1OG4A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 mutant e189a in complex with nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEAVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 68
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og4A00
1OG1A 1PWQA 5GTTA 1G24A 4H0XA 1OG3A 4FXQA 1GZEA 2C8HA 3BUZA 3U0JA 4XSHB 2BOVB 2C8EE 2C8FE 2C8DA 4PKSA 4H03A 5D1SA 3BW8A 2J3ZA 4XM6A 1GIRA 4XSGB 1GY0A 4PKTA 2GWLA 1R45A 1QS2A 2J3VA 2J3XA 4PKQA 1UZIA 2WN8A 2WN4A 1GXYA 1R4BA 4H0VA 4FK7A 5H03A 1PWWA 1OJQA 2C8BX 2WN5A 4H0YA 1J7NA 1OG4A 4H0TA 3NTSA 2A9KB 1PWUA 2C8AA 4PKUA 5D1UA 4TR5A 1GXZA 1YQYA 1ZXVA 2C89A 5D1TA 4PKWA 4GY2A 4DV8A 1OJZA 2A78B 2GWMA 5H04A 4XM8A 4PKVA 1JKYA 4XM7A 5DZQA 4GF1A 1GIQA 4PKRA 4WF6A 4ELNA 1PWVA 2WN7A 2C8GA 5BWMB 1PWPA 4FMLA 2WN6A 1GZFA 1QS1A 2C8CA
chains in the Genus database with same CATH superfamily
1OG1A 1PWQA 5GTTA 1G24A 4H0XA 1OG3A 4FXQA 1GZEA 2C8HA 3BUZA 3U0JA 4XSHB 2BOVB 2C8EE 2C8FE 2C8DA 4PKSA 4H03A 5D1SA 3BW8A 2J3ZA 4XM6A 1GIRA 4XSGB 1GY0A 4PKTA 2GWLA 1R45A 1QS2A 2J3VA 2J3XA 4PKQA 1UZIA 2WN8A 2WN4A 1GXYA 1R4BA 4H0VA 4FK7A 5H03A 1PWWA 1OJQA 2C8BX 2WN5A 4H0YA 1J7NA 1OG4A 4H0TA 3NTSA 2A9KB 1PWUA 2C8AA 4PKUA 5D1UA 4TR5A 1GXZA 1YQYA 1ZXVA 2C89A 5D1TA 4PKWA 4GY2A 4DV8A 1OJZA 2A78B 2GWMA 5H04A 4XM8A 4PKVA 1JKYA 4XM7A 5DZQA 4GF1A 1GIQA 4PKRA 4WF6A 4ELNA 1PWVA 2WN7A 2C8GA 5BWMB 1PWPA 4FMLA 2WN6A 1GZFA 1QS1A 2C8CA
chains in the Genus database with same CATH topology
1OG1A 1PWQA 5GTTA 1G24A 4H0XA 1OG3A 4FXQA 1GZEA 2C8HA 3BUZA 3U0JA 4XSHB 2BOVB 2C8EE 2C8FE 2C8DA 4PKSA 4H03A 5D1SA 3BW8A 2J3ZA 4XM6A 1GIRA 4XSGB 1GY0A 4PKTA 2GWLA 1R45A 1QS2A 2J3VA 2J3XA 4PKQA 1UZIA 2WN8A 2WN4A 1GXYA 1R4BA 4H0VA 4FK7A 5H03A 1PWWA 1OJQA 2C8BX 2WN5A 4H0YA 1J7NA 1OG4A 4H0TA 3NTSA 2A9KB 1PWUA 2C8AA 4PKUA 5D1UA 4TR5A 1GXZA 1YQYA 1ZXVA 2C89A 5D1TA 4PKWA 4GY2A 4DV8A 1OJZA 2A78B 2GWMA 5H04A 4XM8A 4PKVA 1JKYA 4XM7A 5DZQA 4GF1A 1GIQA 4PKRA 4WF6A 4ELNA 1PWVA 2WN7A 2C8GA 5BWMB 1PWPA 4FMLA 2WN6A 1GZFA 1QS1A 2C8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OG1 A;  1PWQ A;  5GTT A;  1G24 A;  4H0X A;  1OG3 A;  4FXQ A;  1GZE A;  2C8H A;  3BUZ A;  3U0J A;  4XSH B;  2BOV B;  2C8E E;  2C8F E;  2C8D A;  4PKS A;  4H03 A;  5D1S A;  3BW8 A;  2J3Z A;  4XM6 A;  1GIR A;  4XSG B;  1GY0 A;  4PKT A;  2GWL A;  1R45 A;  1QS2 A;  