2C89A

Structure of the wild-type c3bot1 exoenzyme (free state, crystal form i)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
201
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 64
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c89A00
1GIRA 2WN4A 2C8DA 1R45A 1PWQA 1UZIA 2C8AA 1PWVA 1OJZA 4H03A 4H0YA 1GXZA 5D1SA 2C89A 3BW8A 4H0XA 4XM6A 4XSHB 3NTSA 2WN7A 2A78B 1ZXVA 2C8BX 1JKYA 2C8FE 4H0VA 5H03A 1G24A 4GF1A 4XM8A 4H0TA 2WN8A 5DZQA 5H04A 1R4BA 2C8GA 5BWMB 3BUZA 3U0JA 1GXYA 2C8CA 4PKWA 1J7NA 4TR5A 4PKRA 2GWMA 1OG4A 1YQYA 1GZFA 4WF6A 1GIQA 1OG3A 4XSGB 4ELNA 4GY2A 1OJQA 2J3ZA 1QS2A 2WN6A 4PKSA 4XM7A 4FXQA 2BOVB 4PKUA 2WN5A 2GWLA 1PWUA 1GZEA 2C8EE 4PKTA 2A9KB 1PWWA 5D1TA 1GY0A 4PKQA 2C8HA 4DV8A 5D1UA 2J3VA 1PWPA 1QS1A 4FK7A 2J3XA 5GTTA 4PKVA 4FMLA 1OG1A
chains in the Genus database with same CATH superfamily
1GIRA 2WN4A 2C8DA 1R45A 1PWQA 1UZIA 2C8AA 1PWVA 1OJZA 4H03A 4H0YA 1GXZA 5D1SA 2C89A 3BW8A 4H0XA 4XM6A 4XSHB 3NTSA 2WN7A 2A78B 1ZXVA 2C8BX 1JKYA 2C8FE 4H0VA 5H03A 1G24A 4GF1A 4XM8A 4H0TA 2WN8A 5DZQA 5H04A 1R4BA 2C8GA 5BWMB 3BUZA 3U0JA 1GXYA 2C8CA 4PKWA 1J7NA 4TR5A 4PKRA 2GWMA 1OG4A 1YQYA 1GZFA 4WF6A 1GIQA 1OG3A 4XSGB 4ELNA 4GY2A 1OJQA 2J3ZA 1QS2A 2WN6A 4PKSA 4XM7A 4FXQA 2BOVB 4PKUA 2WN5A 2GWLA 1PWUA 1GZEA 2C8EE 4PKTA 2A9KB 1PWWA 5D1TA 1GY0A 4PKQA 2C8HA 4DV8A 5D1UA 2J3VA 1PWPA 1QS1A 4FK7A 2J3XA 5GTTA 4PKVA 4FMLA 1OG1A
chains in the Genus database with same CATH topology
1GIRA 2WN4A 2C8DA 1R45A 1PWQA 1UZIA 2C8AA 1PWVA 1OJZA 4H03A 4H0YA 1GXZA 5D1SA 2C89A 3BW8A 4H0XA 4XM6A 4XSHB 3NTSA 2WN7A 2A78B 1ZXVA 2C8BX 1JKYA 2C8FE 4H0VA 5H03A 1G24A 4GF1A 4XM8A 4H0TA 2WN8A 5DZQA 5H04A 1R4BA 2C8GA 5BWMB 3BUZA 3U0JA 1GXYA 2C8CA 4PKWA 1J7NA 4TR5A 4PKRA 2GWMA 1OG4A 1YQYA 1GZFA 4WF6A 1GIQA 1OG3A 4XSGB 4ELNA 4GY2A 1OJQA 2J3ZA 1QS2A 2WN6A 4PKSA 4XM7A 4FXQA 2BOVB 4PKUA 2WN5A 2GWLA 1PWUA 1GZEA 2C8EE 4PKTA 2A9KB 1PWWA 5D1TA 1GY0A 4PKQA 2C8HA 4DV8A 5D1UA 2J3VA 1PWPA 1QS1A 4FK7A 2J3XA 5GTTA 4PKVA 4FMLA 1OG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GIR A;  2WN4 A;  2C8D A;  1R45 A;  1PWQ A;  1UZI A;  2C8A A;  1PWV A;  1OJZ A;  4H03 A;  4H0Y A;  1GXZ A;  5D1S A;  2C89 A;  3BW8 A;  4H0X A;  4XM6 A;  4XSH B;  3NTS A;  2WN7 A;  2A78 B;  1ZXV A;  2C8B X;  1JKY A;  2C8F E;  4H0V A;  5H03 A;  1G24 A;  4GF1 A;  4XM8 