1GXYA

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2; crystal form a (p21)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Structure of the Ecto-Adp-Ribosyl Transferase Art2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2002-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gxyA00
1JKYA 1GIQA 2GWMA 4PKQA 5DZQA 1OJZA 4GY2A 2C8GA 4PKSA 3U0JA 4XM6A 1GIRA 5GTTA 1GZEA 4WF6A 2J3VA 1PWUA 4DV8A 5D1TA 1R4BA 4H03A 2C8AA 4FMLA 5H04A 1OG4A 4FK7A 2WN5A 2C8FE 5D1SA 2WN7A 1UZIA 4XM8A 1QS1A 2WN8A 2BOVB 1PWQA 5H03A 4ELNA 1GZFA 2C8DA 1GY0A 4XM7A 4XSHB 1GXZA 3NTSA 1J7NA 4H0VA 4PKRA 2C89A 1OG3A 2WN6A 4XSGB 4H0YA 1G24A 4PKTA 1PWWA 5D1UA 1YQYA 2A9KB 2GWLA 1PWPA 1OG1A 4PKVA 4PKUA 2J3XA 2C8HA 1GXYA 1OJQA 1QS2A 4GF1A 1PWVA 1R45A 2C8CA 2A78B 1ZXVA 3BW8A 2C8BX 3BUZA 4PKWA 4H0TA 2WN4A 4H0XA 4FXQA 4TR5A 5BWMB 2C8EE 2J3ZA
chains in the Genus database with same CATH superfamily
1JKYA 1GIQA 2GWMA 4PKQA 5DZQA 1OJZA 4GY2A 2C8GA 4PKSA 3U0JA 4XM6A 1GIRA 5GTTA 1GZEA 4WF6A 2J3VA 1PWUA 4DV8A 5D1TA 1R4BA 4H03A 2C8AA 4FMLA 5H04A 1OG4A 4FK7A 2WN5A 2C8FE 5D1SA 2WN7A 1UZIA 4XM8A 1QS1A 2WN8A 2BOVB 1PWQA 5H03A 4ELNA 1GZFA 2C8DA 1GY0A 4XM7A 4XSHB 1GXZA 3NTSA 1J7NA 4H0VA 4PKRA 2C89A 1OG3A 2WN6A 4XSGB 4H0YA 1G24A 4PKTA 1PWWA 5D1UA 1YQYA 2A9KB 2GWLA 1PWPA 1OG1A 4PKVA 4PKUA 2J3XA 2C8HA 1GXYA 1OJQA 1QS2A 4GF1A 1PWVA 1R45A 2C8CA 2A78B 1ZXVA 3BW8A 2C8BX 3BUZA 4PKWA 4H0TA 2WN4A 4H0XA 4FXQA 4TR5A 5BWMB 2C8EE 2J3ZA
chains in the Genus database with same CATH topology
1JKYA 1GIQA 2GWMA 4PKQA 5DZQA 1OJZA 4GY2A 2C8GA 4PKSA 3U0JA 4XM6A 1GIRA 5GTTA 1GZEA 4WF6A 2J3VA 1PWUA 4DV8A 5D1TA 1R4BA 4H03A 2C8AA 4FMLA 5H04A 1OG4A 4FK7A 2WN5A 2C8FE 5D1SA 2WN7A 1UZIA 4XM8A 1QS1A 2WN8A 2BOVB 1PWQA 5H03A 4ELNA 1GZFA 2C8DA 1GY0A 4XM7A 4XSHB 1GXZA 3NTSA 1J7NA 4H0VA 4PKRA 2C89A 1OG3A 2WN6A 4XSGB 4H0YA 1G24A 4PKTA 1PWWA 5D1UA 1YQYA 2A9KB 2GWLA 1PWPA 1OG1A 4PKVA 4PKUA 2J3XA 2C8HA 1GXYA 1OJQA 1QS2A 4GF1A 1PWVA 1R45A 2C8CA 2A78B 1ZXVA 3BW8A 2C8BX 3BUZA 4PKWA 4H0TA 2WN4A 4H0XA 4FXQA 4TR5A 5BWMB 2C8EE 2J3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKY A;  1GIQ A;  2GWM A;  4PKQ A;  5DZQ A;  1OJZ A;  4GY2 A;  2C8G A;  4PKS A;  3U0J A;  4XM6 A;  1GIR A;  5GTT A;  1GZE A;  4WF6 A;  2J3V A;  1PWU A;  4DV8 A;  5D1T A;  1R4B A;  4H03 A;  2C8A A;  4FML A;  5H04 A;  1OG4 A;  4FK7 A;  2WN5 A;  2C8F E;  5D1S A;  2WN7 A;  1UZI A;  4XM8 A;  1QS1 A;  2WN8 A;  2BOV B;  1PWQ A;  5H03 A;  4ELN A;  1GZF A;  2C8D A;  1GY0 A;  4XM7 A;  4XSH B;  1GXZ A;  3NTS A;  1J7N A;  4H0V A;  4PKR A;  2C89 A;  1OG3 A;  2WN6 A;  4XSG B;  4H0Y A;  1G24 A;  4PKT A;  1PWW A;  5D1U A;  1YQY A;  2A9K B;  2GWL A;  1PWP A;  1OG1 A;  4PKV A;  4PKU A;  2J3X A;  2C8H A;  1GXY A;  1OJQ A;  1QS2 A;  4GF1 A;  1PWV A;  1R45 A;  2C8C A;  2A78 B;  1ZXV A;  3BW8 A;  2C8B X;  3BUZ A;  4PKW A;  4H0T A;  2WN4 A;  4H0X A;  4FXQ A;  4TR5 A;  5BWM B;  2C8E E;  2J3Z A; 
#chains in the Genus database with same CATH topology
 1JKY A;  1GIQ A;  2GWM A;  4PKQ A;  5DZQ A;  1OJZ A;  4GY2 A;  2C8G A;  4PKS A;  3U0J A;  4XM6 A;  1GIR A;  5GTT A;  1GZE A;  4WF6 A;  2J3V A;  1PWU A;  4DV8 A;  5D1T A;  1R4B A;  4H03 A;  2C8A A;  4FML A;  5H04 A;  1OG4 A;  4FK7 A;  2WN5 A;  2C8F E;  5D1S A;  2WN7 A;  1UZI A;  4XM8 A;  1QS1 A;  2WN8 A;  2BOV B;  1PWQ A;  5H03 A;  4ELN A;  1GZF A;  2C8D A;  1GY0 A;  4XM7 A;  4XSH B;  1GXZ A;  3NTS A;  1J7N A;  4H0V A;  4PKR A;  2C89 A;  1OG3 A;  2WN6 A;  4XSG B;  4H0Y A;  1G24 A;  4PKT A;  1PWW A;  5D1U A;  1YQY A;  2A9K B;  2GWL A;  1PWP A;  1OG1 A;  4PKV A;  4PKU A;  2J3X A;  2C8H A;  1GXY A;  1OJQ A;  1QS2 A;  4GF1 A;  1PWV A;  1R45 A;  2C8C A;  2A78 B;  1ZXV A;  3BW8 A;  2C8B X;  3BUZ A;  4PKW A;  4H0T A;  2WN4 A;  4H0X A;  4FXQ A;  4TR5 A;  5BWM B;  2C8E E;  2J3Z A; 
#chains in the Genus database with same CATH homology
 1JKY A;  1GIQ A;  2GWM A;  4PKQ A;  5DZQ A;  1OJZ A;  4GY2 A;  2C8G A;  4PKS A;  3U0J A;  4XM6 A;  1GIR A;  5GTT A;  1GZE A;  4WF6 A;  2J3V A;  1PWU A;  4DV8 A;  5D1T A;  1R4B A;  4H03 A;  2C8A A;  4FML A;  5H04 A;  1OG4 A;  4FK7 A;  2WN5 A;  2C8F E;  5D1S A;  2WN7 A;  1UZI A;  4XM8 A;  1QS1 A;  2WN8 A;  2BOV B;  1PWQ A;  5H03 A;  4ELN A;  1GZF A;  2C8D A;  1GY0 A;  4XM7 A;  4XSH B;  1GXZ A;  3NTS A;  1J7N A;  4H0V A;  4PKR A;  2C89 A;  1OG3 A;  2WN6 A;  4XSG B;  4H0Y A;  1G24 A;  4PKT A;  1PWW A;  5D1U A;  1YQY A;  2A9K B;  2GWL A;  1PWP A;  1OG1 A;  4PKV A;  4PKU A;  2J3X A;  2C8H A;  1GXY A;  1OJQ A;  1QS2 A;  4GF1 A;  1PWV A;  1R45 A;  2C8C A;  2A78 B;  1ZXV A;  3BW8 A;  2C8B X;  3BUZ A;  4PKW A;  4H0T A;  2WN4 A;  4H0X A;  4FXQ A;  4TR5 A;  5BWM B;  2C8E E;  2J3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...