1GZEA

Structure of the clostridium botulinum c3 exoenzyme (l177c mutant)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
207
structure length
207
Chain Sequence
AYSNTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSCMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Nad Binding Induces Conformational Changes in Rho Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 55
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gzeA00
2C8CA 4H0XA 1G24A 2C8EE 4FXQA 5D1SA 5DZQA 4PKSA 3BUZA 4WF6A 2WN6A 2A9KB 2WN8A 4GF1A 4PKTA 4XM7A 4PKQA 5H03A 2C8GA 1GIQA 1GY0A 2J3VA 4XM6A 4DV8A 4PKWA 4H0YA 4XSGB 2GWMA 2J3XA 5GTTA 4ELNA 4FK7A 1J7NA 1GZEA 1OJZA 3NTSA 4H0VA 2J3ZA 2BOVB 1PWVA 4PKUA 1OG3A 4GY2A 1OJQA 2C8DA 1JKYA 4TR5A 1UZIA 1OG4A 1GZFA 1R45A 4XSHB 2C8BX 1PWWA 2WN4A 1PWPA 4XM8A 1ZXVA 1PWQA 1GXZA 1YQYA 2WN7A 2A78B 2WN5A 3U0JA 5D1UA 1OG1A 1GIRA 3BW8A 2C8FE 2C8AA 4H03A 2GWLA 4PKRA 2C89A 4FMLA 4H0TA 1QS1A 1R4BA 5D1TA 1QS2A 1PWUA 2C8HA 4PKVA 5H04A 1GXYA 5BWMB
chains in the Genus database with same CATH superfamily
2C8CA 4H0XA 1G24A 2C8EE 4FXQA 5D1SA 5DZQA 4PKSA 3BUZA 4WF6A 2WN6A 2A9KB 2WN8A 4GF1A 4PKTA 4XM7A 4PKQA 5H03A 2C8GA 1GIQA 1GY0A 2J3VA 4XM6A 4DV8A 4PKWA 4H0YA 4XSGB 2GWMA 2J3XA 5GTTA 4ELNA 4FK7A 1J7NA 1GZEA 1OJZA 3NTSA 4H0VA 2J3ZA 2BOVB 1PWVA 4PKUA 1OG3A 4GY2A 1OJQA 2C8DA 1JKYA 4TR5A 1UZIA 1OG4A 1GZFA 1R45A 4XSHB 2C8BX 1PWWA 2WN4A 1PWPA 4XM8A 1ZXVA 1PWQA 1GXZA 1YQYA 2WN7A 2A78B 2WN5A 3U0JA 5D1UA 1OG1A 1GIRA 3BW8A 2C8FE 2C8AA 4H03A 2GWLA 4PKRA 2C89A 4FMLA 4H0TA 1QS1A 1R4BA 5D1TA 1QS2A 1PWUA 2C8HA 4PKVA 5H04A 1GXYA 5BWMB
chains in the Genus database with same CATH topology
2C8CA 4H0XA 1G24A 2C8EE 4FXQA 5D1SA 5DZQA 4PKSA 3BUZA 4WF6A 2WN6A 2A9KB 2WN8A 4GF1A 4PKTA 4XM7A 4PKQA 5H03A 2C8GA 1GIQA 1GY0A 2J3VA 4XM6A 4DV8A 4PKWA 4H0YA 4XSGB 2GWMA 2J3XA 5GTTA 4ELNA 4FK7A 1J7NA 1GZEA 1OJZA 3NTSA 4H0VA 2J3ZA 2BOVB 1PWVA 4PKUA 1OG3A 4GY2A 1OJQA 2C8DA 1JKYA 4TR5A 1UZIA 1OG4A 1GZFA 1R45A 4XSHB 2C8BX 1PWWA 2WN4A 1PWPA 4XM8A 1ZXVA 1PWQA 1GXZA 1YQYA 2WN7A 2A78B 2WN5A 3U0JA 5D1UA 1OG1A 1GIRA 3BW8A 2C8FE 2C8AA 4H03A 2GWLA 4PKRA 2C89A 4FMLA 4H0TA 1QS1A 1R4BA 5D1TA 1QS2A 1PWUA 2C8HA 4PKVA 5H04A 1GXYA 5BWMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8C A;  4H0X A;  1G24 A;  2C8E E;  4FXQ A;  5D1S A;  5DZQ A;  4PKS A;  3BUZ A;  4WF6 A;  2WN6 A;  2A9K B;  2WN8 A;  4GF1 A;  4PKT A;  4XM7 A;  4PKQ A;  5H03 A;  2C8G A;  