4TR5A

C3larvin toxin, an adp-ribosyltransferase from paenibacillus larvae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
ENLYFQGSHMVGEKEYKAWEKKLRANEKELVKEYTANAKPFNTYLRANEGKLGFKPEIDKKILKLDEALKKSKLSETVQVYRGDDTSIFGKEFQNSIYQGNKVNRELFRKLRDEYQGKIRTEYGYLSTSIVSNQQFAMRPVLTTLKVPKGAHAGYVDKISQYKGQYELLLPRNTKYKIDKMYIIVNKGSETIKIEATVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords C3larvin
publication title C3larvin Toxin, an ADP-ribosyltransferase from Paenibacillus larvae.
pubmed doi rcsb
source organism Paenibacillus larvae subsp. larvae brl-230010
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4tr5A00
4H0TA 1OG4A 2WN4A 5DZQA 4GY2A 4GF1A 1GXYA 4FXQA 2A9KB 4FMLA 4XSHB 2GWMA 2J3XA 2WN5A 4ELNA 1ZXVA 2C8BX 4H0YA 1GXZA 1PWVA 4XM7A 5H03A 1GZFA 1UZIA 3NTSA 2BOVB 4XM6A 3BW8A 2GWLA 1YQYA 3BUZA 5H04A 4H0XA 2J3ZA 4PKVA 2C8CA 1OG1A 5GTTA 1PWQA 5BWMB 4WF6A 1GIRA 4PKRA 4PKSA 4PKTA 2C8FE 4FK7A 4XSGB 1PWUA 5D1TA 5D1UA 1PWWA 2C89A 1OG3A 1G24A 2A78B 4H03A 2C8HA 2C8GA 2WN8A 1OJZA 1QS2A 1R4BA 2WN6A 4TR5A 1PWPA 2WN7A 2J3VA 4XM8A 4PKQA 1GIQA 1JKYA 1R45A 5D1SA 4DV8A 1GY0A 2C8EE 1GZEA 2C8AA 1OJQA 4PKWA 1J7NA 2C8DA 4H0VA 1QS1A 4PKUA 3U0JA
chains in the Genus database with same CATH superfamily
4H0TA 1OG4A 2WN4A 5DZQA 4GY2A 4GF1A 1GXYA 4FXQA 2A9KB 4FMLA 4XSHB 2GWMA 2J3XA 2WN5A 4ELNA 1ZXVA 2C8BX 4H0YA 1GXZA 1PWVA 4XM7A 5H03A 1GZFA 1UZIA 3NTSA 2BOVB 4XM6A 3BW8A 2GWLA 1YQYA 3BUZA 5H04A 4H0XA 2J3ZA 4PKVA 2C8CA 1OG1A 5GTTA 1PWQA 5BWMB 4WF6A 1GIRA 4PKRA 4PKSA 4PKTA 2C8FE 4FK7A 4XSGB 1PWUA 5D1TA 5D1UA 1PWWA 2C89A 1OG3A 1G24A 2A78B 4H03A 2C8HA 2C8GA 2WN8A 1OJZA 1QS2A 1R4BA 2WN6A 4TR5A 1PWPA 2WN7A 2J3VA 4XM8A 4PKQA 1GIQA 1JKYA 1R45A 5D1SA 4DV8A 1GY0A 2C8EE 1GZEA 2C8AA 1OJQA 4PKWA 1J7NA 2C8DA 4H0VA 1QS1A 4PKUA 3U0JA
chains in the Genus database with same CATH topology
4H0TA 1OG4A 2WN4A 5DZQA 4GY2A 4GF1A 1GXYA 4FXQA 2A9KB 4FMLA 4XSHB 2GWMA 2J3XA 2WN5A 4ELNA 1ZXVA 2C8BX 4H0YA 1GXZA 1PWVA 4XM7A 5H03A 1GZFA 1UZIA 3NTSA 2BOVB 4XM6A 3BW8A 2GWLA 1YQYA 3BUZA 5H04A 4H0XA 2J3ZA 4PKVA 2C8CA 1OG1A 5GTTA 1PWQA 5BWMB 4WF6A 1GIRA 4PKRA 4PKSA 4PKTA 2C8FE 4FK7A 4XSGB 1PWUA 5D1TA 5D1UA 1PWWA 2C89A 1OG3A 1G24A 2A78B 4H03A 2C8HA 2C8GA 2WN8A 1OJZA 1QS2A 1R4BA 2WN6A 4TR5A 1PWPA 2WN7A 2J3VA 4XM8A 4PKQA 1GIQA 1JKYA 1R45A 5D1SA 4DV8A 1GY0A 2C8EE 1GZEA 2C8AA 1OJQA 4PKWA 1J7NA 2C8DA 4H0VA 1QS1A 4PKUA 3U0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0T A;  1OG4 A;  2WN4 A;  5DZQ A;  4GY2 A;  4GF1 A;  1GXY A;  4FXQ A;  2A9K B;  