1GZEA

Structure of the clostridium botulinum c3 exoenzyme (l177c mutant)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
207
structure length
207
Chain Sequence
AYSNTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSCMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Nad Binding Induces Conformational Changes in Rho Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme
pubmed doi rcsb
source organism Clostridium botulinum
total genus 55
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gzeA00
1OG1A 4PKTA 2C89A 4XM8A 1J7NA 3U0JA 1GXZA 5D1SA 4PKVA 4XM7A 4H03A 2J3VA 1YQYA 1JKYA 1R45A 1OG3A 4XSGB 4PKRA 2J3XA 1OG4A 1ZXVA 1PWQA 1QS1A 4FMLA 4XSHB 4PKUA 4H0VA 3BW8A 4ELNA 4PKQA 2C8GA 5D1UA 1UZIA 4H0YA 4FK7A 4FXQA 2C8AA 2WN6A 5BWMB 2WN5A 1OJQA 2WN8A 1GIRA 1GZEA 2C8BX 1GIQA 4H0TA 4WF6A 2C8FE 5DZQA 3NTSA 2C8HA 1QS2A 4PKWA 4GF1A 2C8CA 2WN4A 1PWPA 4TR5A 4XM6A 1G24A 5H03A 2A9KB 1R4BA 3BUZA 1OJZA 5H04A 5D1TA 5GTTA 4H0XA 4DV8A 2C8DA 1PWVA 2GWLA 2WN7A 1GZFA 1PWWA 2A78B 4PKSA 2C8EE 2J3ZA 2BOVB 1GY0A 4GY2A 1PWUA 2GWMA 1GXYA
chains in the Genus database with same CATH superfamily
1OG1A 4PKTA 2C89A 4XM8A 1J7NA 3U0JA 1GXZA 5D1SA 4PKVA 4XM7A 4H03A 2J3VA 1YQYA 1JKYA 1R45A 1OG3A 4XSGB 4PKRA 2J3XA 1OG4A 1ZXVA 1PWQA 1QS1A 4FMLA 4XSHB 4PKUA 4H0VA 3BW8A 4ELNA 4PKQA 2C8GA 5D1UA 1UZIA 4H0YA 4FK7A 4FXQA 2C8AA 2WN6A 5BWMB 2WN5A 1OJQA 2WN8A 1GIRA 1GZEA 2C8BX 1GIQA 4H0TA 4WF6A 2C8FE 5DZQA 3NTSA 2C8HA 1QS2A 4PKWA 4GF1A 2C8CA 2WN4A 1PWPA 4TR5A 4XM6A 1G24A 5H03A 2A9KB 1R4BA 3BUZA 1OJZA 5H04A 5D1TA 5GTTA 4H0XA 4DV8A 2C8DA 1PWVA 2GWLA 2WN7A 1GZFA 1PWWA 2A78B 4PKSA 2C8EE 2J3ZA 2BOVB 1GY0A 4GY2A 1PWUA 2GWMA 1GXYA
chains in the Genus database with same CATH topology
1OG1A 4PKTA 2C89A 4XM8A 1J7NA 3U0JA 1GXZA 5D1SA 4PKVA 4XM7A 4H03A 2J3VA 1YQYA 1JKYA 1R45A 1OG3A 4XSGB 4PKRA 2J3XA 1OG4A 1ZXVA 1PWQA 1QS1A 4FMLA 4XSHB 4PKUA 4H0VA 3BW8A 4ELNA 4PKQA 2C8GA 5D1UA 1UZIA 4H0YA 4FK7A 4FXQA 2C8AA 2WN6A 5BWMB 2WN5A 1OJQA 2WN8A 1GIRA 1GZEA 2C8BX 1GIQA 4H0TA 4WF6A 2C8FE 5DZQA 3NTSA 2C8HA 1QS2A 4PKWA 4GF1A 2C8CA 2WN4A 1PWPA 4TR5A 4XM6A 1G24A 5H03A 2A9KB 1R4BA 3BUZA 1OJZA 5H04A 5D1TA 5GTTA 4H0XA 4DV8A 2C8DA 1PWVA 2GWLA 2WN7A 1GZFA 1PWWA 2A78B 4PKSA 2C8EE 2J3ZA 2BOVB 1GY0A 4GY2A 1PWUA 2GWMA 1GXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OG1 A;  4PKT A;  2C89 A;  4XM8 A;  1J7N A;  3U0J A;  1GXZ A;  5D1S A;  4PKV A;  4XM7 A;  4H03 A;  2J3V A;  1YQY A;  1JKY A;  1R45 A;  