1GZEA

Structure of the clostridium botulinum c3 exoenzyme (l177c mutant)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
207
structure length
207
Chain Sequence
AYSNTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSCMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Nad Binding Induces Conformational Changes in Rho Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 55
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gzeA00
4GF1A 2C8DA 2WN5A 1JKYA 1PWPA 1GXYA 2C8BX 5H03A 1GZEA 2GWMA 4PKRA 4XSHB 2A9KB 5DZQA 3U0JA 1OJQA 2C89A 1PWVA 5BWMB 1GIRA 5H04A 2WN6A 4PKUA 1YQYA 5D1SA 4PKTA 4XM8A 1G24A 4FK7A 4PKQA 1ZXVA 1J7NA 1UZIA 2J3VA 4FXQA 1GZFA 4XM7A 1PWQA 1PWWA 2C8EE 5D1UA 4ELNA 2A78B 1R4BA 4WF6A 4GY2A 2GWLA 1QS2A 2WN8A 1OJZA 4XSGB 2C8FE 1R45A 3NTSA 4XM6A 3BUZA 2BOVB 4PKVA 1GIQA 4TR5A 2C8AA 3BW8A 4PKWA 4H03A 2C8HA 2C8CA 1GY0A 1PWUA 1OG1A 2WN4A 2J3XA 4PKSA 1GXZA 1QS1A 5GTTA 4H0YA 2J3ZA 4DV8A 2WN7A 4H0XA 4H0VA 1OG3A 2C8GA 4H0TA 1OG4A 4FMLA 5D1TA
chains in the Genus database with same CATH superfamily
4GF1A 2C8DA 2WN5A 1JKYA 1PWPA 1GXYA 2C8BX 5H03A 1GZEA 2GWMA 4PKRA 4XSHB 2A9KB 5DZQA 3U0JA 1OJQA 2C89A 1PWVA 5BWMB 1GIRA 5H04A 2WN6A 4PKUA 1YQYA 5D1SA 4PKTA 4XM8A 1G24A 4FK7A 4PKQA 1ZXVA 1J7NA 1UZIA 2J3VA 4FXQA 1GZFA 4XM7A 1PWQA 1PWWA 2C8EE 5D1UA 4ELNA 2A78B 1R4BA 4WF6A 4GY2A 2GWLA 1QS2A 2WN8A 1OJZA 4XSGB 2C8FE 1R45A 3NTSA 4XM6A 3BUZA 2BOVB 4PKVA 1GIQA 4TR5A 2C8AA 3BW8A 4PKWA 4H03A 2C8HA 2C8CA 1GY0A 1PWUA 1OG1A 2WN4A 2J3XA 4PKSA 1GXZA 1QS1A 5GTTA 4H0YA 2J3ZA 4DV8A 2WN7A 4H0XA 4H0VA 1OG3A 2C8GA 4H0TA 1OG4A 4FMLA 5D1TA
chains in the Genus database with same CATH topology
4GF1A 2C8DA 2WN5A 1JKYA 1PWPA 1GXYA 2C8BX 5H03A 1GZEA 2GWMA 4PKRA 4XSHB 2A9KB 5DZQA 3U0JA 1OJQA 2C89A 1PWVA 5BWMB 1GIRA 5H04A 2WN6A 4PKUA 1YQYA 5D1SA 4PKTA 4XM8A 1G24A 4FK7A 4PKQA 1ZXVA 1J7NA 1UZIA 2J3VA 4FXQA 1GZFA 4XM7A 1PWQA 1PWWA 2C8EE 5D1UA 4ELNA 2A78B 1R4BA 4WF6A 4GY2A 2GWLA 1QS2A 2WN8A 1OJZA 4XSGB 2C8FE 1R45A 3NTSA 4XM6A 3BUZA 2BOVB 4PKVA 1GIQA 4TR5A 2C8AA 3BW8A 4PKWA 4H03A 2C8HA 2C8CA 1GY0A 1PWUA 1OG1A 2WN4A 2J3XA 4PKSA 1GXZA 1QS1A 5GTTA 4H0YA 2J3ZA 4DV8A 2WN7A 4H0XA 4H0VA 1OG3A 2C8GA 4H0TA 1OG4A 4FMLA 5D1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GF1 A;  2C8D A;  2WN5 A;  1JKY A;  1PWP A;  1GXY A;  2C8B X;  5H03 A;  1GZE A;  2GWM A;  4PKR A;  4XSH B;  2A9K B;  5DZQ A;  3U0J A;  1OJQ A;  2C89 A;  1PWV A;  5BWM