A;  4H0T A;  2WN8 A;  5DZQ A;  5H04 A;  1R4B A;  2C8G A;  5BWM B;  3BUZ A;  3U0J A;  1GXY A;  2C8C A;  4PKW A;  1J7N A;  4TR5 A;  4PKR A;  2GWM A;  1OG4 A;  1YQY A;  1GZF A;  4WF6 A;  1GIQ A;  1OG3 A;  4XSG B;  4ELN A;  4GY2 A;  1OJQ A;  2J3Z A;  1QS2 A;  2WN6 A;  4PKS A;  4XM7 A;  4FXQ A;  2BOV B;  4PKU A;  2WN5 A;  2GWL A;  1PWU A;  1GZE A;  2C8E E;  4PKT A;  2A9K B;  1PWW A;  5D1T A;  1GY0 A;  4PKQ A;  2C8H A;  4DV8 A;  5D1U A;  2J3V A;  1PWP A;  1QS1 A;  4FK7 A;  2J3X A;  5GTT A;  4PKV A;  4FML A;  1OG1 A; 
#chains in the Genus database with same CATH topology
 1GIR A;  2WN4 A;  2C8D A;  1R45 A;  1PWQ A;  1UZI A;  2C8A A;  1PWV A;  1OJZ A;  4H03 A;  4H0Y A;  1GXZ A;  5D1S A;  2C89 A;  3BW8 A;  4H0X A;  4XM6 A;  4XSH B;  3NTS A;  2WN7 A;  2A78 B;  1ZXV A;  2C8B X;  1JKY A;  2C8F E;  4H0V A;  5H03 A;  1G24 A;  4GF1 A;  4XM8 A;  4H0T A;  2WN8 A;  5DZQ A;  5H04 A;  1R4B A;  2C8G A;  5BWM B;  3BUZ A;  3U0J A;  1GXY A;  2C8C A;  4PKW A;  1J7N A;  4TR5 A;  4PKR A;  2GWM A;  1OG4 A;  1YQY A;  1GZF A;  4WF6 A;  1GIQ A;  1OG3 A;  4XSG B;  4ELN A;  4GY2 A;  1OJQ A;  2J3Z A;  1QS2 A;  2WN6 A;  4PKS A;  4XM7 A;  4FXQ A;  2BOV B;  4PKU A;  2WN5 A;  2GWL A;  1PWU A;  1GZE A;  2C8E E;  4PKT A;  2A9K B;  1PWW A;  5D1T A;  1GY0 A;  4PKQ A;  2C8H A;  4DV8 A;  5D1U A;  2J3V A;  1PWP A;  1QS1 A;  4FK7 A;  2J3X A;  5GTT A;  4PKV A;  4FML A;  1OG1 A; 
#chains in the Genus database with same CATH homology
 1GIR A;  2WN4 A;  2C8D A;  1R45 A;  1PWQ A;  1UZI A;  2C8A A;  1PWV A;  1OJZ A;  4H03 A;  4H0Y A;  1GXZ A;  5D1S A;  2C89 A;  3BW8 A;  4H0X A;  4XM6 A;  4XSH B;  3NTS A;  2WN7 A;  2A78 B;  1ZXV A;  2C8B X;  1JKY A;  2C8F E;  4H0V A;  5H03 A;  1G24 A;  4GF1 A;  4XM8 A;  4H0T A;  2WN8 A;  5DZQ A;  5H04 A;  1R4B A;  2C8G A;  5BWM B;  3BUZ A;  3U0J A;  1GXY A;  2C8C A;  4PKW A;  1J7N A;  4TR5 A;  4PKR A;  2GWM A;  1OG4 A;  1YQY A;  1GZF A;  4WF6 A;  1GIQ A;  1OG3 A;  4XSG B;  4ELN A;  4GY2 A;  1OJQ A;  2J3Z A;  1QS2 A;  2WN6 A;  4PKS A;  4XM7 A;  4FXQ A;  2BOV B;  4PKU A;  2WN5 A;  2GWL A;  1PWU A;  1GZE A;  2C8E E;  4PKT A;  2A9K B;  1PWW A;  5D1T A;  1GY0 A;  4PKQ A;  2C8H A;  4DV8 A;  5D1U A;  2J3V A;  1PWP A;  1QS1 A;  4FK7 A;  2J3X A;  5GTT A;  4PKV A;  4FML A;  1OG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...