1OG3 A;  4XSG B;  4PKR A;  2J3X A;  1OG4 A;  1ZXV A;  1PWQ A;  1QS1 A;  4FML A;  4XSH B;  4PKU A;  4H0V A;  3BW8 A;  4ELN A;  4PKQ A;  2C8G A;  5D1U A;  1UZI A;  4H0Y A;  4FK7 A;  4FXQ A;  2C8A A;  2WN6 A;  5BWM B;  2WN5 A;  1OJQ A;  2WN8 A;  1GIR A;  1GZE A;  2C8B X;  1GIQ A;  4H0T A;  4WF6 A;  2C8F E;  5DZQ A;  3NTS A;  2C8H A;  1QS2 A;  4PKW A;  4GF1 A;  2C8C A;  2WN4 A;  1PWP A;  4TR5 A;  4XM6 A;  1G24 A;  5H03 A;  2A9K B;  1R4B A;  3BUZ A;  1OJZ A;  5H04 A;  5D1T A;  5GTT A;  4H0X A;  4DV8 A;  2C8D A;  1PWV A;  2GWL A;  2WN7 A;  1GZF A;  1PWW A;  2A78 B;  4PKS A;  2C8E E;  2J3Z A;  2BOV B;  1GY0 A;  4GY2 A;  1PWU A;  2GWM A;  1GXY A; 
#chains in the Genus database with same CATH topology
 1OG1 A;  4PKT A;  2C89 A;  4XM8 A;  1J7N A;  3U0J A;  1GXZ A;  5D1S A;  4PKV A;  4XM7 A;  4H03 A;  2J3V A;  1YQY A;  1JKY A;  1R45 A;  1OG3 A;  4XSG B;  4PKR A;  2J3X A;  1OG4 A;  1ZXV A;  1PWQ A;  1QS1 A;  4FML A;  4XSH B;  4PKU A;  4H0V A;  3BW8 A;  4ELN A;  4PKQ A;  2C8G A;  5D1U A;  1UZI A;  4H0Y A;  4FK7 A;  4FXQ A;  2C8A A;  2WN6 A;  5BWM B;  2WN5 A;  1OJQ A;  2WN8 A;  1GIR A;  1GZE A;  2C8B X;  1GIQ A;  4H0T A;  4WF6 A;  2C8F E;  5DZQ A;  3NTS A;  2C8H A;  1QS2 A;  4PKW A;  4GF1 A;  2C8C A;  2WN4 A;  1PWP A;  4TR5 A;  4XM6 A;  1G24 A;  5H03 A;  2A9K B;  1R4B A;  3BUZ A;  1OJZ A;  5H04 A;  5D1T A;  5GTT A;  4H0X A;  4DV8 A;  2C8D A;  1PWV A;  2GWL A;  2WN7 A;  1GZF A;  1PWW A;  2A78 B;  4PKS A;  2C8E E;  2J3Z A;  2BOV B;  1GY0 A;  4GY2 A;  1PWU A;  2GWM A;  1GXY A; 
#chains in the Genus database with same CATH homology
 1OG1 A;  4PKT A;  2C89 A;  4XM8 A;  1J7N A;  3U0J A;  1GXZ A;  5D1S A;  4PKV A;  4XM7 A;  4H03 A;  2J3V A;  1YQY A;  1JKY A;  1R45 A;  1OG3 A;  4XSG B;  4PKR A;  2J3X A;  1OG4 A;  1ZXV A;  1PWQ A;  1QS1 A;  4FML A;  4XSH B;  4PKU A;  4H0V A;  3BW8 A;  4ELN A;  4PKQ A;  2C8G A;  5D1U A;  1UZI A;  4H0Y A;  4FK7 A;  4FXQ A;  2C8A A;  2WN6 A;  5BWM B;  2WN5 A;  1OJQ A;  2WN8 A;  1GIR A;  1GZE A;  2C8B X;  1GIQ A;  4H0T A;  4WF6 A;  2C8F E;  5DZQ A;  3NTS A;  2C8H A;  1QS2 A;  4PKW A;  4GF1 A;  2C8C A;  2WN4 A;  1PWP A;  4TR5 A;  4XM6 A;  1G24 A;  5H03 A;  2A9K B;  1R4B A;  3BUZ A;  1OJZ A;  5H04 A;  5D1T A;  5GTT A;  4H0X A;  4DV8 A;  2C8D A;  1PWV A;  2GWL A;  2WN7 A;  1GZF A;  1PWW A;  2A78 B;  4PKS A;  2C8E E;  2J3Z A;  2BOV B;  1GY0 A;  4GY2 A;  1PWU A;  2GWM A;  1GXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...