1OG4A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 mutant e189a in complex with nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEAVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 68
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og4A00
2A78B 4PKTA 1GZEA 2C8GA 5H04A 4FMLA 1PWWA 2C89A 2WN6A 1R4BA 1PWPA 2GWMA 2A9KB 4PKVA 2C8BX 2C8CA 1JKYA 1OG1A 5D1TA 4XM8A 1GIRA 4PKSA 2BOVB 4PKRA 1QS1A 4FXQA 4PKUA 4DV8A 1QS2A 3BW8A 3NTSA 2C8HA 4ELNA 5DZQA 4H0TA 4H0YA 2WN8A 1PWVA 5D1UA 4WF6A 4XM6A 1GZFA 4TR5A 4H0XA 5BWMB 2C8AA 4FK7A 5H03A 1YQYA 1R45A 2C8FE 4H03A 5GTTA 1PWQA 3BUZA 2J3ZA 2WN5A 1PWUA 1J7NA 4GY2A 5D1SA 1UZIA 1OG3A 4PKQA 2J3VA 1ZXVA 2WN7A 4XM7A 1OJZA 2C8EE 4GF1A 1OJQA 3U0JA 1OG4A 1GIQA 1GY0A 2WN4A 1GXZA 2J3XA 2C8DA 1GXYA 4XSHB 2GWLA 4PKWA 1G24A 4H0VA 4XSGB
chains in the Genus database with same CATH superfamily
2A78B 4PKTA 1GZEA 2C8GA 5H04A 4FMLA 1PWWA 2C89A 2WN6A 1R4BA 1PWPA 2GWMA 2A9KB 4PKVA 2C8BX 2C8CA 1JKYA 1OG1A 5D1TA 4XM8A 1GIRA 4PKSA 2BOVB 4PKRA 1QS1A 4FXQA 4PKUA 4DV8A 1QS2A 3BW8A 3NTSA 2C8HA 4ELNA 5DZQA 4H0TA 4H0YA 2WN8A 1PWVA 5D1UA 4WF6A 4XM6A 1GZFA 4TR5A 4H0XA 5BWMB 2C8AA 4FK7A 5H03A 1YQYA 1R45A 2C8FE 4H03A 5GTTA 1PWQA 3BUZA 2J3ZA 2WN5A 1PWUA 1J7NA 4GY2A 5D1SA 1UZIA 1OG3A 4PKQA 2J3VA 1ZXVA 2WN7A 4XM7A 1OJZA 2C8EE 4GF1A 1OJQA 3U0JA 1OG4A 1GIQA 1GY0A 2WN4A 1GXZA 2J3XA 2C8DA 1GXYA 4XSHB 2GWLA 4PKWA 1G24A 4H0VA 4XSGB
chains in the Genus database with same CATH topology
2A78B 4PKTA 1GZEA 2C8GA 5H04A 4FMLA 1PWWA 2C89A 2WN6A 1R4BA 1PWPA 2GWMA 2A9KB 4PKVA 2C8BX 2C8CA 1JKYA 1OG1A 5D1TA 4XM8A 1GIRA 4PKSA 2BOVB 4PKRA 1QS1A 4FXQA 4PKUA 4DV8A 1QS2A 3BW8A 3NTSA 2C8HA 4ELNA 5DZQA 4H0TA 4H0YA 2WN8A 1PWVA 5D1UA 4WF6A 4XM6A 1GZFA 4TR5A 4H0XA 5BWMB 2C8AA 4FK7A 5H03A 1YQYA 1R45A 2C8FE 4H03A 5GTTA 1PWQA 3BUZA 2J3ZA 2WN5A 1PWUA 1J7NA 4GY2A 5D1SA 1UZIA 1OG3A 4PKQA 2J3VA 1ZXVA 2WN7A 4XM7A 1OJZA 2C8EE 4GF1A 1OJQA 3U0JA 1OG4A 1GIQA 1GY0A 2WN4A 1GXZA 2J3XA 2C8DA 1GXYA 4XSHB 2GWLA 4PKWA 1G24A 4H0VA 4XSGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A78 B;  4PKT A;  1GZE A;  2C8G A;  5H04 A;  4FML A;  1PWW A;  2C89 A;  2WN6 A;  1R4B A;  1PWP A;  2GWM A;  2A9K B;  4PKV A;  2C8B X;  2C8C A;  1JKY A;  1OG1 A;  5D1T A;  4XM8 A;  1GIR A;  4PKS A;  2BOV B;  4PKR A;  1QS1 A;  4FXQ A;  4PKU A;  4DV8 A;  1QS2 A;  