1GXYA

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2; crystal form a (p21)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Structure of the Ecto-Adp-Ribosyl Transferase Art2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2002-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gxyA00
1PWWA 5H03A 3U0JA 5D1TA 4XM8A 4H03A 1GIQA 4GY2A 4PKUA 5DZQA 4H0VA 2C8HA 1YQYA 2C89A 4PKWA 4FMLA 2J3XA 4XM6A 1OG4A 5BWMB 1PWQA 4H0YA 2WN6A 1OG1A 2WN5A 4PKTA 2WN7A 2C8GA 2WN8A 4PKRA 2GWMA 2J3ZA 4PKQA 4FXQA 4PKSA 1PWPA 1ZXVA 2A9KB 4GF1A 2C8CA 4H0TA 5H04A 1GZFA 4XSHB 5D1UA 1GZEA 1GY0A 4XSGB 1R4BA 1JKYA 1GIRA 1QS2A 3BW8A 1PWUA 5D1SA 1PWVA 4FK7A 1GXYA 4DV8A 2C8FE 3BUZA 1UZIA 5GTTA 1J7NA 1QS1A 4XM7A 4WF6A 4ELNA 2C8BX 2C8DA 1GXZA 4PKVA 2C8EE 2BOVB 4H0XA 3NTSA 1G24A 1OG3A 1OJZA 2A78B 2J3VA 2WN4A 2GWLA 4TR5A 1OJQA 1R45A 2C8AA
chains in the Genus database with same CATH superfamily
1PWWA 5H03A 3U0JA 5D1TA 4XM8A 4H03A 1GIQA 4GY2A 4PKUA 5DZQA 4H0VA 2C8HA 1YQYA 2C89A 4PKWA 4FMLA 2J3XA 4XM6A 1OG4A 5BWMB 1PWQA 4H0YA 2WN6A 1OG1A 2WN5A 4PKTA 2WN7A 2C8GA 2WN8A 4PKRA 2GWMA 2J3ZA 4PKQA 4FXQA 4PKSA 1PWPA 1ZXVA 2A9KB 4GF1A 2C8CA 4H0TA 5H04A 1GZFA 4XSHB 5D1UA 1GZEA 1GY0A 4XSGB 1R4BA 1JKYA 1GIRA 1QS2A 3BW8A 1PWUA 5D1SA 1PWVA 4FK7A 1GXYA 4DV8A 2C8FE 3BUZA 1UZIA 5GTTA 1J7NA 1QS1A 4XM7A 4WF6A 4ELNA 2C8BX 2C8DA 1GXZA 4PKVA 2C8EE 2BOVB 4H0XA 3NTSA 1G24A 1OG3A 1OJZA 2A78B 2J3VA 2WN4A 2GWLA 4TR5A 1OJQA 1R45A 2C8AA
chains in the Genus database with same CATH topology
1PWWA 5H03A 3U0JA 5D1TA 4XM8A 4H03A 1GIQA 4GY2A 4PKUA 5DZQA 4H0VA 2C8HA 1YQYA 2C89A 4PKWA 4FMLA 2J3XA 4XM6A 1OG4A 5BWMB 1PWQA 4H0YA 2WN6A 1OG1A 2WN5A 4PKTA 2WN7A 2C8GA 2WN8A 4PKRA 2GWMA 2J3ZA 4PKQA 4FXQA 4PKSA 1PWPA 1ZXVA 2A9KB 4GF1A 2C8CA 4H0TA 5H04A 1GZFA 4XSHB 5D1UA 1GZEA 1GY0A 4XSGB 1R4BA 1JKYA 1GIRA 1QS2A 3BW8A 1PWUA 5D1SA 1PWVA 4FK7A 1GXYA 4DV8A 2C8FE 3BUZA 1UZIA 5GTTA 1J7NA 1QS1A 4XM7A 4WF6A 4ELNA 2C8BX 2C8DA 1GXZA 4PKVA 2C8EE 2BOVB 4H0XA 3NTSA 1G24A 1OG3A 1OJZA 2A78B 2J3VA 2WN4A 2GWLA 4TR5A 1OJQA 1R45A 2C8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWW A;  5H03 A;  3U0J A;  5D1T A;  4XM8 A;  4H03 A;  1GIQ A;  4GY2 A;  4PKU A;  5DZQ A;  4H0V A;  2C8H A;  1YQY A;  2C89 A;  4PKW A;  4FML A;  2J3X A;  4XM6 A;  1OG4 A;  5BWM B;  1PWQ A;  4H0Y A;  2WN6 A;  1OG1 A;  2WN5 A;  4PKT A;  2WN7 