2C8EE

Structure of the artt motif e214n mutant c3bot1 exoenzyme (free state, crystal form iii)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLNMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 71
structure length 200
sequence length 200
chains with identical sequence F, G
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8eE00
2GWLA 4H0XA 2WN5A 4PKWA 4PKSA 1G24A 2C8HA 2WN8A 2C89A 4XSHB 4H03A 1QS2A 2WN6A 2BOVB 1J7NA 1OJQA 1OG3A 1PWQA 2C8FE 4XM8A 1GY0A 4WF6A 5D1TA 1R4BA 3U0JA 5GTTA 1GXZA 4FK7A 1GIRA 4XM7A 1GIQA 2C8DA 4PKQA 2J3XA 5H04A 2C8GA 1PWVA 1PWPA 1GZFA 4FMLA 4ELNA 2C8AA 1GZEA 2WN7A 1PWUA 4H0YA 4XSGB 4GY2A 1R45A 4GF1A 2J3VA 2A9KB 1JKYA 1PWWA 1OG4A 5D1SA 4XM6A 3BUZA 4PKVA 1QS1A 4FXQA 4PKRA 2C8BX 2A78B 2J3ZA 1OJZA 1ZXVA 2GWMA 2WN4A 5H03A 4PKTA 1YQYA 4H0VA 4PKUA 5BWMB 4H0TA 5D1UA 1OG1A 4TR5A 1GXYA 3BW8A 3NTSA 1UZIA 2C8EE 5DZQA 2C8CA 4DV8A
chains in the Genus database with same CATH superfamily
2GWLA 4H0XA 2WN5A 4PKWA 4PKSA 1G24A 2C8HA 2WN8A 2C89A 4XSHB 4H03A 1QS2A 2WN6A 2BOVB 1J7NA 1OJQA 1OG3A 1PWQA 2C8FE 4XM8A 1GY0A 4WF6A 5D1TA 1R4BA 3U0JA 5GTTA 1GXZA 4FK7A 1GIRA 4XM7A 1GIQA 2C8DA 4PKQA 2J3XA 5H04A 2C8GA 1PWVA 1PWPA 1GZFA 4FMLA 4ELNA 2C8AA 1GZEA 2WN7A 1PWUA 4H0YA 4XSGB 4GY2A 1R45A 4GF1A 2J3VA 2A9KB 1JKYA 1PWWA 1OG4A 5D1SA 4XM6A 3BUZA 4PKVA 1QS1A 4FXQA 4PKRA 2C8BX 2A78B 2J3ZA 1OJZA 1ZXVA 2GWMA 2WN4A 5H03A 4PKTA 1YQYA 4H0VA 4PKUA 5BWMB 4H0TA 5D1UA 1OG1A 4TR5A 1GXYA 3BW8A 3NTSA 1UZIA 2C8EE 5DZQA 2C8CA 4DV8A
chains in the Genus database with same CATH topology
2GWLA 4H0XA 2WN5A 4PKWA 4PKSA 1G24A 2C8HA 2WN8A 2C89A 4XSHB 4H03A 1QS2A 2WN6A 2BOVB 1J7NA 1OJQA 1OG3A 1PWQA 2C8FE 4XM8A 1GY0A 4WF6A 5D1TA 1R4BA 3U0JA 5GTTA 1GXZA 4FK7A 1GIRA 4XM7A 1GIQA 2C8DA 4PKQA 2J3XA 5H04A 2C8GA 1PWVA 1PWPA 1GZFA 4FMLA 4ELNA 2C8AA 1GZEA 2WN7A 1PWUA 4H0YA 4XSGB 4GY2A 1R45A 4GF1A 2J3VA 2A9KB 1JKYA 1PWWA 1OG4A 5D1SA 4XM6A 3BUZA 4PKVA 1QS1A 4FXQA 4PKRA 2C8BX 2A78B 2J3ZA 1OJZA 1ZXVA 2GWMA 2WN4A 5H03A 4PKTA 1YQYA 4H0VA 4PKUA 5BWMB 4H0TA 5D1UA 1OG1A 4TR5A 1GXYA 3BW8A 3NTSA 1UZIA 2C8EE 5DZQA 2C8CA 4DV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWL A;  4H0X A;  2WN5 A;  4PKW A;  4PKS A;  1G24 A;  2C8H A;  2WN8 A;  2C89 A;  4XSH B;  4H03 A;  1QS2 A;  2WN6 A;  2BOV B;  1J7N A;  1OJQ A;  1OG3 A;  1PWQ A;  2C8F E;  4XM8 A;  1GY0 A;  4WF6 A;  5D1T A;  1R4B A;  3U0J