1R4BA

Adp-ribosyltransferase c3bot2 from clostridium botulinum, monoclinic form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
TFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal Structure of ADP-RIBOSYLTRANSFERASE C3bot2 from CLOSTRIDIUM BOTULINUM
rcsb
source organism Clostridium phage c-st
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r4bA00
2J3XA 2J3ZA 5D1SA 1GIRA 5H04A 2C8GA 4FK7A 4PKRA 1G24A 1PWUA 1QS2A 4H0VA 4ELNA 4PKWA 1PWVA 1J7NA 1QS1A 1OJZA 4DV8A 1YQYA 1GY0A 1UZIA 1R45A 1OG1A 4FMLA 5D1UA 1GXZA 2C89A 2WN6A 2WN4A 2GWLA 4H03A 4H0TA 4TR5A 4PKVA 2WN8A 3NTSA 3U0JA 4WF6A 1GZEA 2A9KB 2C8BX 1ZXVA 3BW8A 1JKYA 2C8HA 4PKQA 5GTTA 1OG3A 4XSGB 1PWPA 1OG4A 5BWMB 4H0XA 2BOVB 4XM6A 4GY2A 4PKSA 3BUZA 1R4BA 2C8CA 2C8AA 4PKTA 4PKUA 2C8DA 5DZQA 4XM7A 1GZFA 2C8FE 4XM8A 5H03A 1GXYA 1PWWA 4XSHB 4FXQA 2A78B 2WN5A 4H0YA 1GIQA 2J3VA 1PWQA 2GWMA 1OJQA 2C8EE 2WN7A 5D1TA 4GF1A
chains in the Genus database with same CATH superfamily
2J3XA 2J3ZA 5D1SA 1GIRA 5H04A 2C8GA 4FK7A 4PKRA 1G24A 1PWUA 1QS2A 4H0VA 4ELNA 4PKWA 1PWVA 1J7NA 1QS1A 1OJZA 4DV8A 1YQYA 1GY0A 1UZIA 1R45A 1OG1A 4FMLA 5D1UA 1GXZA 2C89A 2WN6A 2WN4A 2GWLA 4H03A 4H0TA 4TR5A 4PKVA 2WN8A 3NTSA 3U0JA 4WF6A 1GZEA 2A9KB 2C8BX 1ZXVA 3BW8A 1JKYA 2C8HA 4PKQA 5GTTA 1OG3A 4XSGB 1PWPA 1OG4A 5BWMB 4H0XA 2BOVB 4XM6A 4GY2A 4PKSA 3BUZA 1R4BA 2C8CA 2C8AA 4PKTA 4PKUA 2C8DA 5DZQA 4XM7A 1GZFA 2C8FE 4XM8A 5H03A 1GXYA 1PWWA 4XSHB 4FXQA 2A78B 2WN5A 4H0YA 1GIQA 2J3VA 1PWQA 2GWMA 1OJQA 2C8EE 2WN7A 5D1TA 4GF1A
chains in the Genus database with same CATH topology
2J3XA 2J3ZA 5D1SA 1GIRA 5H04A 2C8GA 4FK7A 4PKRA 1G24A 1PWUA 1QS2A 4H0VA 4ELNA 4PKWA 1PWVA 1J7NA 1QS1A 1OJZA 4DV8A 1YQYA 1GY0A 1UZIA 1R45A 1OG1A 4FMLA 5D1UA 1GXZA 2C89A 2WN6A 2WN4A 2GWLA 4H03A 4H0TA 4TR5A 4PKVA 2WN8A 3NTSA 3U0JA 4WF6A 1GZEA 2A9KB 2C8BX 1ZXVA 3BW8A 1JKYA 2C8HA 4PKQA 5GTTA 1OG3A 4XSGB 1PWPA 1OG4A 5BWMB 4H0XA 2BOVB 4XM6A 4GY2A 4PKSA 3BUZA 1R4BA 2C8CA 2C8AA 4PKTA 4PKUA 2C8DA 5DZQA 4XM7A 1GZFA 2C8FE 4XM8A 5H03A 1GXYA 1PWWA 4XSHB 4FXQA 2A78B 2WN5A 4H0YA 1GIQA 2J3VA 1PWQA 2GWMA 1OJQA 2C8EE 2WN7A 5D1TA 4GF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3X A;  2J3Z A;  5D1S A;  1GIR A;  5H04 A;  2C8G A;  4FK7 A;  4PKR A;  1G24 A;  1PWU A;  1QS2 A;  4H0V A;  4ELN A;  4PKW A;  1PWV A;  1J7N A;  1QS1 A;  1OJZ A;  4DV8 A;  1YQY A;  1GY0 A;  1UZI A;  1R45 A;  1OG1 