2C8HA

Structure of the pn loop q182a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
204
structure length
204
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSAFAGRPIITKFKVAKGSKAGYIDPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Properties of Wild-Type and Two Artt Motif Mutants Clostridium Botulinum C3 Exoenzyme Isoform 1 in Different Substrate Complexed States and Crystal Forms.
rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 66
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8hA00
1PWQA 5GTTA 2GWMA 1J7NA 2J3ZA 2C8BX 5H04A 4PKQA 4PKTA 1PWWA 1QS2A 1GY0A 2C8AA 1QS1A 4TR5A 4XM7A 2WN5A 2J3XA 4DV8A 2BOVB 4GY2A 5D1SA 4H0VA 4XSGB 4WF6A 1GZFA 5D1UA 4GF1A 4H03A 4ELNA 2C8HA 4PKRA 1ZXVA 1R45A 1R4BA 4FXQA 1PWUA 4XSHB 1OG1A 3BUZA 1YQYA 1G24A 4H0XA 2C8EE 3BW8A 1GZEA 4PKSA 2C8GA 4H0TA 2C89A 3NTSA 1JKYA 2J3VA 2WN7A 1GXYA 2WN6A 2A78B 1OJQA 4XM8A 2C8FE 4H0YA 4XM6A 2C8DA 5DZQA 4FK7A 5BWMB 1OJZA 5D1TA 5H03A 1PWPA 4PKVA 1PWVA 1OG3A 2WN8A 1GIQA 2WN4A 4PKWA 3U0JA 2C8CA 4FMLA 1GIRA 2A9KB 1OG4A 1UZIA 4PKUA 2GWLA 1GXZA
chains in the Genus database with same CATH superfamily
1PWQA 5GTTA 2GWMA 1J7NA 2J3ZA 2C8BX 5H04A 4PKQA 4PKTA 1PWWA 1QS2A 1GY0A 2C8AA 1QS1A 4TR5A 4XM7A 2WN5A 2J3XA 4DV8A 2BOVB 4GY2A 5D1SA 4H0VA 4XSGB 4WF6A 1GZFA 5D1UA 4GF1A 4H03A 4ELNA 2C8HA 4PKRA 1ZXVA 1R45A 1R4BA 4FXQA 1PWUA 4XSHB 1OG1A 3BUZA 1YQYA 1G24A 4H0XA 2C8EE 3BW8A 1GZEA 4PKSA 2C8GA 4H0TA 2C89A 3NTSA 1JKYA 2J3VA 2WN7A 1GXYA 2WN6A 2A78B 1OJQA 4XM8A 2C8FE 4H0YA 4XM6A 2C8DA 5DZQA 4FK7A 5BWMB 1OJZA 5D1TA 5H03A 1PWPA 4PKVA 1PWVA 1OG3A 2WN8A 1GIQA 2WN4A 4PKWA 3U0JA 2C8CA 4FMLA 1GIRA 2A9KB 1OG4A 1UZIA 4PKUA 2GWLA 1GXZA
chains in the Genus database with same CATH topology
1PWQA 5GTTA 2GWMA 1J7NA 2J3ZA 2C8BX 5H04A 4PKQA 4PKTA 1PWWA 1QS2A 1GY0A 2C8AA 1QS1A 4TR5A 4XM7A 2WN5A 2J3XA 4DV8A 2BOVB 4GY2A 5D1SA 4H0VA 4XSGB 4WF6A 1GZFA 5D1UA 4GF1A 4H03A 4ELNA 2C8HA 4PKRA 1ZXVA 1R45A 1R4BA 4FXQA 1PWUA 4XSHB 1OG1A 3BUZA 1YQYA 1G24A 4H0XA 2C8EE 3BW8A 1GZEA 4PKSA 2C8GA 4H0TA 2C89A 3NTSA 1JKYA 2J3VA 2WN7A 1GXYA 2WN6A 2A78B 1OJQA 4XM8A 2C8FE 4H0YA 4XM6A 2C8DA 5DZQA 4FK7A 5BWMB 1OJZA 5D1TA 5H03A 1PWPA 4PKVA 1PWVA 1OG3A 2WN8A 1GIQA 2WN4A 4PKWA 3U0JA 2C8CA 4FMLA 1GIRA 2A9KB 1OG4A 1UZIA 4PKUA 2GWLA 1GXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWQ A;  5GTT A;  2GWM A;  1J7N A;  2J3Z A;  2C8B X;  5H04 A;  4PKQ A;  4PKT A;  1PWW A;  1QS2 A;  1GY0 A;  2C8A A;  1QS1 A;  4TR5 A;  