A;  5GTT A;  1GXZ A;  4FK7 A;  1GIR A;  4XM7 A;  1GIQ A;  2C8D A;  4PKQ A;  2J3X A;  5H04 A;  2C8G A;  1PWV A;  1PWP A;  1GZF A;  4FML A;  4ELN A;  2C8A A;  1GZE A;  2WN7 A;  1PWU A;  4H0Y A;  4XSG B;  4GY2 A;  1R45 A;  4GF1 A;  2J3V A;  2A9K B;  1JKY A;  1PWW A;  1OG4 A;  5D1S A;  4XM6 A;  3BUZ A;  4PKV A;  1QS1 A;  4FXQ A;  4PKR A;  2C8B X;  2A78 B;  2J3Z A;  1OJZ A;  1ZXV A;  2GWM A;  2WN4 A;  5H03 A;  4PKT A;  1YQY A;  4H0V A;  4PKU A;  5BWM B;  4H0T A;  5D1U A;  1OG1 A;  4TR5 A;  1GXY A;  3BW8 A;  3NTS A;  1UZI A;  2C8E E;  5DZQ A;  2C8C A;  4DV8 A; 
#chains in the Genus database with same CATH topology
 2GWL A;  4H0X A;  2WN5 A;  4PKW A;  4PKS A;  1G24 A;  2C8H A;  2WN8 A;  2C89 A;  4XSH B;  4H03 A;  1QS2 A;  2WN6 A;  2BOV B;  1J7N A;  1OJQ A;  1OG3 A;  1PWQ A;  2C8F E;  4XM8 A;  1GY0 A;  4WF6 A;  5D1T A;  1R4B A;  3U0J A;  5GTT A;  1GXZ A;  4FK7 A;  1GIR A;  4XM7 A;  1GIQ A;  2C8D A;  4PKQ A;  2J3X A;  5H04 A;  2C8G A;  1PWV A;  1PWP A;  1GZF A;  4FML A;  4ELN A;  2C8A A;  1GZE A;  2WN7 A;  1PWU A;  4H0Y A;  4XSG B;  4GY2 A;  1R45 A;  4GF1 A;  2J3V A;  2A9K B;  1JKY A;  1PWW A;  1OG4 A;  5D1S A;  4XM6 A;  3BUZ A;  4PKV A;  1QS1 A;  4FXQ A;  4PKR A;  2C8B X;  2A78 B;  2J3Z A;  1OJZ A;  1ZXV A;  2GWM A;  2WN4 A;  5H03 A;  4PKT A;  1YQY A;  4H0V A;  4PKU A;  5BWM B;  4H0T A;  5D1U A;  1OG1 A;  4TR5 A;  1GXY A;  3BW8 A;  3NTS A;  1UZI A;  2C8E E;  5DZQ A;  2C8C A;  4DV8 A; 
#chains in the Genus database with same CATH homology
 2GWL A;  4H0X A;  2WN5 A;  4PKW A;  4PKS A;  1G24 A;  2C8H A;  2WN8 A;  2C89 A;  4XSH B;  4H03 A;  1QS2 A;  2WN6 A;  2BOV B;  1J7N A;  1OJQ A;  1OG3 A;  1PWQ A;  2C8F E;  4XM8 A;  1GY0 A;  4WF6 A;  5D1T A;  1R4B A;  3U0J A;  5GTT A;  1GXZ A;  4FK7 A;  1GIR A;  4XM7 A;  1GIQ A;  2C8D A;  4PKQ A;  2J3X A;  5H04 A;  2C8G A;  1PWV A;  1PWP A;  1GZF A;  4FML A;  4ELN A;  2C8A A;  1GZE A;  2WN7 A;  1PWU A;  4H0Y A;  4XSG B;  4GY2 A;  1R45 A;  4GF1 A;  2J3V A;  2A9K B;  1JKY A;  1PWW A;  1OG4 A;  5D1S A;  4XM6 A;  3BUZ A;  4PKV A;  1QS1 A;  4FXQ A;  4PKR A;  2C8B X;  2A78 B;  2J3Z A;  1OJZ A;  1ZXV A;  2GWM A;  2WN4 A;  5H03 A;  4PKT A;  1YQY A;  4H0V A;  4PKU A;  5BWM B;  4H0T A;  5D1U A;  1OG1 A;  4TR5 A;  1GXY A;  3BW8 A;  3NTS A;  1UZI A;  2C8E E;  5DZQ A;  2C8C A;  4DV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...