1OG4A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 mutant e189a in complex with nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEAVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
total genus 68
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og4A00
1GY0A 1G24A 3BUZA 4FMLA 5H04A 1OJQA 3BW8A 1GIRA 4ELNA 1ZXVA 3U0JA 5D1UA 1GZFA 4H03A 1PWPA 2WN5A 1YQYA 4FXQA 1GXYA 2BOVB 4PKWA 1GZEA 1JKYA 2J3VA 4XM8A 1OG1A 4PKVA 1QS1A 4PKQA 2A78B 2WN8A 1UZIA 1GIQA 4XSGB 2C8EE 1OG4A 4XSHB 5D1TA 2C8BX 2C8CA 4DV8A 2A9KB 4GF1A 5BWMB 2C89A 5GTTA 4PKTA 2C8HA 4FK7A 4H0VA 4XM6A 4PKRA 1R45A 2C8DA 2J3ZA 1R4BA 5DZQA 5D1SA 4PKUA 2C8GA 1OJZA 2WN4A 4XM7A 1PWWA 2WN7A 3NTSA 4GY2A 1J7NA 2GWMA 2GWLA 1QS2A 2WN6A 1PWQA 2C8AA 4H0XA 4PKSA 2J3XA 1OG3A 4TR5A 4WF6A 4H0TA 1GXZA 1PWVA 4H0YA 5H03A 1PWUA 2C8FE
chains in the Genus database with same CATH superfamily
1GY0A 1G24A 3BUZA 4FMLA 5H04A 1OJQA 3BW8A 1GIRA 4ELNA 1ZXVA 3U0JA 5D1UA 1GZFA 4H03A 1PWPA 2WN5A 1YQYA 4FXQA 1GXYA 2BOVB 4PKWA 1GZEA 1JKYA 2J3VA 4XM8A 1OG1A 4PKVA 1QS1A 4PKQA 2A78B 2WN8A 1UZIA 1GIQA 4XSGB 2C8EE 1OG4A 4XSHB 5D1TA 2C8BX 2C8CA 4DV8A 2A9KB 4GF1A 5BWMB 2C89A 5GTTA 4PKTA 2C8HA 4FK7A 4H0VA 4XM6A 4PKRA 1R45A 2C8DA 2J3ZA 1R4BA 5DZQA 5D1SA 4PKUA 2C8GA 1OJZA 2WN4A 4XM7A 1PWWA 2WN7A 3NTSA 4GY2A 1J7NA 2GWMA 2GWLA 1QS2A 2WN6A 1PWQA 2C8AA 4H0XA 4PKSA 2J3XA 1OG3A 4TR5A 4WF6A 4H0TA 1GXZA 1PWVA 4H0YA 5H03A 1PWUA 2C8FE
chains in the Genus database with same CATH topology
1GY0A 1G24A 3BUZA 4FMLA 5H04A 1OJQA 3BW8A 1GIRA 4ELNA 1ZXVA 3U0JA 5D1UA 1GZFA 4H03A 1PWPA 2WN5A 1YQYA 4FXQA 1GXYA 2BOVB 4PKWA 1GZEA 1JKYA 2J3VA 4XM8A 1OG1A 4PKVA 1QS1A 4PKQA 2A78B 2WN8A 1UZIA 1GIQA 4XSGB 2C8EE 1OG4A 4XSHB 5D1TA 2C8BX 2C8CA 4DV8A 2A9KB 4GF1A 5BWMB 2C89A 5GTTA 4PKTA 2C8HA 4FK7A 4H0VA 4XM6A 4PKRA 1R45A 2C8DA 2J3ZA 1R4BA 5DZQA 5D1SA 4PKUA 2C8GA 1OJZA 2WN4A 4XM7A 1PWWA 2WN7A 3NTSA 4GY2A 1J7NA 2GWMA 2GWLA 1QS2A 2WN6A 1PWQA 2C8AA 4H0XA 4PKSA 2J3XA 1OG3A 4TR5A 4WF6A 4H0TA 1GXZA 1PWVA 4H0YA 5H03A 1PWUA 2C8FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY0 A;  1G24 A;  3BUZ A;  4FML A;  5H04 A;  1OJQ A;  3BW8 A;  1GIR A;  4ELN A;  1ZXV A;  3U0J A;  5D1U A;  1GZF A;  4H03 A;  1PWP A;  2WN5 A;  1YQY A;  4FXQ A;  1GXY A;  2BOV B;  4PKW A;  1GZE A;  1JKY A;  2J3V A;  4XM8 A;  1OG1 A;  4PKV A;  1QS1 A;  4PKQ A;  2A78 B;  2WN8 A;  1UZI A;  1GIQ A;  4XSG B;  2C8E E;  1OG4 A;  4XSH B;  5D1T A;  2C8B X;  2C8C A;  4DV8 A;  2A9K B;  4GF1 A;  5BWM B;  2C89 A;  5GTT A;  4PKT A;  2C8H A;  4FK7 A;  4H0V A;  4XM6 A;  4PKR A;  1R45 A;  2C8D A;  2J3Z A;  1R4B A;  5DZQ A;  5D1S A;  4PKU A;  2C8G A;  1OJZ A;  2WN4 A;  4XM7 A;  1PWW A;  2WN7 A;  3NTS A;  4GY2 A;  1J7N A;  2GWM A;  2GWL A;  1QS2 A;  2WN6 A;  1PWQ A;  2C8A A;  4H0X A;  4PKS A;  2J3X A;  1OG3 A;  4TR5 A;  4WF6 A;  4H0T A;  1GXZ A;  1PWV A;  4H0Y A;  5H03 A;  1PWU A;  2C8F E; 
#chains in the Genus database with same CATH topology
 1GY0 A;  1G24 A;  3BUZ A;  4FML A;  5H04 A;  1OJQ A;  3BW8 A;  1GIR A;  4ELN A;  1ZXV A;  3U0J A;  5D1U A;  1GZF A;  4H03 A;  1PWP A;  2WN5 A;  1YQY A;  4FXQ A;  1GXY A;  2BOV B;  4PKW A;  1GZE A;  1JKY A;  2J3V A;  4XM8 A;  1OG1 A;  4PKV A;  1QS1 A;  4PKQ A;  2A78 B;  2WN8 A;  1UZI A;  1GIQ A;  4XSG B;  2C8E E;  1OG4 A;  4XSH B;  5D1T A;  2C8B X;  2C8C A;  4DV8 A;  2A9K B;  4GF1 A;  5BWM B;  2C89 A;  5GTT A;  4PKT A;  2C8H A;  4FK7 A;  4H0V A;  4XM6 A;  4PKR A;  1R45 A;  2C8D A;  2J3Z A;  1R4B A;  5DZQ A;  5D1S A;  4PKU A;  2C8G A;  1OJZ A;  2WN4 A;  4XM7 A;  1PWW A;  2WN7 A;  3NTS A;  4GY2 A;  1J7N A;  2GWM A;  2GWL A;  1QS2 A;  2WN6 A;  1PWQ A;  2C8A A;  4H0X A;  4PKS A;  2J3X A;  1OG3 A;  4TR5 A;  4WF6 A;  4H0T A;  1GXZ A;  1PWV A;  4H0Y A;  5H03 A;  1PWU A;  2C8F E; 
#chains in the Genus database with same CATH homology
 1GY0 A;  1G24 A;  3BUZ A;  4FML A;  5H04 A;  1OJQ A;  3BW8 A;  1GIR A;  4ELN A;  1ZXV A;  3U0J A;  5D1U A;  1GZF A;  4H03 A;  1PWP A;  2WN5 A;  1YQY A;  4FXQ A;  1GXY A;  2BOV B;  4PKW A;  1GZE A;  1JKY A;  2J3V A;  4XM8 A;  1OG1 A;  4PKV A;  1QS1 A;  4PKQ A;  2A78 B;  2WN8 A;  1UZI A;  1GIQ A;  4XSG B;  2C8E E;  1OG4 A;  4XSH B;  5D1T A;  2C8B X;  2C8C A;  4DV8 A;  2A9K B;  4GF1 A;  5BWM B;  2C89 A;  5GTT A;  4PKT A;  2C8H A;  4FK7 A;  4H0V A;  4XM6 A;  4PKR A;  1R45 A;  2C8D A;  2J3Z A;  1R4B A;  5DZQ A;  5D1S A;  4PKU A;  2C8G A;  1OJZ A;  2WN4 A;  4XM7 A;  1PWW A;  2WN7 A;  3NTS A;  4GY2 A;  1J7N A;  2GWM A;  2GWL A;  1QS2 A;  2WN6 A;  1PWQ A;  2C8A A;  4H0X A;  4PKS A;  2J3X A;  1OG3 A;  4TR5 A;  4WF6 A;  4H0T A;  1GXZ A;  1PWV A;  4H0Y A;  5H03 A;  1PWU A;  2C8F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...