2C8HA

Structure of the pn loop q182a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
204
structure length
204
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSAFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Properties of Wild-Type and Two Artt Motif Mutants Clostridium Botulinum C3 Exoenzyme Isoform 1 in Different Substrate Complexed States and Crystal Forms.
rcsb
source organism Clostridium botulinum
total genus 66
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8hA00
4WF6A 4PKSA 5GTTA 1GZFA 1OG3A 1PWWA 4PKUA 2J3ZA 4TR5A 5H03A 1QS1A 2C8HA 2A9KB 2WN6A 4H0TA 5D1SA 4H03A 4XSGB 1OG4A 2GWLA 2C89A 5D1UA 1PWQA 4PKRA 2C8DA 2A78B 2J3VA 2WN5A 1R4BA 4H0VA 1ZXVA 2C8AA 5H04A 4ELNA 4PKQA 1OG1A 1GY0A 2C8GA 2WN8A 2C8BX 1OJQA 1R45A 4XM6A 4DV8A 4PKVA 2BOVB 2C8FE 4FK7A 4GF1A 1PWVA 4H0XA 1GXZA 5D1TA 2C8CA 1GXYA 2WN4A 3BW8A 1GIRA 1YQYA 1PWUA 5BWMB 1GIQA 1JKYA 1PWPA 3BUZA 1OJZA 4PKTA 3NTSA 1GZEA 1UZIA 4FXQA 4H0YA 4FMLA 1QS2A 2GWMA 2J3XA 4GY2A 1G24A 4PKWA 5DZQA 1J7NA 4XM7A 4XSHB 2WN7A 3U0JA 4XM8A 2C8EE
chains in the Genus database with same CATH superfamily
4WF6A 4PKSA 5GTTA 1GZFA 1OG3A 1PWWA 4PKUA 2J3ZA 4TR5A 5H03A 1QS1A 2C8HA 2A9KB 2WN6A 4H0TA 5D1SA 4H03A 4XSGB 1OG4A 2GWLA 2C89A 5D1UA 1PWQA 4PKRA 2C8DA 2A78B 2J3VA 2WN5A 1R4BA 4H0VA 1ZXVA 2C8AA 5H04A 4ELNA 4PKQA 1OG1A 1GY0A 2C8GA 2WN8A 2C8BX 1OJQA 1R45A 4XM6A 4DV8A 4PKVA 2BOVB 2C8FE 4FK7A 4GF1A 1PWVA 4H0XA 1GXZA 5D1TA 2C8CA 1GXYA 2WN4A 3BW8A 1GIRA 1YQYA 1PWUA 5BWMB 1GIQA 1JKYA 1PWPA 3BUZA 1OJZA 4PKTA 3NTSA 1GZEA 1UZIA 4FXQA 4H0YA 4FMLA 1QS2A 2GWMA 2J3XA 4GY2A 1G24A 4PKWA 5DZQA 1J7NA 4XM7A 4XSHB 2WN7A 3U0JA 4XM8A 2C8EE
chains in the Genus database with same CATH topology
4WF6A 4PKSA 5GTTA 1GZFA 1OG3A 1PWWA 4PKUA 2J3ZA 4TR5A 5H03A 1QS1A 2C8HA 2A9KB 2WN6A 4H0TA 5D1SA 4H03A 4XSGB 1OG4A 2GWLA 2C89A 5D1UA 1PWQA 4PKRA 2C8DA 2A78B 2J3VA 2WN5A 1R4BA 4H0VA 1ZXVA 2C8AA 5H04A 4ELNA 4PKQA 1OG1A 1GY0A 2C8GA 2WN8A 2C8BX 1OJQA 1R45A 4XM6A 4DV8A 4PKVA 2BOVB 2C8FE 4FK7A 4GF1A 1PWVA 4H0XA 1GXZA 5D1TA 2C8CA 1GXYA 2WN4A 3BW8A 1GIRA 1YQYA 1PWUA 5BWMB 1GIQA 1JKYA 1PWPA 3BUZA 1OJZA 4PKTA 3NTSA 1GZEA 1UZIA 4FXQA 4H0YA 4FMLA 1QS2A 2GWMA 2J3XA 4GY2A 1G24A 4PKWA 5DZQA 1J7NA 4XM7A 4XSHB 2WN7A 3U0JA 4XM8A 2C8EE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF6 A;  4PKS A;  5GTT A;  1GZF A;  1OG3 A;  1PWW A;  4PKU A;  2J3Z A;  4TR5 A;  5H03 A;  1QS1 A;  2C8H A;  2A9K B;  2WN6 A;  4H0T A;  5D1S A;  