4TR5A

C3larvin toxin, an adp-ribosyltransferase from paenibacillus larvae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
ENLYFQGSHMVGEKEYKAWEKKLRANEKELVKEYTANAKPFNTYLRANEGKLGFKPEIDKKILKLDEALKKSKLSETVQVYRGDDTSIFGKEFQNSIYQGNKVNRELFRKLRDEYQGKIRTEYGYLSTSIVSNQQFAMRPVLTTLKVPKGAHAGYVDKISQYKGQYELLLPRNTKYKIDKMYIIVNKGSETIKIEATVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C3larvin
publication title C3larvin Toxin, an ADP-ribosyltransferase from Paenibacillus larvae.
pubmed doi rcsb
source organism Paenibacillus larvae subsp. larvae brl-230010
molecule tags Transferase
total genus 60
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2014-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4tr5A00
1PWPA 4PKUA 4DV8A 2J3ZA 1ZXVA 4H0TA 4XM7A 2C8EE 4TR5A 5D1SA 1PWQA 1OG4A 1PWWA 5H03A 4FK7A 2C8BX 1GZEA 2J3XA 1OJZA 1QS2A 1J7NA 4PKSA 1R45A 5GTTA 1GXZA 5DZQA 2C8CA 1UZIA 1GIRA 5H04A 5BWMB 4H0VA 3BUZA 4WF6A 2WN4A 1OJQA 2A9KB 1R4BA 4XSHB 1GZFA 2WN7A 2WN5A 4GY2A 4ELNA 4PKWA 2C8DA 2WN6A 4XM6A 1QS1A 2C8FE 4XM8A 1GY0A 1G24A 1JKYA 4FXQA 1PWVA 1OG1A 4PKRA 4PKTA 4PKQA 2A78B 1YQYA 1OG3A 3BW8A 2C8HA 1GXYA 3U0JA 4H0XA 2BOVB 3NTSA 2C8GA 2GWLA 2J3VA 5D1TA 4FMLA 1GIQA 4XSGB 2WN8A 2GWMA 4H0YA 2C89A 4GF1A 2C8AA 5D1UA 1PWUA 4H03A 4PKVA
chains in the Genus database with same CATH superfamily
1PWPA 4PKUA 4DV8A 2J3ZA 1ZXVA 4H0TA 4XM7A 2C8EE 4TR5A 5D1SA 1PWQA 1OG4A 1PWWA 5H03A 4FK7A 2C8BX 1GZEA 2J3XA 1OJZA 1QS2A 1J7NA 4PKSA 1R45A 5GTTA 1GXZA 5DZQA 2C8CA 1UZIA 1GIRA 5H04A 5BWMB 4H0VA 3BUZA 4WF6A 2WN4A 1OJQA 2A9KB 1R4BA 4XSHB 1GZFA 2WN7A 2WN5A 4GY2A 4ELNA 4PKWA 2C8DA 2WN6A 4XM6A 1QS1A 2C8FE 4XM8A 1GY0A 1G24A 1JKYA 4FXQA 1PWVA 1OG1A 4PKRA 4PKTA 4PKQA 2A78B 1YQYA 1OG3A 3BW8A 2C8HA 1GXYA 3U0JA 4H0XA 2BOVB 3NTSA 2C8GA 2GWLA 2J3VA 5D1TA 4FMLA 1GIQA 4XSGB 2WN8A 2GWMA 4H0YA 2C89A 4GF1A 2C8AA 5D1UA 1PWUA 4H03A 4PKVA
chains in the Genus database with same CATH topology
1PWPA 4PKUA 4DV8A 2J3ZA 1ZXVA 4H0TA 4XM7A 2C8EE 4TR5A 5D1SA 1PWQA 1OG4A 1PWWA 5H03A 4FK7A 2C8BX 1GZEA 2J3XA 1OJZA 1QS2A 1J7NA 4PKSA 1R45A 5GTTA 1GXZA 5DZQA 2C8CA 1UZIA 1GIRA 5H04A 5BWMB 4H0VA 3BUZA 4WF6A 2WN4A 1OJQA 2A9KB 1R4BA 4XSHB 1GZFA 2WN7A 2WN5A 4GY2A 4ELNA 4PKWA 2C8DA 2WN6A 4XM6A 1QS1A 2C8FE 4XM8A 1GY0A 1G24A 1JKYA 4FXQA 1PWVA 1OG1A 4PKRA 4PKTA 4PKQA 2A78B 1YQYA 1OG3A 3BW8A 2C8HA 1GXYA 3U0JA 4H0XA 2BOVB 3NTSA 2C8GA 2GWLA 2J3VA 5D1TA 4FMLA 1GIQA 4XSGB 2WN8A 2GWMA 4H0YA 2C89A 4GF1A 2C8AA 5D1UA 1PWUA 4H03A 4PKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWP A;  4PKU A;  4DV8 A;  2J3Z A;  