A;  2C8G A;  2WN8 A;  4PKR A;  2GWM A;  2J3Z A;  4PKQ A;  4FXQ A;  4PKS A;  1PWP A;  1ZXV A;  2A9K B;  4GF1 A;  2C8C A;  4H0T A;  5H04 A;  1GZF A;  4XSH B;  5D1U A;  1GZE A;  1GY0 A;  4XSG B;  1R4B A;  1JKY A;  1GIR A;  1QS2 A;  3BW8 A;  1PWU A;  5D1S A;  1PWV A;  4FK7 A;  1GXY A;  4DV8 A;  2C8F E;  3BUZ A;  1UZI A;  5GTT A;  1J7N A;  1QS1 A;  4XM7 A;  4WF6 A;  4ELN A;  2C8B X;  2C8D A;  1GXZ A;  4PKV A;  2C8E E;  2BOV B;  4H0X A;  3NTS A;  1G24 A;  1OG3 A;  1OJZ A;  2A78 B;  2J3V A;  2WN4 A;  2GWL A;  4TR5 A;  1OJQ A;  1R45 A;  2C8A A; 
#chains in the Genus database with same CATH topology
 1PWW A;  5H03 A;  3U0J A;  5D1T A;  4XM8 A;  4H03 A;  1GIQ A;  4GY2 A;  4PKU A;  5DZQ A;  4H0V A;  2C8H A;  1YQY A;  2C89 A;  4PKW A;  4FML A;  2J3X A;  4XM6 A;  1OG4 A;  5BWM B;  1PWQ A;  4H0Y A;  2WN6 A;  1OG1 A;  2WN5 A;  4PKT A;  2WN7 A;  2C8G A;  2WN8 A;  4PKR A;  2GWM A;  2J3Z A;  4PKQ A;  4FXQ A;  4PKS A;  1PWP A;  1ZXV A;  2A9K B;  4GF1 A;  2C8C A;  4H0T A;  5H04 A;  1GZF A;  4XSH B;  5D1U A;  1GZE A;  1GY0 A;  4XSG B;  1R4B A;  1JKY A;  1GIR A;  1QS2 A;  3BW8 A;  1PWU A;  5D1S A;  1PWV A;  4FK7 A;  1GXY A;  4DV8 A;  2C8F E;  3BUZ A;  1UZI A;  5GTT A;  1J7N A;  1QS1 A;  4XM7 A;  4WF6 A;  4ELN A;  2C8B X;  2C8D A;  1GXZ A;  4PKV A;  2C8E E;  2BOV B;  4H0X A;  3NTS A;  1G24 A;  1OG3 A;  1OJZ A;  2A78 B;  2J3V A;  2WN4 A;  2GWL A;  4TR5 A;  1OJQ A;  1R45 A;  2C8A A; 
#chains in the Genus database with same CATH homology
 1PWW A;  5H03 A;  3U0J A;  5D1T A;  4XM8 A;  4H03 A;  1GIQ A;  4GY2 A;  4PKU A;  5DZQ A;  4H0V A;  2C8H A;  1YQY A;  2C89 A;  4PKW A;  4FML A;  2J3X A;  4XM6 A;  1OG4 A;  5BWM B;  1PWQ A;  4H0Y A;  2WN6 A;  1OG1 A;  2WN5 A;  4PKT A;  2WN7 A;  2C8G A;  2WN8 A;  4PKR A;  2GWM A;  2J3Z A;  4PKQ A;  4FXQ A;  4PKS A;  1PWP A;  1ZXV A;  2A9K B;  4GF1 A;  2C8C A;  4H0T A;  5H04 A;  1GZF A;  4XSH B;  5D1U A;  1GZE A;  1GY0 A;  4XSG B;  1R4B A;  1JKY A;  1GIR A;  1QS2 A;  3BW8 A;  1PWU A;  5D1S A;  1PWV A;  4FK7 A;  1GXY A;  4DV8 A;  2C8F E;  3BUZ A;  1UZI A;  5GTT A;  1J7N A;  1QS1 A;  4XM7 A;  4WF6 A;  4ELN A;  2C8B X;  2C8D A;  1GXZ A;  4PKV A;  2C8E E;  2BOV B;  4H0X A;  3NTS A;  1G24 A;  1OG3 A;  1OJZ A;  2A78 B;  2J3V A;  2WN4 A;  2GWL A;  4TR5 A;  1OJQ A;  1R45 A;  2C8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...