3BW8 A;  3NTS A;  2C8H A;  4ELN A;  5DZQ A;  4H0T A;  4H0Y A;  2WN8 A;  1PWV A;  5D1U A;  4WF6 A;  4XM6 A;  1GZF A;  4TR5 A;  4H0X A;  5BWM B;  2C8A A;  4FK7 A;  5H03 A;  1YQY A;  1R45 A;  2C8F E;  4H03 A;  5GTT A;  1PWQ A;  3BUZ A;  2J3Z A;  2WN5 A;  1PWU A;  1J7N A;  4GY2 A;  5D1S A;  1UZI A;  1OG3 A;  4PKQ A;  2J3V A;  1ZXV A;  2WN7 A;  4XM7 A;  1OJZ A;  2C8E E;  4GF1 A;  1OJQ A;  3U0J A;  1OG4 A;  1GIQ A;  1GY0 A;  2WN4 A;  1GXZ A;  2J3X A;  2C8D A;  1GXY A;  4XSH B;  2GWL A;  4PKW A;  1G24 A;  4H0V A;  4XSG B; 
#chains in the Genus database with same CATH topology
 2A78 B;  4PKT A;  1GZE A;  2C8G A;  5H04 A;  4FML A;  1PWW A;  2C89 A;  2WN6 A;  1R4B A;  1PWP A;  2GWM A;  2A9K B;  4PKV A;  2C8B X;  2C8C A;  1JKY A;  1OG1 A;  5D1T A;  4XM8 A;  1GIR A;  4PKS A;  2BOV B;  4PKR A;  1QS1 A;  4FXQ A;  4PKU A;  4DV8 A;  1QS2 A;  3BW8 A;  3NTS A;  2C8H A;  4ELN A;  5DZQ A;  4H0T A;  4H0Y A;  2WN8 A;  1PWV A;  5D1U A;  4WF6 A;  4XM6 A;  1GZF A;  4TR5 A;  4H0X A;  5BWM B;  2C8A A;  4FK7 A;  5H03 A;  1YQY A;  1R45 A;  2C8F E;  4H03 A;  5GTT A;  1PWQ A;  3BUZ A;  2J3Z A;  2WN5 A;  1PWU A;  1J7N A;  4GY2 A;  5D1S A;  1UZI A;  1OG3 A;  4PKQ A;  2J3V A;  1ZXV A;  2WN7 A;  4XM7 A;  1OJZ A;  2C8E E;  4GF1 A;  1OJQ A;  3U0J A;  1OG4 A;  1GIQ A;  1GY0 A;  2WN4 A;  1GXZ A;  2J3X A;  2C8D A;  1GXY A;  4XSH B;  2GWL A;  4PKW A;  1G24 A;  4H0V A;  4XSG B; 
#chains in the Genus database with same CATH homology
 2A78 B;  4PKT A;  1GZE A;  2C8G A;  5H04 A;  4FML A;  1PWW A;  2C89 A;  2WN6 A;  1R4B A;  1PWP A;  2GWM A;  2A9K B;  4PKV A;  2C8B X;  2C8C A;  1JKY A;  1OG1 A;  5D1T A;  4XM8 A;  1GIR A;  4PKS A;  2BOV B;  4PKR A;  1QS1 A;  4FXQ A;  4PKU A;  4DV8 A;  1QS2 A;  3BW8 A;  3NTS A;  2C8H A;  4ELN A;  5DZQ A;  4H0T A;  4H0Y A;  2WN8 A;  1PWV A;  5D1U A;  4WF6 A;  4XM6 A;  1GZF A;  4TR5 A;  4H0X A;  5BWM B;  2C8A A;  4FK7 A;  5H03 A;  1YQY A;  1R45 A;  2C8F E;  4H03 A;  5GTT A;  1PWQ A;  3BUZ A;  2J3Z A;  2WN5 A;  1PWU A;  1J7N A;  4GY2 A;  5D1S A;  1UZI A;  1OG3 A;  4PKQ A;  2J3V A;  1ZXV A;  2WN7 A;  4XM7 A;  1OJZ A;  2C8E E;  4GF1 A;  1OJQ A;  3U0J A;  1OG4 A;  1GIQ A;  1GY0 A;  2WN4 A;  1GXZ A;  2J3X A;  2C8D A;  1GXY A;  4XSH B;  2GWL A;  4PKW A;  1G24 A;  4H0V A;  4XSG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...