1R4BA

Adp-ribosyltransferase c3bot2 from clostridium botulinum, monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
TFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal Structure of ADP-RIBOSYLTRANSFERASE C3bot2 from CLOSTRIDIUM BOTULINUM
rcsb
source organism Clostridium phage c-st
molecule tags Transferase
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r4bA00
1GZEA 1J7NA 4XM8A 1ZXVA 2C8EE 4PKSA 1R4BA 4ELNA 4H0TA 2A78B 2A9KB 2WN7A 1QS2A 4XM7A 2C8HA 5DZQA 4PKQA 3U0JA 4TR5A 4FMLA 1YQYA 5H04A 2C8CA 4FXQA 4H03A 2GWLA 1OG4A 1PWWA 1PWPA 2WN8A 5H03A 2J3ZA 2C8AA 2GWMA 5BWMB 2C8DA 4H0XA 1GZFA 1GIRA 2BOVB 3NTSA 2C89A 1PWVA 4XSGB 1OJQA 5GTTA 4WF6A 1UZIA 2WN6A 1JKYA 5D1UA 4H0YA 1GXYA 4GY2A 2J3XA 4FK7A 4GF1A 1OG1A 5D1TA 3BW8A 5D1SA 1QS1A 1PWQA 1OJZA 4XSHB 1GXZA 4PKUA 4XM6A 4PKVA 2C8BX 1OG3A 4PKTA 2C8FE 3BUZA 1GY0A 1GIQA 2J3VA 4DV8A 2C8GA 4H0VA 1R45A 1PWUA 4PKWA 1G24A 4PKRA 2WN4A 2WN5A
chains in the Genus database with same CATH superfamily
1GZEA 1J7NA 4XM8A 1ZXVA 2C8EE 4PKSA 1R4BA 4ELNA 4H0TA 2A78B 2A9KB 2WN7A 1QS2A 4XM7A 2C8HA 5DZQA 4PKQA 3U0JA 4TR5A 4FMLA 1YQYA 5H04A 2C8CA 4FXQA 4H03A 2GWLA 1OG4A 1PWWA 1PWPA 2WN8A 5H03A 2J3ZA 2C8AA 2GWMA 5BWMB 2C8DA 4H0XA 1GZFA 1GIRA 2BOVB 3NTSA 2C89A 1PWVA 4XSGB 1OJQA 5GTTA 4WF6A 1UZIA 2WN6A 1JKYA 5D1UA 4H0YA 1GXYA 4GY2A 2J3XA 4FK7A 4GF1A 1OG1A 5D1TA 3BW8A 5D1SA 1QS1A 1PWQA 1OJZA 4XSHB 1GXZA 4PKUA 4XM6A 4PKVA 2C8BX 1OG3A 4PKTA 2C8FE 3BUZA 1GY0A 1GIQA 2J3VA 4DV8A 2C8GA 4H0VA 1R45A 1PWUA 4PKWA 1G24A 4PKRA 2WN4A 2WN5A
chains in the Genus database with same CATH topology
1GZEA 1J7NA 4XM8A 1ZXVA 2C8EE 4PKSA 1R4BA 4ELNA 4H0TA 2A78B 2A9KB 2WN7A 1QS2A 4XM7A 2C8HA 5DZQA 4PKQA 3U0JA 4TR5A 4FMLA 1YQYA 5H04A 2C8CA 4FXQA 4H03A 2GWLA 1OG4A 1PWWA 1PWPA 2WN8A 5H03A 2J3ZA 2C8AA 2GWMA 5BWMB 2C8DA 4H0XA 1GZFA 1GIRA 2BOVB 3NTSA 2C89A 1PWVA 4XSGB 1OJQA 5GTTA 4WF6A 1UZIA 2WN6A 1JKYA 5D1UA 4H0YA 1GXYA 4GY2A 2J3XA 4FK7A 4GF1A 1OG1A 5D1TA 3BW8A 5D1SA 1QS1A 1PWQA 1OJZA 4XSHB 1GXZA 4PKUA 4XM6A 4PKVA 2C8BX 1OG3A 4PKTA 2C8FE 3BUZA 1GY0A 1GIQA 2J3VA 4DV8A 2C8GA 4H0VA 1R45A 1PWUA 4PKWA 1G24A 4PKRA 2WN4A 2WN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZE A;  1J7N A;  4XM8 A;  1ZXV A;  2C8E E;  4PKS A;  1R4B A;  4ELN A;  4H0T A;  2A78 B;  2A9K B;  2WN7 A;  1QS2 A;  4XM7 A;  2C8H A;  5DZQ A;  4PKQ A;  3U0J A;  4TR5 A;  4FML A;  1YQY A;  5H04 A;  2C8C