1ZXV A;  4H0T A;  4XM7 A;  2C8E E;  4TR5 A;  5D1S A;  1PWQ A;  1OG4 A;  1PWW A;  5H03 A;  4FK7 A;  2C8B X;  1GZE A;  2J3X A;  1OJZ A;  1QS2 A;  1J7N A;  4PKS A;  1R45 A;  5GTT A;  1GXZ A;  5DZQ A;  2C8C A;  1UZI A;  1GIR A;  5H04 A;  5BWM B;  4H0V A;  3BUZ A;  4WF6 A;  2WN4 A;  1OJQ A;  2A9K B;  1R4B A;  4XSH B;  1GZF A;  2WN7 A;  2WN5 A;  4GY2 A;  4ELN A;  4PKW A;  2C8D A;  2WN6 A;  4XM6 A;  1QS1 A;  2C8F E;  4XM8 A;  1GY0 A;  1G24 A;  1JKY A;  4FXQ A;  1PWV A;  1OG1 A;  4PKR A;  4PKT A;  4PKQ A;  2A78 B;  1YQY A;  1OG3 A;  3BW8 A;  2C8H A;  1GXY A;  3U0J A;  4H0X A;  2BOV B;  3NTS A;  2C8G A;  2GWL A;  2J3V A;  5D1T A;  4FML A;  1GIQ A;  4XSG B;  2WN8 A;  2GWM A;  4H0Y A;  2C89 A;  4GF1 A;  2C8A A;  5D1U A;  1PWU A;  4H03 A;  4PKV A; 
#chains in the Genus database with same CATH topology
 1PWP A;  4PKU A;  4DV8 A;  2J3Z A;  1ZXV A;  4H0T A;  4XM7 A;  2C8E E;  4TR5 A;  5D1S A;  1PWQ A;  1OG4 A;  1PWW A;  5H03 A;  4FK7 A;  2C8B X;  1GZE A;  2J3X A;  1OJZ A;  1QS2 A;  1J7N A;  4PKS A;  1R45 A;  5GTT A;  1GXZ A;  5DZQ A;  2C8C A;  1UZI A;  1GIR A;  5H04 A;  5BWM B;  4H0V A;  3BUZ A;  4WF6 A;  2WN4 A;  1OJQ A;  2A9K B;  1R4B A;  4XSH B;  1GZF A;  2WN7 A;  2WN5 A;  4GY2 A;  4ELN A;  4PKW A;  2C8D A;  2WN6 A;  4XM6 A;  1QS1 A;  2C8F E;  4XM8 A;  1GY0 A;  1G24 A;  1JKY A;  4FXQ A;  1PWV A;  1OG1 A;  4PKR A;  4PKT A;  4PKQ A;  2A78 B;  1YQY A;  1OG3 A;  3BW8 A;  2C8H A;  1GXY A;  3U0J A;  4H0X A;  2BOV B;  3NTS A;  2C8G A;  2GWL A;  2J3V A;  5D1T A;  4FML A;  1GIQ A;  4XSG B;  2WN8 A;  2GWM A;  4H0Y A;  2C89 A;  4GF1 A;  2C8A A;  5D1U A;  1PWU A;  4H03 A;  4PKV A; 
#chains in the Genus database with same CATH homology
 1PWP A;  4PKU A;  4DV8 A;  2J3Z A;  1ZXV A;  4H0T A;  4XM7 A;  2C8E E;  4TR5 A;  5D1S A;  1PWQ A;  1OG4 A;  1PWW A;  5H03 A;  4FK7 A;  2C8B X;  1GZE A;  2J3X A;  1OJZ A;  1QS2 A;  1J7N A;  4PKS A;  1R45 A;  5GTT A;  1GXZ A;  5DZQ A;  2C8C A;  1UZI A;  1GIR A;  5H04 A;  5BWM B;  4H0V A;  3BUZ A;  4WF6 A;  2WN4 A;  1OJQ A;  2A9K B;  1R4B A;  4XSH B;  1GZF A;  2WN7 A;  2WN5 A;  4GY2 A;  4ELN A;  4PKW A;  2C8D A;  2WN6 A;  4XM6 A;  1QS1 A;  2C8F E;  4XM8 A;  1GY0 A;  1G24 A;  1JKY A;  4FXQ A;  1PWV A;  1OG1 A;  4PKR A;  4PKT A;  4PKQ A;  2A78 B;  1YQY A;  1OG3 A;  3BW8 A;  2C8H A;  1GXY A;  3U0J A;  4H0X A;  2BOV B;  3NTS A;  2C8G A;  2GWL A;  2J3V A;  5D1T A;  4FML A;  1GIQ A;  4XSG B;  2WN8 A;  2GWM A;  4H0Y A;  2C89 A;  4GF1 A;  2C8A A;  5D1U A;  1PWU A;  4H03 A;  4PKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...