1R4BA

Adp-ribosyltransferase c3bot2 from clostridium botulinum, monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
TFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal Structure of ADP-RIBOSYLTRANSFERASE C3bot2 from CLOSTRIDIUM BOTULINUM
rcsb
source organism Clostridium phage c-st
molecule tags Transferase
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r4bA00
2WN4A 4FXQA 2C8FE 4PKQA 4XM8A 1GZEA 5BWMB 4XSHB 1R4BA 1QS2A 1OG4A 2J3VA 4PKSA 4TR5A 1JKYA 2C8AA 3U0JA 4PKRA 4XM6A 5H04A 5D1UA 1R45A 4GF1A 1GZFA 1PWUA 2C89A 2J3XA 4PKUA 2C8HA 3BW8A 1PWQA 1GXZA 2C8BX 4ELNA 2C8DA 5D1TA 1GY0A 2GWLA 2WN8A 4H0VA 2A78B 3NTSA 1QS1A 4XM7A 1OG3A 1OJZA 1ZXVA 2J3ZA 4H0TA 4FMLA 1GIQA 4FK7A 1PWVA 2WN5A 5H03A 4DV8A 1GXYA 1G24A 1OJQA 1UZIA 4H03A 3BUZA 4GY2A 1J7NA 4H0YA 1PWWA 4PKWA 2C8GA 2BOVB 2WN7A 1YQYA 5DZQA 4PKVA 1GIRA 2WN6A 2GWMA 5GTTA 4H0XA 1PWPA 4WF6A 1OG1A 5D1SA 2C8CA 4PKTA 2C8EE 2A9KB 4XSGB
chains in the Genus database with same CATH superfamily
2WN4A 4FXQA 2C8FE 4PKQA 4XM8A 1GZEA 5BWMB 4XSHB 1R4BA 1QS2A 1OG4A 2J3VA 4PKSA 4TR5A 1JKYA 2C8AA 3U0JA 4PKRA 4XM6A 5H04A 5D1UA 1R45A 4GF1A 1GZFA 1PWUA 2C89A 2J3XA 4PKUA 2C8HA 3BW8A 1PWQA 1GXZA 2C8BX 4ELNA 2C8DA 5D1TA 1GY0A 2GWLA 2WN8A 4H0VA 2A78B 3NTSA 1QS1A 4XM7A 1OG3A 1OJZA 1ZXVA 2J3ZA 4H0TA 4FMLA 1GIQA 4FK7A 1PWVA 2WN5A 5H03A 4DV8A 1GXYA 1G24A 1OJQA 1UZIA 4H03A 3BUZA 4GY2A 1J7NA 4H0YA 1PWWA 4PKWA 2C8GA 2BOVB 2WN7A 1YQYA 5DZQA 4PKVA 1GIRA 2WN6A 2GWMA 5GTTA 4H0XA 1PWPA 4WF6A 1OG1A 5D1SA 2C8CA 4PKTA 2C8EE 2A9KB 4XSGB
chains in the Genus database with same CATH topology
2WN4A 4FXQA 2C8FE 4PKQA 4XM8A 1GZEA 5BWMB 4XSHB 1R4BA 1QS2A 1OG4A 2J3VA 4PKSA 4TR5A 1JKYA 2C8AA 3U0JA 4PKRA 4XM6A 5H04A 5D1UA 1R45A 4GF1A 1GZFA 1PWUA 2C89A 2J3XA 4PKUA 2C8HA 3BW8A 1PWQA 1GXZA 2C8BX 4ELNA 2C8DA 5D1TA 1GY0A 2GWLA 2WN8A 4H0VA 2A78B 3NTSA 1QS1A 4XM7A 1OG3A 1OJZA 1ZXVA 2J3ZA 4H0TA 4FMLA 1GIQA 4FK7A 1PWVA 2WN5A 5H03A 4DV8A 1GXYA 1G24A 1OJQA 1UZIA 4H03A 3BUZA 4GY2A 1J7NA 4H0YA 1PWWA 4PKWA 2C8GA 2BOVB 2WN7A 1YQYA 5DZQA 4PKVA 1GIRA 2WN6A 2GWMA 5GTTA 4H0XA 1PWPA 4WF6A 1OG1A 5D1SA 2C8CA 4PKTA 2C8EE 2A9KB 4XSGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WN4 A;  4FXQ A;  2C8F E;  4PKQ A;  4XM8 A;  1GZE A;  5BWM B;  4XSH B;  1R4B A;  1QS2 A;  1OG4 A;  2J3V A;  4PKS A;  4TR5 A;  1JKY A;  2C8A A;  3U0J A;  4PKR A;  4XM6 A;  5H04 A;  5D1U A;  1R45 A;  4GF1 