2C89A

Structure of the wild-type c3bot1 exoenzyme (free state, crystal form i)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
201
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 64
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c89A00
2J3XA 3BW8A 2C8AA 5D1SA 2WN8A 5D1TA 1OG1A 1GIRA 2WN5A 1G24A 4PKQA 4PKUA 4ELNA 1GXYA 4H0VA 4XSGB 1PWPA 1GIQA 4FMLA 5DZQA 1R4BA 4FXQA 4FK7A 5D1UA 3NTSA 1UZIA 2C8CA 4GY2A 5H04A 1ZXVA 5H03A 4GF1A 4H0TA 1GZFA 4PKWA 5BWMB 4TR5A 1PWUA 2GWMA 2A9KB 4PKSA 4WF6A 1JKYA 5GTTA 4DV8A 2C89A 4XM6A 1R45A 1PWVA 3BUZA 2BOVB 4PKTA 1GY0A 1QS1A 2C8DA 4XM7A 4XM8A 1J7NA 2WN4A 1GZEA 2WN7A 2WN6A 2C8FE 2A78B 1PWWA 4PKRA 1OG3A 4PKVA 1YQYA 2C8BX 2J3ZA 2C8EE 1OJZA 3U0JA 4H03A 2J3VA 4H0YA 1OG4A 4XSHB 2GWLA 2C8GA 1GXZA 1OJQA 1QS2A 4H0XA 2C8HA 1PWQA
chains in the Genus database with same CATH superfamily
2J3XA 3BW8A 2C8AA 5D1SA 2WN8A 5D1TA 1OG1A 1GIRA 2WN5A 1G24A 4PKQA 4PKUA 4ELNA 1GXYA 4H0VA 4XSGB 1PWPA 1GIQA 4FMLA 5DZQA 1R4BA 4FXQA 4FK7A 5D1UA 3NTSA 1UZIA 2C8CA 4GY2A 5H04A 1ZXVA 5H03A 4GF1A 4H0TA 1GZFA 4PKWA 5BWMB 4TR5A 1PWUA 2GWMA 2A9KB 4PKSA 4WF6A 1JKYA 5GTTA 4DV8A 2C89A 4XM6A 1R45A 1PWVA 3BUZA 2BOVB 4PKTA 1GY0A 1QS1A 2C8DA 4XM7A 4XM8A 1J7NA 2WN4A 1GZEA 2WN7A 2WN6A 2C8FE 2A78B 1PWWA 4PKRA 1OG3A 4PKVA 1YQYA 2C8BX 2J3ZA 2C8EE 1OJZA 3U0JA 4H03A 2J3VA 4H0YA 1OG4A 4XSHB 2GWLA 2C8GA 1GXZA 1OJQA 1QS2A 4H0XA 2C8HA 1PWQA
chains in the Genus database with same CATH topology
2J3XA 3BW8A 2C8AA 5D1SA 2WN8A 5D1TA 1OG1A 1GIRA 2WN5A 1G24A 4PKQA 4PKUA 4ELNA 1GXYA 4H0VA 4XSGB 1PWPA 1GIQA 4FMLA 5DZQA 1R4BA 4FXQA 4FK7A 5D1UA 3NTSA 1UZIA 2C8CA 4GY2A 5H04A 1ZXVA 5H03A 4GF1A 4H0TA 1GZFA 4PKWA 5BWMB 4TR5A 1PWUA 2GWMA 2A9KB 4PKSA 4WF6A 1JKYA 5GTTA 4DV8A 2C89A 4XM6A 1R45A 1PWVA 3BUZA 2BOVB 4PKTA 1GY0A 1QS1A 2C8DA 4XM7A 4XM8A 1J7NA 2WN4A 1GZEA 2WN7A 2WN6A 2C8FE 2A78B 1PWWA 4PKRA 1OG3A 4PKVA 1YQYA 2C8BX 2J3ZA 2C8EE 1OJZA 3U0JA 4H03A 2J3VA 4H0YA 1OG4A 4XSHB 2GWLA 2C8GA 1GXZA 1OJQA 1QS2A 4H0XA 2C8HA 1PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3X A;  3BW8 A;  2C8A A;  5D1S A;  2WN8 A;  5D1T A;  1OG1 A;  1GIR A;  2WN5 A;  1G24 A;  4PKQ A;  4PKU A;  4ELN A;  1GXY A;  4H0V A;  4XSG B;  1PWP A;  1GIQ A;  4FML A;  5DZQ A;  1R4B A;  4FXQ A;  4FK7 A;  5D1U A;  3NTS A;  1UZI A;  2C8C A;  4GY2 A;  5H04 A;  1ZXV