4XM7 A;  2WN5 A;  2J3X A;  4DV8 A;  2BOV B;  4GY2 A;  5D1S A;  4H0V A;  4XSG B;  4WF6 A;  1GZF A;  5D1U A;  4GF1 A;  4H03 A;  4ELN A;  2C8H A;  4PKR A;  1ZXV A;  1R45 A;  1R4B A;  4FXQ A;  1PWU A;  4XSH B;  1OG1 A;  3BUZ A;  1YQY A;  1G24 A;  4H0X A;  2C8E E;  3BW8 A;  1GZE A;  4PKS A;  2C8G A;  4H0T A;  2C89 A;  3NTS A;  1JKY A;  2J3V A;  2WN7 A;  1GXY A;  2WN6 A;  2A78 B;  1OJQ A;  4XM8 A;  2C8F E;  4H0Y A;  4XM6 A;  2C8D A;  5DZQ A;  4FK7 A;  5BWM B;  1OJZ A;  5D1T A;  5H03 A;  1PWP A;  4PKV A;  1PWV A;  1OG3 A;  2WN8 A;  1GIQ A;  2WN4 A;  4PKW A;  3U0J A;  2C8C A;  4FML A;  1GIR A;  2A9K B;  1OG4 A;  1UZI A;  4PKU A;  2GWL A;  1GXZ A; 
#chains in the Genus database with same CATH topology
 1PWQ A;  5GTT A;  2GWM A;  1J7N A;  2J3Z A;  2C8B X;  5H04 A;  4PKQ A;  4PKT A;  1PWW A;  1QS2 A;  1GY0 A;  2C8A A;  1QS1 A;  4TR5 A;  4XM7 A;  2WN5 A;  2J3X A;  4DV8 A;  2BOV B;  4GY2 A;  5D1S A;  4H0V A;  4XSG B;  4WF6 A;  1GZF A;  5D1U A;  4GF1 A;  4H03 A;  4ELN A;  2C8H A;  4PKR A;  1ZXV A;  1R45 A;  1R4B A;  4FXQ A;  1PWU A;  4XSH B;  1OG1 A;  3BUZ A;  1YQY A;  1G24 A;  4H0X A;  2C8E E;  3BW8 A;  1GZE A;  4PKS A;  2C8G A;  4H0T A;  2C89 A;  3NTS A;  1JKY A;  2J3V A;  2WN7 A;  1GXY A;  2WN6 A;  2A78 B;  1OJQ A;  4XM8 A;  2C8F E;  4H0Y A;  4XM6 A;  2C8D A;  5DZQ A;  4FK7 A;  5BWM B;  1OJZ A;  5D1T A;  5H03 A;  1PWP A;  4PKV A;  1PWV A;  1OG3 A;  2WN8 A;  1GIQ A;  2WN4 A;  4PKW A;  3U0J A;  2C8C A;  4FML A;  1GIR A;  2A9K B;  1OG4 A;  1UZI A;  4PKU A;  2GWL A;  1GXZ A; 
#chains in the Genus database with same CATH homology
 1PWQ A;  5GTT A;  2GWM A;  1J7N A;  2J3Z A;  2C8B X;  5H04 A;  4PKQ A;  4PKT A;  1PWW A;  1QS2 A;  1GY0 A;  2C8A A;  1QS1 A;  4TR5 A;  4XM7 A;  2WN5 A;  2J3X A;  4DV8 A;  2BOV B;  4GY2 A;  5D1S A;  4H0V A;  4XSG B;  4WF6 A;  1GZF A;  5D1U A;  4GF1 A;  4H03 A;  4ELN A;  2C8H A;  4PKR A;  1ZXV A;  1R45 A;  1R4B A;  4FXQ A;  1PWU A;  4XSH B;  1OG1 A;  3BUZ A;  1YQY A;  1G24 A;  4H0X A;  2C8E E;  3BW8 A;  1GZE A;  4PKS A;  2C8G A;  4H0T A;  2C89 A;  3NTS A;  1JKY A;  2J3V A;  2WN7 A;  1GXY A;  2WN6 A;  2A78 B;  1OJQ A;  4XM8 A;  2C8F E;  4H0Y A;  4XM6 A;  2C8D A;  5DZQ A;  4FK7 A;  5BWM B;  1OJZ A;  5D1T A;  5H03 A;  1PWP A;  4PKV A;  1PWV A;  1OG3 A;  2WN8 A;  1GIQ A;  2WN4 A;  4PKW A;  3U0J A;  2C8C A;  4FML A;  1GIR A;  2A9K B;  1OG4 A;  1UZI A;  4PKU A;  2GWL A;  1GXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...