2C89A

Structure of the wild-type c3bot1 exoenzyme (free state, crystal form i)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
201
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 64
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c89A00
1ZXVA 2C8EE 1OG1A 1GZEA 4XM8A 1G24A 4WF6A 5GTTA 1GIRA 5D1TA 2GWLA 1PWWA 1GZFA 2J3ZA 4PKRA 4TR5A 4DV8A 3BW8A 4ELNA 2C8CA 1J7NA 2WN4A 5D1UA 5H04A 1OJQA 2WN6A 1OG4A 4PKQA 1GXZA 5H03A 1PWQA 2WN7A 2J3XA 1GIQA 1YQYA 4PKWA 2C8FE 4GF1A 5DZQA 2C89A 1QS1A 4PKTA 4PKSA 2J3VA 1OJZA 2A9KB 4FXQA 2BOVB 4H0YA 4H0XA 1PWVA 4XSHB 4PKUA 4H03A 2WN5A 4XSGB 1QS2A 4FK7A 4XM6A 5D1SA 1JKYA 1OG3A 2C8BX 5BWMB 2WN8A 4GY2A 4H0VA 2GWMA 1R45A 4XM7A 1PWPA 2C8GA 2C8DA 3U0JA 1GXYA 3BUZA 1GY0A 1PWUA 2A78B 4FMLA 2C8HA 3NTSA 1UZIA 2C8AA 4PKVA 4H0TA 1R4BA
chains in the Genus database with same CATH superfamily
1ZXVA 2C8EE 1OG1A 1GZEA 4XM8A 1G24A 4WF6A 5GTTA 1GIRA 5D1TA 2GWLA 1PWWA 1GZFA 2J3ZA 4PKRA 4TR5A 4DV8A 3BW8A 4ELNA 2C8CA 1J7NA 2WN4A 5D1UA 5H04A 1OJQA 2WN6A 1OG4A 4PKQA 1GXZA 5H03A 1PWQA 2WN7A 2J3XA 1GIQA 1YQYA 4PKWA 2C8FE 4GF1A 5DZQA 2C89A 1QS1A 4PKTA 4PKSA 2J3VA 1OJZA 2A9KB 4FXQA 2BOVB 4H0YA 4H0XA 1PWVA 4XSHB 4PKUA 4H03A 2WN5A 4XSGB 1QS2A 4FK7A 4XM6A 5D1SA 1JKYA 1OG3A 2C8BX 5BWMB 2WN8A 4GY2A 4H0VA 2GWMA 1R45A 4XM7A 1PWPA 2C8GA 2C8DA 3U0JA 1GXYA 3BUZA 1GY0A 1PWUA 2A78B 4FMLA 2C8HA 3NTSA 1UZIA 2C8AA 4PKVA 4H0TA 1R4BA
chains in the Genus database with same CATH topology
1ZXVA 2C8EE 1OG1A 1GZEA 4XM8A 1G24A 4WF6A 5GTTA 1GIRA 5D1TA 2GWLA 1PWWA 1GZFA 2J3ZA 4PKRA 4TR5A 4DV8A 3BW8A 4ELNA 2C8CA 1J7NA 2WN4A 5D1UA 5H04A 1OJQA 2WN6A 1OG4A 4PKQA 1GXZA 5H03A 1PWQA 2WN7A 2J3XA 1GIQA 1YQYA 4PKWA 2C8FE 4GF1A 5DZQA 2C89A 1QS1A 4PKTA 4PKSA 2J3VA 1OJZA 2A9KB 4FXQA 2BOVB 4H0YA 4H0XA 1PWVA 4XSHB 4PKUA 4H03A 2WN5A 4XSGB 1QS2A 4FK7A 4XM6A 5D1SA 1JKYA 1OG3A 2C8BX 5BWMB 2WN8A 4GY2A 4H0VA 2GWMA 1R45A 4XM7A 1PWPA 2C8GA 2C8DA 3U0JA 1GXYA 3BUZA 1GY0A 1PWUA 2A78B 4FMLA 2C8HA 3NTSA 1UZIA 2C8AA 4PKVA 4H0TA 1R4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXV A;  2C8E E;  1OG1 A;  1GZE A;  4XM8 A;  1G24 A;  4WF6 A;  5GTT A;  1GIR A;  5D1T A;  2GWL A;  1PWW A;  1GZF A;  2J3Z A;  4PKR A;  4TR5 A;  4DV8 A;  3BW8 A;  4ELN A;  2C8C A;  1J7N A;  2WN4 A;  5D1U A;  5H04 A;  1OJQ A;  2WN6 A;  1OG4 A;  4PKQ A;  1GXZ A;  5H03 