A;  5H03 A;  4GF1 A;  4H0T A;  1GZF A;  4PKW A;  5BWM B;  4TR5 A;  1PWU A;  2GWM A;  2A9K B;  4PKS A;  4WF6 A;  1JKY A;  5GTT A;  4DV8 A;  2C89 A;  4XM6 A;  1R45 A;  1PWV A;  3BUZ A;  2BOV B;  4PKT A;  1GY0 A;  1QS1 A;  2C8D A;  4XM7 A;  4XM8 A;  1J7N A;  2WN4 A;  1GZE A;  2WN7 A;  2WN6 A;  2C8F E;  2A78 B;  1PWW A;  4PKR A;  1OG3 A;  4PKV A;  1YQY A;  2C8B X;  2J3Z A;  2C8E E;  1OJZ A;  3U0J A;  4H03 A;  2J3V A;  4H0Y A;  1OG4 A;  4XSH B;  2GWL A;  2C8G A;  1GXZ A;  1OJQ A;  1QS2 A;  4H0X A;  2C8H A;  1PWQ A; 
#chains in the Genus database with same CATH topology
 2J3X A;  3BW8 A;  2C8A A;  5D1S A;  2WN8 A;  5D1T A;  1OG1 A;  1GIR A;  2WN5 A;  1G24 A;  4PKQ A;  4PKU A;  4ELN A;  1GXY A;  4H0V A;  4XSG B;  1PWP A;  1GIQ A;  4FML A;  5DZQ A;  1R4B A;  4FXQ A;  4FK7 A;  5D1U A;  3NTS A;  1UZI A;  2C8C A;  4GY2 A;  5H04 A;  1ZXV A;  5H03 A;  4GF1 A;  4H0T A;  1GZF A;  4PKW A;  5BWM B;  4TR5 A;  1PWU A;  2GWM A;  2A9K B;  4PKS A;  4WF6 A;  1JKY A;  5GTT A;  4DV8 A;  2C89 A;  4XM6 A;  1R45 A;  1PWV A;  3BUZ A;  2BOV B;  4PKT A;  1GY0 A;  1QS1 A;  2C8D A;  4XM7 A;  4XM8 A;  1J7N A;  2WN4 A;  1GZE A;  2WN7 A;  2WN6 A;  2C8F E;  2A78 B;  1PWW A;  4PKR A;  1OG3 A;  4PKV A;  1YQY A;  2C8B X;  2J3Z A;  2C8E E;  1OJZ A;  3U0J A;  4H03 A;  2J3V A;  4H0Y A;  1OG4 A;  4XSH B;  2GWL A;  2C8G A;  1GXZ A;  1OJQ A;  1QS2 A;  4H0X A;  2C8H A;  1PWQ A; 
#chains in the Genus database with same CATH homology
 2J3X A;  3BW8 A;  2C8A A;  5D1S A;  2WN8 A;  5D1T A;  1OG1 A;  1GIR A;  2WN5 A;  1G24 A;  4PKQ A;  4PKU A;  4ELN A;  1GXY A;  4H0V A;  4XSG B;  1PWP A;  1GIQ A;  4FML A;  5DZQ A;  1R4B A;  4FXQ A;  4FK7 A;  5D1U A;  3NTS A;  1UZI A;  2C8C A;  4GY2 A;  5H04 A;  1ZXV A;  5H03 A;  4GF1 A;  4H0T A;  1GZF A;  4PKW A;  5BWM B;  4TR5 A;  1PWU A;  2GWM A;  2A9K B;  4PKS A;  4WF6 A;  1JKY A;  5GTT A;  4DV8 A;  2C89 A;  4XM6 A;  1R45 A;  1PWV A;  3BUZ A;  2BOV B;  4PKT A;  1GY0 A;  1QS1 A;  2C8D A;  4XM7 A;  4XM8 A;  1J7N A;  2WN4 A;  1GZE A;  2WN7 A;  2WN6 A;  2C8F E;  2A78 B;  1PWW A;  4PKR A;  1OG3 A;  4PKV A;  1YQY A;  2C8B X;  2J3Z A;  2C8E E;  1OJZ A;  3U0J A;  4H03 A;  2J3V A;  4H0Y A;  1OG4 A;  4XSH B;  2GWL A;  2C8G A;  1GXZ A;  1OJQ A;  1QS2 A;  4H0X A;  2C8H A;  1PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...