1OG3A

Crystal structure of the eukaryotic mono-adp-ribosyltransferase art2.2 mutant e189i in complex with nad
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEIVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og3A00
3BW8A 2WN4A 2GWMA 4PKWA 1OG1A 4FK7A 2A78B 4PKRA 2C8BX 2GWLA 4GY2A 5BWMB 1ZXVA 2J3ZA 3BUZA 4PKQA 4XM7A 2A9KB 5DZQA 1OG4A 2J3VA 1R45A 1YQYA 1J7NA 1PWVA 5H03A 2C8AA 4ELNA 1GXZA 3NTSA 2J3XA 1GZFA 2C8FE 4PKSA 2WN8A 1R4BA 4DV8A 4H0TA 5H04A 1GIQA 5D1SA 1GIRA 1OJQA 4H0XA 1G24A 2C8GA 4H03A 2C8EE 2C8DA 1GXYA 4XM6A 4PKUA 2WN5A 4PKTA 5D1TA 4FXQA 2WN7A 4H0VA 2C8HA 1OJZA 4FMLA 1PWWA 1UZIA 2C8CA 4TR5A 1OG3A 1PWPA 2WN6A 1GZEA 5GTTA 4XSGB 1QS1A 4XSHB 5D1UA 1PWQA 1PWUA 2C89A 1JKYA 1QS2A 4XM8A 2BOVB 4WF6A 4GF1A 4H0YA 1GY0A 4PKVA 3U0JA
chains in the Genus database with same CATH superfamily
3BW8A 2WN4A 2GWMA 4PKWA 1OG1A 4FK7A 2A78B 4PKRA 2C8BX 2GWLA 4GY2A 5BWMB 1ZXVA 2J3ZA 3BUZA 4PKQA 4XM7A 2A9KB 5DZQA 1OG4A 2J3VA 1R45A 1YQYA 1J7NA 1PWVA 5H03A 2C8AA 4ELNA 1GXZA 3NTSA 2J3XA 1GZFA 2C8FE 4PKSA 2WN8A 1R4BA 4DV8A 4H0TA 5H04A 1GIQA 5D1SA 1GIRA 1OJQA 4H0XA 1G24A 2C8GA 4H03A 2C8EE 2C8DA 1GXYA 4XM6A 4PKUA 2WN5A 4PKTA 5D1TA 4FXQA 2WN7A 4H0VA 2C8HA 1OJZA 4FMLA 1PWWA 1UZIA 2C8CA 4TR5A 1OG3A 1PWPA 2WN6A 1GZEA 5GTTA 4XSGB 1QS1A 4XSHB 5D1UA 1PWQA 1PWUA 2C89A 1JKYA 1QS2A 4XM8A 2BOVB 4WF6A 4GF1A 4H0YA 1GY0A 4PKVA 3U0JA
chains in the Genus database with same CATH topology
3BW8A 2WN4A 2GWMA 4PKWA 1OG1A 4FK7A 2A78B 4PKRA 2C8BX 2GWLA 4GY2A 5BWMB 1ZXVA 2J3ZA 3BUZA 4PKQA 4XM7A 2A9KB 5DZQA 1OG4A 2J3VA 1R45A 1YQYA 1J7NA 1PWVA 5H03A 2C8AA 4ELNA 1GXZA 3NTSA 2J3XA 1GZFA 2C8FE 4PKSA 2WN8A 1R4BA 4DV8A 4H0TA 5H04A 1GIQA 5D1SA 1GIRA 1OJQA 4H0XA 1G24A 2C8GA 4H03A 2C8EE 2C8DA 1GXYA 4XM6A 4PKUA 2WN5A 4PKTA 5D1TA 4FXQA 2WN7A 4H0VA 2C8HA 1OJZA 4FMLA 1PWWA 1UZIA 2C8CA 4TR5A 1OG3A 1PWPA 2WN6A 1GZEA 5GTTA 4XSGB 1QS1A 4XSHB 5D1UA 1PWQA 1PWUA 2C89A 1JKYA 1QS2A 4XM8A 2BOVB 4WF6A 4GF1A 4H0YA 1GY0A 4PKVA 3U0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW8 A;  2WN4 A;  2GWM A;  4PKW A;  1OG1 A;  4FK7 A;  2A78 B;  4PKR A;  2C8B X;  2GWL A;  4GY2 A;  5BWM B;  1ZXV A;  2J3Z A;  3BUZ A;  4PKQ A;  4XM7 A;  2A9K B;  5DZQ A;  1OG4 A;  2J3V A;  1R45 A;  1YQY A;  1J7N A;  1PWV A;  5H03 A;  2C8A A;  4ELN A;  1GXZ A;  3NTS A;  2J3X A;  