1OG3A

Crystal structure of the eukaryotic mono-adp-ribosyltransferase art2.2 mutant e189i in complex with nad
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEIVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og3A00
1PWQA 2GWLA 5D1SA 2WN8A 4GF1A 1OG3A 1OJQA 1R45A 2WN6A 1G24A 4ELNA 1PWWA 2C89A 4H0VA 1YQYA 2J3XA 1GZFA 4PKVA 1PWPA 1PWVA 2WN5A 4H0TA 4XSHB 4GY2A 4XSGB 5DZQA 2J3ZA 4PKQA 1GXZA 1J7NA 2BOVB 2J3VA 1QS1A 5D1UA 2C8HA 1GIQA 2C8FE 2WN4A 4FK7A 4XM6A 4PKUA 1OJZA 5GTTA 2C8EE 5BWMB 2C8CA 3BUZA 1GZEA 2C8DA 4TR5A 5D1TA 4H0XA 2A78B 3U0JA 1ZXVA 2C8BX 4PKTA 1GIRA 1GXYA 1GY0A 4WF6A 5H04A 4XM8A 4FXQA 1PWUA 2A9KB 1QS2A 5H03A 1OG1A 4PKSA 4XM7A 4H0YA 2C8AA 4FMLA 4DV8A 4H03A 3NTSA 2GWMA 1UZIA 2C8GA 4PKWA 3BW8A 1R4BA 1JKYA 1OG4A 2WN7A 4PKRA
chains in the Genus database with same CATH superfamily
1PWQA 2GWLA 5D1SA 2WN8A 4GF1A 1OG3A 1OJQA 1R45A 2WN6A 1G24A 4ELNA 1PWWA 2C89A 4H0VA 1YQYA 2J3XA 1GZFA 4PKVA 1PWPA 1PWVA 2WN5A 4H0TA 4XSHB 4GY2A 4XSGB 5DZQA 2J3ZA 4PKQA 1GXZA 1J7NA 2BOVB 2J3VA 1QS1A 5D1UA 2C8HA 1GIQA 2C8FE 2WN4A 4FK7A 4XM6A 4PKUA 1OJZA 5GTTA 2C8EE 5BWMB 2C8CA 3BUZA 1GZEA 2C8DA 4TR5A 5D1TA 4H0XA 2A78B 3U0JA 1ZXVA 2C8BX 4PKTA 1GIRA 1GXYA 1GY0A 4WF6A 5H04A 4XM8A 4FXQA 1PWUA 2A9KB 1QS2A 5H03A 1OG1A 4PKSA 4XM7A 4H0YA 2C8AA 4FMLA 4DV8A 4H03A 3NTSA 2GWMA 1UZIA 2C8GA 4PKWA 3BW8A 1R4BA 1JKYA 1OG4A 2WN7A 4PKRA
chains in the Genus database with same CATH topology
1PWQA 2GWLA 5D1SA 2WN8A 4GF1A 1OG3A 1OJQA 1R45A 2WN6A 1G24A 4ELNA 1PWWA 2C89A 4H0VA 1YQYA 2J3XA 1GZFA 4PKVA 1PWPA 1PWVA 2WN5A 4H0TA 4XSHB 4GY2A 4XSGB 5DZQA 2J3ZA 4PKQA 1GXZA 1J7NA 2BOVB 2J3VA 1QS1A 5D1UA 2C8HA 1GIQA 2C8FE 2WN4A 4FK7A 4XM6A 4PKUA 1OJZA 5GTTA 2C8EE 5BWMB 2C8CA 3BUZA 1GZEA 2C8DA 4TR5A 5D1TA 4H0XA 2A78B 3U0JA 1ZXVA 2C8BX 4PKTA 1GIRA 1GXYA 1GY0A 4WF6A 5H04A 4XM8A 4FXQA 1PWUA 2A9KB 1QS2A 5H03A 1OG1A 4PKSA 4XM7A 4H0YA 2C8AA 4FMLA 4DV8A 4H03A 3NTSA 2GWMA 1UZIA 2C8GA 4PKWA 3BW8A 1R4BA 1JKYA 1OG4A 2WN7A 4PKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWQ A;  2GWL A;  5D1S A;  2WN8 A;  4GF1 A;  1OG3 A;  1OJQ A;  1R45 A;  2WN6 A;  1G24 A;  4ELN A;  1PWW A;  2C89 A;  4H0V A;  1YQY A;  2J3X A;  1GZF A;  4PKV A;  1PWP A;  1PWV A;  2WN5 A;  4H0T A;  4XSH B;  4GY2 A;  4XSG B;  5DZQ A;  2J3Z A;  4PKQ A;  1GXZ A;  1J7N A;  2BOV B;  