2C8EE

Structure of the artt motif e214n mutant c3bot1 exoenzyme (free state, crystal form iii)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLNMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 71
structure length 200
sequence length 200
chains with identical sequence F, G
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8eE00
2C8GA 2GWLA 2BOVB 4GY2A 4H03A 1PWUA 1OG1A 1OJQA 1GZFA 1OG3A 1ZXVA 1PWWA 1GIRA 4TR5A 1GXZA 2GWMA 1R4BA 2C8AA 3U0JA 5H04A 2A9KB 2A78B 4PKTA 2C8DA 2C8HA 3BW8A 2J3ZA 5D1UA 5D1SA 2WN7A 1GY0A 2J3XA 1PWPA 4FXQA 5D1TA 1QS1A 1GZEA 4PKRA 5H03A 4ELNA 4PKUA 4H0YA 4WF6A 4PKQA 4GF1A 2WN4A 4H0VA 1J7NA 4XM8A 1PWVA 2WN6A 4DV8A 2C8CA 2C8FE 2WN8A 4XSHB 1R45A 3BUZA 1OG4A 5BWMB 1GIQA 4PKVA 5GTTA 4XM7A 1G24A 4H0XA 2WN5A 1UZIA 4FMLA 4FK7A 2C8EE 2C8BX 1QS2A 3NTSA 4H0TA 2J3VA 4XSGB 1PWQA 4PKSA 4PKWA 2C89A 1GXYA 1OJZA 4XM6A 1YQYA 1JKYA 5DZQA
chains in the Genus database with same CATH superfamily
2C8GA 2GWLA 2BOVB 4GY2A 4H03A 1PWUA 1OG1A 1OJQA 1GZFA 1OG3A 1ZXVA 1PWWA 1GIRA 4TR5A 1GXZA 2GWMA 1R4BA 2C8AA 3U0JA 5H04A 2A9KB 2A78B 4PKTA 2C8DA 2C8HA 3BW8A 2J3ZA 5D1UA 5D1SA 2WN7A 1GY0A 2J3XA 1PWPA 4FXQA 5D1TA 1QS1A 1GZEA 4PKRA 5H03A 4ELNA 4PKUA 4H0YA 4WF6A 4PKQA 4GF1A 2WN4A 4H0VA 1J7NA 4XM8A 1PWVA 2WN6A 4DV8A 2C8CA 2C8FE 2WN8A 4XSHB 1R45A 3BUZA 1OG4A 5BWMB 1GIQA 4PKVA 5GTTA 4XM7A 1G24A 4H0XA 2WN5A 1UZIA 4FMLA 4FK7A 2C8EE 2C8BX 1QS2A 3NTSA 4H0TA 2J3VA 4XSGB 1PWQA 4PKSA 4PKWA 2C89A 1GXYA 1OJZA 4XM6A 1YQYA 1JKYA 5DZQA
chains in the Genus database with same CATH topology
2C8GA 2GWLA 2BOVB 4GY2A 4H03A 1PWUA 1OG1A 1OJQA 1GZFA 1OG3A 1ZXVA 1PWWA 1GIRA 4TR5A 1GXZA 2GWMA 1R4BA 2C8AA 3U0JA 5H04A 2A9KB 2A78B 4PKTA 2C8DA 2C8HA 3BW8A 2J3ZA 5D1UA 5D1SA 2WN7A 1GY0A 2J3XA 1PWPA 4FXQA 5D1TA 1QS1A 1GZEA 4PKRA 5H03A 4ELNA 4PKUA 4H0YA 4WF6A 4PKQA 4GF1A 2WN4A 4H0VA 1J7NA 4XM8A 1PWVA 2WN6A 4DV8A 2C8CA 2C8FE 2WN8A 4XSHB 1R45A 3BUZA 1OG4A 5BWMB 1GIQA 4PKVA 5GTTA 4XM7A 1G24A 4H0XA 2WN5A 1UZIA 4FMLA 4FK7A 2C8EE 2C8BX 1QS2A 3NTSA 4H0TA 2J3VA 4XSGB 1PWQA 4PKSA 4PKWA 2C89A 1GXYA 1OJZA 4XM6A 1YQYA 1JKYA 5DZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8G A;  2GWL A;  2BOV B;  4GY2 A;  4H03 A;  1PWU A;  1OG1 A;  1OJQ A;  1GZF A;  1OG3 A;  1ZXV A;  1PWW A;  1GIR A;  4TR5 A;  1GXZ A;  2GWM A;  1R4B A;  2C8A A;  3U0J A;  5H04 A;  2A9K B;  2A78 B;  4PKT A;  2C8D A;  2C8H