1GZF A;  2C8F E;  4PKS A;  2WN8 A;  1R4B A;  4DV8 A;  4H0T A;  5H04 A;  1GIQ A;  5D1S A;  1GIR A;  1OJQ A;  4H0X A;  1G24 A;  2C8G A;  4H03 A;  2C8E E;  2C8D A;  1GXY A;  4XM6 A;  4PKU A;  2WN5 A;  4PKT A;  5D1T A;  4FXQ A;  2WN7 A;  4H0V A;  2C8H A;  1OJZ A;  4FML A;  1PWW A;  1UZI A;  2C8C A;  4TR5 A;  1OG3 A;  1PWP A;  2WN6 A;  1GZE A;  5GTT A;  4XSG B;  1QS1 A;  4XSH B;  5D1U A;  1PWQ A;  1PWU A;  2C89 A;  1JKY A;  1QS2 A;  4XM8 A;  2BOV B;  4WF6 A;  4GF1 A;  4H0Y A;  1GY0 A;  4PKV A;  3U0J A; 
#chains in the Genus database with same CATH topology
 3BW8 A;  2WN4 A;  2GWM A;  4PKW A;  1OG1 A;  4FK7 A;  2A78 B;  4PKR A;  2C8B X;  2GWL A;  4GY2 A;  5BWM B;  1ZXV A;  2J3Z A;  3BUZ A;  4PKQ A;  4XM7 A;  2A9K B;  5DZQ A;  1OG4 A;  2J3V A;  1R45 A;  1YQY A;  1J7N A;  1PWV A;  5H03 A;  2C8A A;  4ELN A;  1GXZ A;  3NTS A;  2J3X A;  1GZF A;  2C8F E;  4PKS A;  2WN8 A;  1R4B A;  4DV8 A;  4H0T A;  5H04 A;  1GIQ A;  5D1S A;  1GIR A;  1OJQ A;  4H0X A;  1G24 A;  2C8G A;  4H03 A;  2C8E E;  2C8D A;  1GXY A;  4XM6 A;  4PKU A;  2WN5 A;  4PKT A;  5D1T A;  4FXQ A;  2WN7 A;  4H0V A;  2C8H A;  1OJZ A;  4FML A;  1PWW A;  1UZI A;  2C8C A;  4TR5 A;  1OG3 A;  1PWP A;  2WN6 A;  1GZE A;  5GTT A;  4XSG B;  1QS1 A;  4XSH B;  5D1U A;  1PWQ A;  1PWU A;  2C89 A;  1JKY A;  1QS2 A;  4XM8 A;  2BOV B;  4WF6 A;  4GF1 A;  4H0Y A;  1GY0 A;  4PKV A;  3U0J A; 
#chains in the Genus database with same CATH homology
 3BW8 A;  2WN4 A;  2GWM A;  4PKW A;  1OG1 A;  4FK7 A;  2A78 B;  4PKR A;  2C8B X;  2GWL A;  4GY2 A;  5BWM B;  1ZXV A;  2J3Z A;  3BUZ A;  4PKQ A;  4XM7 A;  2A9K B;  5DZQ A;  1OG4 A;  2J3V A;  1R45 A;  1YQY A;  1J7N A;  1PWV A;  5H03 A;  2C8A A;  4ELN A;  1GXZ A;  3NTS A;  2J3X A;  1GZF A;  2C8F E;  4PKS A;  2WN8 A;  1R4B A;  4DV8 A;  4H0T A;  5H04 A;  1GIQ A;  5D1S A;  1GIR A;  1OJQ A;  4H0X A;  1G24 A;  2C8G A;  4H03 A;  2C8E E;  2C8D A;  1GXY A;  4XM6 A;  4PKU A;  2WN5 A;  4PKT A;  5D1T A;  4FXQ A;  2WN7 A;  4H0V A;  2C8H A;  1OJZ A;  4FML A;  1PWW A;  1UZI A;  2C8C A;  4TR5 A;  1OG3 A;  1PWP A;  2WN6 A;  1GZE A;  5GTT A;  4XSG B;  1QS1 A;  4XSH B;  5D1U A;  1PWQ A;  1PWU A;  2C89 A;  1JKY A;  1QS2 A;  4XM8 A;  2BOV B;  4WF6 A;  4GF1 A;  4H0Y A;  1GY0 A;  4PKV A;  3U0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...