4FML A;  4XSH B;  2GWM A;  2J3X A;  2WN5 A;  4ELN A;  1ZXV A;  2C8B X;  4H0Y A;  1GXZ A;  1PWV A;  4XM7 A;  5H03 A;  1GZF A;  1UZI A;  3NTS A;  2BOV B;  4XM6 A;  3BW8 A;  2GWL A;  1YQY A;  3BUZ A;  5H04 A;  4H0X A;  2J3Z A;  4PKV A;  2C8C A;  1OG1 A;  5GTT A;  1PWQ A;  5BWM B;  4WF6 A;  1GIR A;  4PKR A;  4PKS A;  4PKT A;  2C8F E;  4FK7 A;  4XSG B;  1PWU A;  5D1T A;  5D1U A;  1PWW A;  2C89 A;  1OG3 A;  1G24 A;  2A78 B;  4H03 A;  2C8H A;  2C8G A;  2WN8 A;  1OJZ A;  1QS2 A;  1R4B A;  2WN6 A;  4TR5 A;  1PWP A;  2WN7 A;  2J3V A;  4XM8 A;  4PKQ A;  1GIQ A;  1JKY A;  1R45 A;  5D1S A;  4DV8 A;  1GY0 A;  2C8E E;  1GZE A;  2C8A A;  1OJQ A;  4PKW A;  1J7N A;  2C8D A;  4H0V A;  1QS1 A;  4PKU A;  3U0J A; 
#chains in the Genus database with same CATH topology
 4H0T A;  1OG4 A;  2WN4 A;  5DZQ A;  4GY2 A;  4GF1 A;  1GXY A;  4FXQ A;  2A9K B;  4FML A;  4XSH B;  2GWM A;  2J3X A;  2WN5 A;  4ELN A;  1ZXV A;  2C8B X;  4H0Y A;  1GXZ A;  1PWV A;  4XM7 A;  5H03 A;  1GZF A;  1UZI A;  3NTS A;  2BOV B;  4XM6 A;  3BW8 A;  2GWL A;  1YQY A;  3BUZ A;  5H04 A;  4H0X A;  2J3Z A;  4PKV A;  2C8C A;  1OG1 A;  5GTT A;  1PWQ A;  5BWM B;  4WF6 A;  1GIR A;  4PKR A;  4PKS A;  4PKT A;  2C8F E;  4FK7 A;  4XSG B;  1PWU A;  5D1T A;  5D1U A;  1PWW A;  2C89 A;  1OG3 A;  1G24 A;  2A78 B;  4H03 A;  2C8H A;  2C8G A;  2WN8 A;  1OJZ A;  1QS2 A;  1R4B A;  2WN6 A;  4TR5 A;  1PWP A;  2WN7 A;  2J3V A;  4XM8 A;  4PKQ A;  1GIQ A;  1JKY A;  1R45 A;  5D1S A;  4DV8 A;  1GY0 A;  2C8E E;  1GZE A;  2C8A A;  1OJQ A;  4PKW A;  1J7N A;  2C8D A;  4H0V A;  1QS1 A;  4PKU A;  3U0J A; 
#chains in the Genus database with same CATH homology
 4H0T A;  1OG4 A;  2WN4 A;  5DZQ A;  4GY2 A;  4GF1 A;  1GXY A;  4FXQ A;  2A9K B;  4FML A;  4XSH B;  2GWM A;  2J3X A;  2WN5 A;  4ELN A;  1ZXV A;  2C8B X;  4H0Y A;  1GXZ A;  1PWV A;  4XM7 A;  5H03 A;  1GZF A;  1UZI A;  3NTS A;  2BOV B;  4XM6 A;  3BW8 A;  2GWL A;  1YQY A;  3BUZ A;  5H04 A;  4H0X A;  2J3Z A;  4PKV A;  2C8C A;  1OG1 A;  5GTT A;  1PWQ A;  5BWM B;  4WF6 A;  1GIR A;  4PKR A;  4PKS A;  4PKT A;  2C8F E;  4FK7 A;  4XSG B;  1PWU A;  5D1T A;  5D1U A;  1PWW A;  2C89 A;  1OG3 A;  1G24 A;  2A78 B;  4H03 A;  2C8H A;  2C8G A;  2WN8 A;  1OJZ A;  1QS2 A;  1R4B A;  2WN6 A;  4TR5 A;  1PWP A;  2WN7 A;  2J3V A;  4XM8 A;  4PKQ A;  1GIQ A;  1JKY A;  1R45 A;  5D1S A;  4DV8 A;  1GY0 A;  2C8E E;  1GZE A;  2C8A A;  1OJQ A;  4PKW A;  1J7N A;  2C8D A;  4H0V A;  1QS1 A;  4PKU A;  3U0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...