A;  4FXQ A;  4H03 A;  2GWL A;  1OG4 A;  1PWW A;  1PWP A;  2WN8 A;  5H03 A;  2J3Z A;  2C8A A;  2GWM A;  5BWM B;  2C8D A;  4H0X A;  1GZF A;  1GIR A;  2BOV B;  3NTS A;  2C89 A;  1PWV A;  4XSG B;  1OJQ A;  5GTT A;  4WF6 A;  1UZI A;  2WN6 A;  1JKY A;  5D1U A;  4H0Y A;  1GXY A;  4GY2 A;  2J3X A;  4FK7 A;  4GF1 A;  1OG1 A;  5D1T A;  3BW8 A;  5D1S A;  1QS1 A;  1PWQ A;  1OJZ A;  4XSH B;  1GXZ A;  4PKU A;  4XM6 A;  4PKV A;  2C8B X;  1OG3 A;  4PKT A;  2C8F E;  3BUZ A;  1GY0 A;  1GIQ A;  2J3V A;  4DV8 A;  2C8G A;  4H0V A;  1R45 A;  1PWU A;  4PKW A;  1G24 A;  4PKR A;  2WN4 A;  2WN5 A; 
#chains in the Genus database with same CATH topology
 1GZE A;  1J7N A;  4XM8 A;  1ZXV A;  2C8E E;  4PKS A;  1R4B A;  4ELN A;  4H0T A;  2A78 B;  2A9K B;  2WN7 A;  1QS2 A;  4XM7 A;  2C8H A;  5DZQ A;  4PKQ A;  3U0J A;  4TR5 A;  4FML A;  1YQY A;  5H04 A;  2C8C A;  4FXQ A;  4H03 A;  2GWL A;  1OG4 A;  1PWW A;  1PWP A;  2WN8 A;  5H03 A;  2J3Z A;  2C8A A;  2GWM A;  5BWM B;  2C8D A;  4H0X A;  1GZF A;  1GIR A;  2BOV B;  3NTS A;  2C89 A;  1PWV A;  4XSG B;  1OJQ A;  5GTT A;  4WF6 A;  1UZI A;  2WN6 A;  1JKY A;  5D1U A;  4H0Y A;  1GXY A;  4GY2 A;  2J3X A;  4FK7 A;  4GF1 A;  1OG1 A;  5D1T A;  3BW8 A;  5D1S A;  1QS1 A;  1PWQ A;  1OJZ A;  4XSH B;  1GXZ A;  4PKU A;  4XM6 A;  4PKV A;  2C8B X;  1OG3 A;  4PKT A;  2C8F E;  3BUZ A;  1GY0 A;  1GIQ A;  2J3V A;  4DV8 A;  2C8G A;  4H0V A;  1R45 A;  1PWU A;  4PKW A;  1G24 A;  4PKR A;  2WN4 A;  2WN5 A; 
#chains in the Genus database with same CATH homology
 1GZE A;  1J7N A;  4XM8 A;  1ZXV A;  2C8E E;  4PKS A;  1R4B A;  4ELN A;  4H0T A;  2A78 B;  2A9K B;  2WN7 A;  1QS2 A;  4XM7 A;  2C8H A;  5DZQ A;  4PKQ A;  3U0J A;  4TR5 A;  4FML A;  1YQY A;  5H04 A;  2C8C A;  4FXQ A;  4H03 A;  2GWL A;  1OG4 A;  1PWW A;  1PWP A;  2WN8 A;  5H03 A;  2J3Z A;  2C8A A;  2GWM A;  5BWM B;  2C8D A;  4H0X A;  1GZF A;  1GIR A;  2BOV B;  3NTS A;  2C89 A;  1PWV A;  4XSG B;  1OJQ A;  5GTT A;  4WF6 A;  1UZI A;  2WN6 A;  1JKY A;  5D1U A;  4H0Y A;  1GXY A;  4GY2 A;  2J3X A;  4FK7 A;  4GF1 A;  1OG1 A;  5D1T A;  3BW8 A;  5D1S A;  1QS1 A;  1PWQ A;  1OJZ A;  4XSH B;  1GXZ A;  4PKU A;  4XM6 A;  4PKV A;  2C8B X;  1OG3 A;  4PKT A;  2C8F E;  3BUZ A;  1GY0 A;  1GIQ A;  2J3V A;  4DV8 A;  2C8G A;  4H0V A;  1R45 A;  1PWU A;  4PKW A;  1G24 A;  4PKR A;  2WN4 A;  2WN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...