2J3V A;  2J3X A;  4PKQ A;  1UZI A;  2WN8 A;  2WN4 A;  1GXY A;  1R4B A;  4H0V A;  4FK7 A;  5H03 A;  1PWW A;  1OJQ A;  2C8B X;  2WN5 A;  4H0Y A;  1J7N A;  1OG4 A;  4H0T A;  3NTS A;  2A9K B;  1PWU A;  2C8A A;  4PKU A;  5D1U A;  4TR5 A;  1GXZ A;  1YQY A;  1ZXV A;  2C89 A;  5D1T A;  4PKW A;  4GY2 A;  4DV8 A;  1OJZ A;  2A78 B;  2GWM A;  5H04 A;  4XM8 A;  4PKV A;  1JKY A;  4XM7 A;  5DZQ A;  4GF1 A;  1GIQ A;  4PKR A;  4WF6 A;  4ELN A;  1PWV A;  2WN7 A;  2C8G A;  5BWM B;  1PWP A;  4FML A;  2WN6 A;  1GZF A;  1QS1 A;  2C8C A; 
#chains in the Genus database with same CATH topology
 1OG1 A;  1PWQ A;  5GTT A;  1G24 A;  4H0X A;  1OG3 A;  4FXQ A;  1GZE A;  2C8H A;  3BUZ A;  3U0J A;  4XSH B;  2BOV B;  2C8E E;  2C8F E;  2C8D A;  4PKS A;  4H03 A;  5D1S A;  3BW8 A;  2J3Z A;  4XM6 A;  1GIR A;  4XSG B;  1GY0 A;  4PKT A;  2GWL A;  1R45 A;  1QS2 A;  2J3V A;  2J3X A;  4PKQ A;  1UZI A;  2WN8 A;  2WN4 A;  1GXY A;  1R4B A;  4H0V A;  4FK7 A;  5H03 A;  1PWW A;  1OJQ A;  2C8B X;  2WN5 A;  4H0Y A;  1J7N A;  1OG4 A;  4H0T A;  3NTS A;  2A9K B;  1PWU A;  2C8A A;  4PKU A;  5D1U A;  4TR5 A;  1GXZ A;  1YQY A;  1ZXV A;  2C89 A;  5D1T A;  4PKW A;  4GY2 A;  4DV8 A;  1OJZ A;  2A78 B;  2GWM A;  5H04 A;  4XM8 A;  4PKV A;  1JKY A;  4XM7 A;  5DZQ A;  4GF1 A;  1GIQ A;  4PKR A;  4WF6 A;  4ELN A;  1PWV A;  2WN7 A;  2C8G A;  5BWM B;  1PWP A;  4FML A;  2WN6 A;  1GZF A;  1QS1 A;  2C8C A; 
#chains in the Genus database with same CATH homology
 1OG1 A;  1PWQ A;  5GTT A;  1G24 A;  4H0X A;  1OG3 A;  4FXQ A;  1GZE A;  2C8H A;  3BUZ A;  3U0J A;  4XSH B;  2BOV B;  2C8E E;  2C8F E;  2C8D A;  4PKS A;  4H03 A;  5D1S A;  3BW8 A;  2J3Z A;  4XM6 A;  1GIR A;  4XSG B;  1GY0 A;  4PKT A;  2GWL A;  1R45 A;  1QS2 A;  2J3V A;  2J3X A;  4PKQ A;  1UZI A;  2WN8 A;  2WN4 A;  1GXY A;  1R4B A;  4H0V A;  4FK7 A;  5H03 A;  1PWW A;  1OJQ A;  2C8B X;  2WN5 A;  4H0Y A;  1J7N A;  1OG4 A;  4H0T A;  3NTS A;  2A9K B;  1PWU A;  2C8A A;  4PKU A;  5D1U A;  4TR5 A;  1GXZ A;  1YQY A;  1ZXV A;  2C89 A;  5D1T A;  4PKW A;  4GY2 A;  4DV8 A;  1OJZ A;  2A78 B;  2GWM A;  5H04 A;  4XM8 A;  4PKV A;  1JKY A;  4XM7 A;  5DZQ A;  4GF1 A;  1GIQ A;  4PKR A;  4WF6 A;  4ELN A;  1PWV A;  2WN7 A;  2C8G A;  5BWM B;  1PWP A;  4FML A;  2WN6 A;  1GZF A;  1QS1 A;  2C8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...