B;  1GIR A;  5H04 A;  2WN6 A;  4PKU A;  1YQY A;  5D1S A;  4PKT A;  4XM8 A;  1G24 A;  4FK7 A;  4PKQ A;  1ZXV A;  1J7N A;  1UZI A;  2J3V A;  4FXQ A;  1GZF A;  4XM7 A;  1PWQ A;  1PWW A;  2C8E E;  5D1U A;  4ELN A;  2A78 B;  1R4B A;  4WF6 A;  4GY2 A;  2GWL A;  1QS2 A;  2WN8 A;  1OJZ A;  4XSG B;  2C8F E;  1R45 A;  3NTS A;  4XM6 A;  3BUZ A;  2BOV B;  4PKV A;  1GIQ A;  4TR5 A;  2C8A A;  3BW8 A;  4PKW A;  4H03 A;  2C8H A;  2C8C A;  1GY0 A;  1PWU A;  1OG1 A;  2WN4 A;  2J3X A;  4PKS A;  1GXZ A;  1QS1 A;  5GTT A;  4H0Y A;  2J3Z A;  4DV8 A;  2WN7 A;  4H0X A;  4H0V A;  1OG3 A;  2C8G A;  4H0T A;  1OG4 A;  4FML A;  5D1T A; 
#chains in the Genus database with same CATH topology
 4GF1 A;  2C8D A;  2WN5 A;  1JKY A;  1PWP A;  1GXY A;  2C8B X;  5H03 A;  1GZE A;  2GWM A;  4PKR A;  4XSH B;  2A9K B;  5DZQ A;  3U0J A;  1OJQ A;  2C89 A;  1PWV A;  5BWM B;  1GIR A;  5H04 A;  2WN6 A;  4PKU A;  1YQY A;  5D1S A;  4PKT A;  4XM8 A;  1G24 A;  4FK7 A;  4PKQ A;  1ZXV A;  1J7N A;  1UZI A;  2J3V A;  4FXQ A;  1GZF A;  4XM7 A;  1PWQ A;  1PWW A;  2C8E E;  5D1U A;  4ELN A;  2A78 B;  1R4B A;  4WF6 A;  4GY2 A;  2GWL A;  1QS2 A;  2WN8 A;  1OJZ A;  4XSG B;  2C8F E;  1R45 A;  3NTS A;  4XM6 A;  3BUZ A;  2BOV B;  4PKV A;  1GIQ A;  4TR5 A;  2C8A A;  3BW8 A;  4PKW A;  4H03 A;  2C8H A;  2C8C A;  1GY0 A;  1PWU A;  1OG1 A;  2WN4 A;  2J3X A;  4PKS A;  1GXZ A;  1QS1 A;  5GTT A;  4H0Y A;  2J3Z A;  4DV8 A;  2WN7 A;  4H0X A;  4H0V A;  1OG3 A;  2C8G A;  4H0T A;  1OG4 A;  4FML A;  5D1T A; 
#chains in the Genus database with same CATH homology
 4GF1 A;  2C8D A;  2WN5 A;  1JKY A;  1PWP A;  1GXY A;  2C8B X;  5H03 A;  1GZE A;  2GWM A;  4PKR A;  4XSH B;  2A9K B;  5DZQ A;  3U0J A;  1OJQ A;  2C89 A;  1PWV A;  5BWM B;  1GIR A;  5H04 A;  2WN6 A;  4PKU A;  1YQY A;  5D1S A;  4PKT A;  4XM8 A;  1G24 A;  4FK7 A;  4PKQ A;  1ZXV A;  1J7N A;  1UZI A;  2J3V A;  4FXQ A;  1GZF A;  4XM7 A;  1PWQ A;  1PWW A;  2C8E E;  5D1U A;  4ELN A;  2A78 B;  1R4B A;  4WF6 A;  4GY2 A;  2GWL A;  1QS2 A;  2WN8 A;  1OJZ A;  4XSG B;  2C8F E;  1R45 A;  3NTS A;  4XM6 A;  3BUZ A;  2BOV B;  4PKV A;  1GIQ A;  4TR5 A;  2C8A A;  3BW8 A;  4PKW A;  4H03 A;  2C8H A;  2C8C A;  1GY0 A;  1PWU A;  1OG1 A;  2WN4 A;  2J3X A;  4PKS A;  1GXZ A;  1QS1 A;  5GTT A;  4H0Y A;  2J3Z A;  4DV8 A;  2WN7 A;  4H0X A;  4H0V A;  1OG3 A;  2C8G A;  4H0T A;  1OG4 A;  4FML A;  5D1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...