4H03 A;  4XSG B;  1OG4 A;  2GWL A;  2C89 A;  5D1U A;  1PWQ A;  4PKR A;  2C8D A;  2A78 B;  2J3V A;  2WN5 A;  1R4B A;  4H0V A;  1ZXV A;  2C8A A;  5H04 A;  4ELN A;  4PKQ A;  1OG1 A;  1GY0 A;  2C8G A;  2WN8 A;  2C8B X;  1OJQ A;  1R45 A;  4XM6 A;  4DV8 A;  4PKV A;  2BOV B;  2C8F E;  4FK7 A;  4GF1 A;  1PWV A;  4H0X A;  1GXZ A;  5D1T A;  2C8C A;  1GXY A;  2WN4 A;  3BW8 A;  1GIR A;  1YQY A;  1PWU A;  5BWM B;  1GIQ A;  1JKY A;  1PWP A;  3BUZ A;  1OJZ A;  4PKT A;  3NTS A;  1GZE A;  1UZI A;  4FXQ A;  4H0Y A;  4FML A;  1QS2 A;  2GWM A;  2J3X A;  4GY2 A;  1G24 A;  4PKW A;  5DZQ A;  1J7N A;  4XM7 A;  4XSH B;  2WN7 A;  3U0J A;  4XM8 A;  2C8E E; 
#chains in the Genus database with same CATH topology
 4WF6 A;  4PKS A;  5GTT A;  1GZF A;  1OG3 A;  1PWW A;  4PKU A;  2J3Z A;  4TR5 A;  5H03 A;  1QS1 A;  2C8H A;  2A9K B;  2WN6 A;  4H0T A;  5D1S A;  4H03 A;  4XSG B;  1OG4 A;  2GWL A;  2C89 A;  5D1U A;  1PWQ A;  4PKR A;  2C8D A;  2A78 B;  2J3V A;  2WN5 A;  1R4B A;  4H0V A;  1ZXV A;  2C8A A;  5H04 A;  4ELN A;  4PKQ A;  1OG1 A;  1GY0 A;  2C8G A;  2WN8 A;  2C8B X;  1OJQ A;  1R45 A;  4XM6 A;  4DV8 A;  4PKV A;  2BOV B;  2C8F E;  4FK7 A;  4GF1 A;  1PWV A;  4H0X A;  1GXZ A;  5D1T A;  2C8C A;  1GXY A;  2WN4 A;  3BW8 A;  1GIR A;  1YQY A;  1PWU A;  5BWM B;  1GIQ A;  1JKY A;  1PWP A;  3BUZ A;  1OJZ A;  4PKT A;  3NTS A;  1GZE A;  1UZI A;  4FXQ A;  4H0Y A;  4FML A;  1QS2 A;  2GWM A;  2J3X A;  4GY2 A;  1G24 A;  4PKW A;  5DZQ A;  1J7N A;  4XM7 A;  4XSH B;  2WN7 A;  3U0J A;  4XM8 A;  2C8E E; 
#chains in the Genus database with same CATH homology
 4WF6 A;  4PKS A;  5GTT A;  1GZF A;  1OG3 A;  1PWW A;  4PKU A;  2J3Z A;  4TR5 A;  5H03 A;  1QS1 A;  2C8H A;  2A9K B;  2WN6 A;  4H0T A;  5D1S A;  4H03 A;  4XSG B;  1OG4 A;  2GWL A;  2C89 A;  5D1U A;  1PWQ A;  4PKR A;  2C8D A;  2A78 B;  2J3V A;  2WN5 A;  1R4B A;  4H0V A;  1ZXV A;  2C8A A;  5H04 A;  4ELN A;  4PKQ A;  1OG1 A;  1GY0 A;  2C8G A;  2WN8 A;  2C8B X;  1OJQ A;  1R45 A;  4XM6 A;  4DV8 A;  4PKV A;  2BOV B;  2C8F E;  4FK7 A;  4GF1 A;  1PWV A;  4H0X A;  1GXZ A;  5D1T A;  2C8C A;  1GXY A;  2WN4 A;  3BW8 A;  1GIR A;  1YQY A;  1PWU A;  5BWM B;  1GIQ A;  1JKY A;  1PWP A;  3BUZ A;  1OJZ A;  4PKT A;  3NTS A;  1GZE A;  1UZI A;  4FXQ A;  4H0Y A;  4FML A;  1QS2 A;  2GWM A;  2J3X A;  4GY2 A;  1G24 A;  4PKW A;  5DZQ A;  1J7N A;  4XM7 A;  4XSH B;  2WN7 A;  3U0J A;  4XM8 A;  2C8E E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...