A;  1GZF A;  1PWU A;  2C89 A;  2J3X A;  4PKU A;  2C8H A;  3BW8 A;  1PWQ A;  1GXZ A;  2C8B X;  4ELN A;  2C8D A;  5D1T A;  1GY0 A;  2GWL A;  2WN8 A;  4H0V A;  2A78 B;  3NTS A;  1QS1 A;  4XM7 A;  1OG3 A;  1OJZ A;  1ZXV A;  2J3Z A;  4H0T A;  4FML A;  1GIQ A;  4FK7 A;  1PWV A;  2WN5 A;  5H03 A;  4DV8 A;  1GXY A;  1G24 A;  1OJQ A;  1UZI A;  4H03 A;  3BUZ A;  4GY2 A;  1J7N A;  4H0Y A;  1PWW A;  4PKW A;  2C8G A;  2BOV B;  2WN7 A;  1YQY A;  5DZQ A;  4PKV A;  1GIR A;  2WN6 A;  2GWM A;  5GTT A;  4H0X A;  1PWP A;  4WF6 A;  1OG1 A;  5D1S A;  2C8C A;  4PKT A;  2C8E E;  2A9K B;  4XSG B; 
#chains in the Genus database with same CATH topology
 2WN4 A;  4FXQ A;  2C8F E;  4PKQ A;  4XM8 A;  1GZE A;  5BWM B;  4XSH B;  1R4B A;  1QS2 A;  1OG4 A;  2J3V A;  4PKS A;  4TR5 A;  1JKY A;  2C8A A;  3U0J A;  4PKR A;  4XM6 A;  5H04 A;  5D1U A;  1R45 A;  4GF1 A;  1GZF A;  1PWU A;  2C89 A;  2J3X A;  4PKU A;  2C8H A;  3BW8 A;  1PWQ A;  1GXZ A;  2C8B X;  4ELN A;  2C8D A;  5D1T A;  1GY0 A;  2GWL A;  2WN8 A;  4H0V A;  2A78 B;  3NTS A;  1QS1 A;  4XM7 A;  1OG3 A;  1OJZ A;  1ZXV A;  2J3Z A;  4H0T A;  4FML A;  1GIQ A;  4FK7 A;  1PWV A;  2WN5 A;  5H03 A;  4DV8 A;  1GXY A;  1G24 A;  1OJQ A;  1UZI A;  4H03 A;  3BUZ A;  4GY2 A;  1J7N A;  4H0Y A;  1PWW A;  4PKW A;  2C8G A;  2BOV B;  2WN7 A;  1YQY A;  5DZQ A;  4PKV A;  1GIR A;  2WN6 A;  2GWM A;  5GTT A;  4H0X A;  1PWP A;  4WF6 A;  1OG1 A;  5D1S A;  2C8C A;  4PKT A;  2C8E E;  2A9K B;  4XSG B; 
#chains in the Genus database with same CATH homology
 2WN4 A;  4FXQ A;  2C8F E;  4PKQ A;  4XM8 A;  1GZE A;  5BWM B;  4XSH B;  1R4B A;  1QS2 A;  1OG4 A;  2J3V A;  4PKS A;  4TR5 A;  1JKY A;  2C8A A;  3U0J A;  4PKR A;  4XM6 A;  5H04 A;  5D1U A;  1R45 A;  4GF1 A;  1GZF A;  1PWU A;  2C89 A;  2J3X A;  4PKU A;  2C8H A;  3BW8 A;  1PWQ A;  1GXZ A;  2C8B X;  4ELN A;  2C8D A;  5D1T A;  1GY0 A;  2GWL A;  2WN8 A;  4H0V A;  2A78 B;  3NTS A;  1QS1 A;  4XM7 A;  1OG3 A;  1OJZ A;  1ZXV A;  2J3Z A;  4H0T A;  4FML A;  1GIQ A;  4FK7 A;  1PWV A;  2WN5 A;  5H03 A;  4DV8 A;  1GXY A;  1G24 A;  1OJQ A;  1UZI A;  4H03 A;  3BUZ A;  4GY2 A;  1J7N A;  4H0Y A;  1PWW A;  4PKW A;  2C8G A;  2BOV B;  2WN7 A;  1YQY A;  5DZQ A;  4PKV A;  1GIR A;  2WN6 A;  2GWM A;  5GTT A;  4H0X A;  1PWP A;  4WF6 A;  1OG1 A;  5D1S A;  2C8C A;  4PKT A;  2C8E E;  2A9K B;  4XSG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...