2J3V A;  1QS1 A;  5D1U A;  2C8H A;  1GIQ A;  2C8F E;  2WN4 A;  4FK7 A;  4XM6 A;  4PKU A;  1OJZ A;  5GTT A;  2C8E E;  5BWM B;  2C8C A;  3BUZ A;  1GZE A;  2C8D A;  4TR5 A;  5D1T A;  4H0X A;  2A78 B;  3U0J A;  1ZXV A;  2C8B X;  4PKT A;  1GIR A;  1GXY A;  1GY0 A;  4WF6 A;  5H04 A;  4XM8 A;  4FXQ A;  1PWU A;  2A9K B;  1QS2 A;  5H03 A;  1OG1 A;  4PKS A;  4XM7 A;  4H0Y A;  2C8A A;  4FML A;  4DV8 A;  4H03 A;  3NTS A;  2GWM A;  1UZI A;  2C8G A;  4PKW A;  3BW8 A;  1R4B A;  1JKY A;  1OG4 A;  2WN7 A;  4PKR A; 
#chains in the Genus database with same CATH topology
 1PWQ A;  2GWL A;  5D1S A;  2WN8 A;  4GF1 A;  1OG3 A;  1OJQ A;  1R45 A;  2WN6 A;  1G24 A;  4ELN A;  1PWW A;  2C89 A;  4H0V A;  1YQY A;  2J3X A;  1GZF A;  4PKV A;  1PWP A;  1PWV A;  2WN5 A;  4H0T A;  4XSH B;  4GY2 A;  4XSG B;  5DZQ A;  2J3Z A;  4PKQ A;  1GXZ A;  1J7N A;  2BOV B;  2J3V A;  1QS1 A;  5D1U A;  2C8H A;  1GIQ A;  2C8F E;  2WN4 A;  4FK7 A;  4XM6 A;  4PKU A;  1OJZ A;  5GTT A;  2C8E E;  5BWM B;  2C8C A;  3BUZ A;  1GZE A;  2C8D A;  4TR5 A;  5D1T A;  4H0X A;  2A78 B;  3U0J A;  1ZXV A;  2C8B X;  4PKT A;  1GIR A;  1GXY A;  1GY0 A;  4WF6 A;  5H04 A;  4XM8 A;  4FXQ A;  1PWU A;  2A9K B;  1QS2 A;  5H03 A;  1OG1 A;  4PKS A;  4XM7 A;  4H0Y A;  2C8A A;  4FML A;  4DV8 A;  4H03 A;  3NTS A;  2GWM A;  1UZI A;  2C8G A;  4PKW A;  3BW8 A;  1R4B A;  1JKY A;  1OG4 A;  2WN7 A;  4PKR A; 
#chains in the Genus database with same CATH homology
 1PWQ A;  2GWL A;  5D1S A;  2WN8 A;  4GF1 A;  1OG3 A;  1OJQ A;  1R45 A;  2WN6 A;  1G24 A;  4ELN A;  1PWW A;  2C89 A;  4H0V A;  1YQY A;  2J3X A;  1GZF A;  4PKV A;  1PWP A;  1PWV A;  2WN5 A;  4H0T A;  4XSH B;  4GY2 A;  4XSG B;  5DZQ A;  2J3Z A;  4PKQ A;  1GXZ A;  1J7N A;  2BOV B;  2J3V A;  1QS1 A;  5D1U A;  2C8H A;  1GIQ A;  2C8F E;  2WN4 A;  4FK7 A;  4XM6 A;  4PKU A;  1OJZ A;  5GTT A;  2C8E E;  5BWM B;  2C8C A;  3BUZ A;  1GZE A;  2C8D A;  4TR5 A;  5D1T A;  4H0X A;  2A78 B;  3U0J A;  1ZXV A;  2C8B X;  4PKT A;  1GIR A;  1GXY A;  1GY0 A;  4WF6 A;  5H04 A;  4XM8 A;  4FXQ A;  1PWU A;  2A9K B;  1QS2 A;  5H03 A;  1OG1 A;  4PKS A;  4XM7 A;  4H0Y A;  2C8A A;  4FML A;  4DV8 A;  4H03 A;  3NTS A;  2GWM A;  1UZI A;  2C8G A;  4PKW A;  3BW8 A;  1R4B A;  1JKY A;  1OG4 A;  2WN7 A;  4PKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...