1GIQ A;  1GY0 A;  2J3V A;  4XM6 A;  4DV8 A;  4PKW A;  4H0Y A;  4XSG B;  2GWM A;  2J3X A;  5GTT A;  4ELN A;  4FK7 A;  1J7N A;  1GZE A;  1OJZ A;  3NTS A;  4H0V A;  2J3Z A;  2BOV B;  1PWV A;  4PKU A;  1OG3 A;  4GY2 A;  1OJQ A;  2C8D A;  1JKY A;  4TR5 A;  1UZI A;  1OG4 A;  1GZF A;  1R45 A;  4XSH B;  2C8B X;  1PWW A;  2WN4 A;  1PWP A;  4XM8 A;  1ZXV A;  1PWQ A;  1GXZ A;  1YQY A;  2WN7 A;  2A78 B;  2WN5 A;  3U0J A;  5D1U A;  1OG1 A;  1GIR A;  3BW8 A;  2C8F E;  2C8A A;  4H03 A;  2GWL A;  4PKR A;  2C89 A;  4FML A;  4H0T A;  1QS1 A;  1R4B A;  5D1T A;  1QS2 A;  1PWU A;  2C8H A;  4PKV A;  5H04 A;  1GXY A;  5BWM B; 
#chains in the Genus database with same CATH topology
 2C8C A;  4H0X A;  1G24 A;  2C8E E;  4FXQ A;  5D1S A;  5DZQ A;  4PKS A;  3BUZ A;  4WF6 A;  2WN6 A;  2A9K B;  2WN8 A;  4GF1 A;  4PKT A;  4XM7 A;  4PKQ A;  5H03 A;  2C8G A;  1GIQ A;  1GY0 A;  2J3V A;  4XM6 A;  4DV8 A;  4PKW A;  4H0Y A;  4XSG B;  2GWM A;  2J3X A;  5GTT A;  4ELN A;  4FK7 A;  1J7N A;  1GZE A;  1OJZ A;  3NTS A;  4H0V A;  2J3Z A;  2BOV B;  1PWV A;  4PKU A;  1OG3 A;  4GY2 A;  1OJQ A;  2C8D A;  1JKY A;  4TR5 A;  1UZI A;  1OG4 A;  1GZF A;  1R45 A;  4XSH B;  2C8B X;  1PWW A;  2WN4 A;  1PWP A;  4XM8 A;  1ZXV A;  1PWQ A;  1GXZ A;  1YQY A;  2WN7 A;  2A78 B;  2WN5 A;  3U0J A;  5D1U A;  1OG1 A;  1GIR A;  3BW8 A;  2C8F E;  2C8A A;  4H03 A;  2GWL A;  4PKR A;  2C89 A;  4FML A;  4H0T A;  1QS1 A;  1R4B A;  5D1T A;  1QS2 A;  1PWU A;  2C8H A;  4PKV A;  5H04 A;  1GXY A;  5BWM B; 
#chains in the Genus database with same CATH homology
 2C8C A;  4H0X A;  1G24 A;  2C8E E;  4FXQ A;  5D1S A;  5DZQ A;  4PKS A;  3BUZ A;  4WF6 A;  2WN6 A;  2A9K B;  2WN8 A;  4GF1 A;  4PKT A;  4XM7 A;  4PKQ A;  5H03 A;  2C8G A;  1GIQ A;  1GY0 A;  2J3V A;  4XM6 A;  4DV8 A;  4PKW A;  4H0Y A;  4XSG B;  2GWM A;  2J3X A;  5GTT A;  4ELN A;  4FK7 A;  1J7N A;  1GZE A;  1OJZ A;  3NTS A;  4H0V A;  2J3Z A;  2BOV B;  1PWV A;  4PKU A;  1OG3 A;  4GY2 A;  1OJQ A;  2C8D A;  1JKY A;  4TR5 A;  1UZI A;  1OG4 A;  1GZF A;  1R45 A;  4XSH B;  2C8B X;  1PWW A;  2WN4 A;  1PWP A;  4XM8 A;  1ZXV A;  1PWQ A;  1GXZ A;  1YQY A;  2WN7 A;  2A78 B;  2WN5 A;  3U0J A;  5D1U A;  1OG1 A;  1GIR A;  3BW8 A;  2C8F E;  2C8A A;  4H03 A;  2GWL A;  4PKR A;  2C89 A;  4FML A;  4H0T A;  1QS1 A;  1R4B A;  5D1T A;  1QS2 A;  1PWU A;  2C8H A;  4PKV A;  5H04 A;  1GXY A;  5BWM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...