A;  1PWQ A;  2WN7 A;  2J3X A;  1GIQ A;  1YQY A;  4PKW A;  2C8F E;  4GF1 A;  5DZQ A;  2C89 A;  1QS1 A;  4PKT A;  4PKS A;  2J3V A;  1OJZ A;  2A9K B;  4FXQ A;  2BOV B;  4H0Y A;  4H0X A;  1PWV A;  4XSH B;  4PKU A;  4H03 A;  2WN5 A;  4XSG B;  1QS2 A;  4FK7 A;  4XM6 A;  5D1S A;  1JKY A;  1OG3 A;  2C8B X;  5BWM B;  2WN8 A;  4GY2 A;  4H0V A;  2GWM A;  1R45 A;  4XM7 A;  1PWP A;  2C8G A;  2C8D A;  3U0J A;  1GXY A;  3BUZ A;  1GY0 A;  1PWU A;  2A78 B;  4FML A;  2C8H A;  3NTS A;  1UZI A;  2C8A A;  4PKV A;  4H0T A;  1R4B A; 
#chains in the Genus database with same CATH topology
 1ZXV A;  2C8E E;  1OG1 A;  1GZE A;  4XM8 A;  1G24 A;  4WF6 A;  5GTT A;  1GIR A;  5D1T A;  2GWL A;  1PWW A;  1GZF A;  2J3Z A;  4PKR A;  4TR5 A;  4DV8 A;  3BW8 A;  4ELN A;  2C8C A;  1J7N A;  2WN4 A;  5D1U A;  5H04 A;  1OJQ A;  2WN6 A;  1OG4 A;  4PKQ A;  1GXZ A;  5H03 A;  1PWQ A;  2WN7 A;  2J3X A;  1GIQ A;  1YQY A;  4PKW A;  2C8F E;  4GF1 A;  5DZQ A;  2C89 A;  1QS1 A;  4PKT A;  4PKS A;  2J3V A;  1OJZ A;  2A9K B;  4FXQ A;  2BOV B;  4H0Y A;  4H0X A;  1PWV A;  4XSH B;  4PKU A;  4H03 A;  2WN5 A;  4XSG B;  1QS2 A;  4FK7 A;  4XM6 A;  5D1S A;  1JKY A;  1OG3 A;  2C8B X;  5BWM B;  2WN8 A;  4GY2 A;  4H0V A;  2GWM A;  1R45 A;  4XM7 A;  1PWP A;  2C8G A;  2C8D A;  3U0J A;  1GXY A;  3BUZ A;  1GY0 A;  1PWU A;  2A78 B;  4FML A;  2C8H A;  3NTS A;  1UZI A;  2C8A A;  4PKV A;  4H0T A;  1R4B A; 
#chains in the Genus database with same CATH homology
 1ZXV A;  2C8E E;  1OG1 A;  1GZE A;  4XM8 A;  1G24 A;  4WF6 A;  5GTT A;  1GIR A;  5D1T A;  2GWL A;  1PWW A;  1GZF A;  2J3Z A;  4PKR A;  4TR5 A;  4DV8 A;  3BW8 A;  4ELN A;  2C8C A;  1J7N A;  2WN4 A;  5D1U A;  5H04 A;  1OJQ A;  2WN6 A;  1OG4 A;  4PKQ A;  1GXZ A;  5H03 A;  1PWQ A;  2WN7 A;  2J3X A;  1GIQ A;  1YQY A;  4PKW A;  2C8F E;  4GF1 A;  5DZQ A;  2C89 A;  1QS1 A;  4PKT A;  4PKS A;  2J3V A;  1OJZ A;  2A9K B;  4FXQ A;  2BOV B;  4H0Y A;  4H0X A;  1PWV A;  4XSH B;  4PKU A;  4H03 A;  2WN5 A;  4XSG B;  1QS2 A;  4FK7 A;  4XM6 A;  5D1S A;  1JKY A;  1OG3 A;  2C8B X;  5BWM B;  2WN8 A;  4GY2 A;  4H0V A;  2GWM A;  1R45 A;  4XM7 A;  1PWP A;  2C8G A;  2C8D A;  3U0J A;  1GXY A;  3BUZ A;  1GY0 A;  1PWU A;  2A78 B;  4FML A;  2C8H A;  3NTS A;  1UZI A;  2C8A A;  4PKV A;  4H0T A;  1R4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...