A;  4FML A;  5D1U A;  1GXZ A;  2C89 A;  2WN6 A;  2WN4 A;  2GWL A;  4H03 A;  4H0T A;  4TR5 A;  4PKV A;  2WN8 A;  3NTS A;  3U0J A;  4WF6 A;  1GZE A;  2A9K B;  2C8B X;  1ZXV A;  3BW8 A;  1JKY A;  2C8H A;  4PKQ A;  5GTT A;  1OG3 A;  4XSG B;  1PWP A;  1OG4 A;  5BWM B;  4H0X A;  2BOV B;  4XM6 A;  4GY2 A;  4PKS A;  3BUZ A;  1R4B A;  2C8C A;  2C8A A;  4PKT A;  4PKU A;  2C8D A;  5DZQ A;  4XM7 A;  1GZF A;  2C8F E;  4XM8 A;  5H03 A;  1GXY A;  1PWW A;  4XSH B;  4FXQ A;  2A78 B;  2WN5 A;  4H0Y A;  1GIQ A;  2J3V A;  1PWQ A;  2GWM A;  1OJQ A;  2C8E E;  2WN7 A;  5D1T A;  4GF1 A; 
#chains in the Genus database with same CATH topology
 2J3X A;  2J3Z A;  5D1S A;  1GIR A;  5H04 A;  2C8G A;  4FK7 A;  4PKR A;  1G24 A;  1PWU A;  1QS2 A;  4H0V A;  4ELN A;  4PKW A;  1PWV A;  1J7N A;  1QS1 A;  1OJZ A;  4DV8 A;  1YQY A;  1GY0 A;  1UZI A;  1R45 A;  1OG1 A;  4FML A;  5D1U A;  1GXZ A;  2C89 A;  2WN6 A;  2WN4 A;  2GWL A;  4H03 A;  4H0T A;  4TR5 A;  4PKV A;  2WN8 A;  3NTS A;  3U0J A;  4WF6 A;  1GZE A;  2A9K B;  2C8B X;  1ZXV A;  3BW8 A;  1JKY A;  2C8H A;  4PKQ A;  5GTT A;  1OG3 A;  4XSG B;  1PWP A;  1OG4 A;  5BWM B;  4H0X A;  2BOV B;  4XM6 A;  4GY2 A;  4PKS A;  3BUZ A;  1R4B A;  2C8C A;  2C8A A;  4PKT A;  4PKU A;  2C8D A;  5DZQ A;  4XM7 A;  1GZF A;  2C8F E;  4XM8 A;  5H03 A;  1GXY A;  1PWW A;  4XSH B;  4FXQ A;  2A78 B;  2WN5 A;  4H0Y A;  1GIQ A;  2J3V A;  1PWQ A;  2GWM A;  1OJQ A;  2C8E E;  2WN7 A;  5D1T A;  4GF1 A; 
#chains in the Genus database with same CATH homology
 2J3X A;  2J3Z A;  5D1S A;  1GIR A;  5H04 A;  2C8G A;  4FK7 A;  4PKR A;  1G24 A;  1PWU A;  1QS2 A;  4H0V A;  4ELN A;  4PKW A;  1PWV A;  1J7N A;  1QS1 A;  1OJZ A;  4DV8 A;  1YQY A;  1GY0 A;  1UZI A;  1R45 A;  1OG1 A;  4FML A;  5D1U A;  1GXZ A;  2C89 A;  2WN6 A;  2WN4 A;  2GWL A;  4H03 A;  4H0T A;  4TR5 A;  4PKV A;  2WN8 A;  3NTS A;  3U0J A;  4WF6 A;  1GZE A;  2A9K B;  2C8B X;  1ZXV A;  3BW8 A;  1JKY A;  2C8H A;  4PKQ A;  5GTT A;  1OG3 A;  4XSG B;  1PWP A;  1OG4 A;  5BWM B;  4H0X A;  2BOV B;  4XM6 A;  4GY2 A;  4PKS A;  3BUZ A;  1R4B A;  2C8C A;  2C8A A;  4PKT A;  4PKU A;  2C8D A;  5DZQ A;  4XM7 A;  1GZF A;  2C8F E;  4XM8 A;  5H03 A;  1GXY A;  1PWW A;  4XSH B;  4FXQ A;  2A78 B;  2WN5 A;  4H0Y A;  1GIQ A;  2J3V A;  1PWQ A;  2GWM A;  1OJQ A;  2C8E E;  2WN7 A;  5D1T A;  4GF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...