A;  3BW8 A;  2J3Z A;  5D1U A;  5D1S A;  2WN7 A;  1GY0 A;  2J3X A;  1PWP A;  4FXQ A;  5D1T A;  1QS1 A;  1GZE A;  4PKR A;  5H03 A;  4ELN A;  4PKU A;  4H0Y A;  4WF6 A;  4PKQ A;  4GF1 A;  2WN4 A;  4H0V A;  1J7N A;  4XM8 A;  1PWV A;  2WN6 A;  4DV8 A;  2C8C A;  2C8F E;  2WN8 A;  4XSH B;  1R45 A;  3BUZ A;  1OG4 A;  5BWM B;  1GIQ A;  4PKV A;  5GTT A;  4XM7 A;  1G24 A;  4H0X A;  2WN5 A;  1UZI A;  4FML A;  4FK7 A;  2C8E E;  2C8B X;  1QS2 A;  3NTS A;  4H0T A;  2J3V A;  4XSG B;  1PWQ A;  4PKS A;  4PKW A;  2C89 A;  1GXY A;  1OJZ A;  4XM6 A;  1YQY A;  1JKY A;  5DZQ A; 
#chains in the Genus database with same CATH topology
 2C8G A;  2GWL A;  2BOV B;  4GY2 A;  4H03 A;  1PWU A;  1OG1 A;  1OJQ A;  1GZF A;  1OG3 A;  1ZXV A;  1PWW A;  1GIR A;  4TR5 A;  1GXZ A;  2GWM A;  1R4B A;  2C8A A;  3U0J A;  5H04 A;  2A9K B;  2A78 B;  4PKT A;  2C8D A;  2C8H A;  3BW8 A;  2J3Z A;  5D1U A;  5D1S A;  2WN7 A;  1GY0 A;  2J3X A;  1PWP A;  4FXQ A;  5D1T A;  1QS1 A;  1GZE A;  4PKR A;  5H03 A;  4ELN A;  4PKU A;  4H0Y A;  4WF6 A;  4PKQ A;  4GF1 A;  2WN4 A;  4H0V A;  1J7N A;  4XM8 A;  1PWV A;  2WN6 A;  4DV8 A;  2C8C A;  2C8F E;  2WN8 A;  4XSH B;  1R45 A;  3BUZ A;  1OG4 A;  5BWM B;  1GIQ A;  4PKV A;  5GTT A;  4XM7 A;  1G24 A;  4H0X A;  2WN5 A;  1UZI A;  4FML A;  4FK7 A;  2C8E E;  2C8B X;  1QS2 A;  3NTS A;  4H0T A;  2J3V A;  4XSG B;  1PWQ A;  4PKS A;  4PKW A;  2C89 A;  1GXY A;  1OJZ A;  4XM6 A;  1YQY A;  1JKY A;  5DZQ A; 
#chains in the Genus database with same CATH homology
 2C8G A;  2GWL A;  2BOV B;  4GY2 A;  4H03 A;  1PWU A;  1OG1 A;  1OJQ A;  1GZF A;  1OG3 A;  1ZXV A;  1PWW A;  1GIR A;  4TR5 A;  1GXZ A;  2GWM A;  1R4B A;  2C8A A;  3U0J A;  5H04 A;  2A9K B;  2A78 B;  4PKT A;  2C8D A;  2C8H A;  3BW8 A;  2J3Z A;  5D1U A;  5D1S A;  2WN7 A;  1GY0 A;  2J3X A;  1PWP A;  4FXQ A;  5D1T A;  1QS1 A;  1GZE A;  4PKR A;  5H03 A;  4ELN A;  4PKU A;  4H0Y A;  4WF6 A;  4PKQ A;  4GF1 A;  2WN4 A;  4H0V A;  1J7N A;  4XM8 A;  1PWV A;  2WN6 A;  4DV8 A;  2C8C A;  2C8F E;  2WN8 A;  4XSH B;  1R45 A;  3BUZ A;  1OG4 A;  5BWM B;  1GIQ A;  4PKV A;  5GTT A;  4XM7 A;  1G24 A;  4H0X A;  2WN5 A;  1UZI A;  4FML A;  4FK7 A;  2C8E E;  2C8B X;  1QS2 A;  3NTS A;  4H0T A;  2J3V A;  4XSG B;  1PWQ A;  4PKS A;  4PKW A;  2C89 A;  1GXY A;  1OJZ A;  4XM6 A;  1YQY A;  1JKY A;  5DZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...