2C8EE

Structure of the artt motif e214n mutant c3bot1 exoenzyme (free state, crystal form iii)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLNMLLPRHSTYHIDDMRLSSDGKQIIITATMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 71
structure length 200
sequence length 200
chains with identical sequence F, G
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8eE00
4PKSA 2WN7A 1OG3A 4PKVA 2WN6A 4ELNA 2C8BX 4H03A 4XM8A 4H0XA 1ZXVA 2C8EE 1PWUA 1G24A 1R4BA 1YQYA 1UZIA 1QS2A 5H03A 4DV8A 2A78B 2C89A 4H0YA 4XSHB 4PKUA 3NTSA 5BWMB 1JKYA 4GY2A 1GXZA 2J3XA 5GTTA 4FMLA 4H0TA 4TR5A 5D1TA 4XM7A 4PKWA 3BW8A 1GXYA 1PWWA 4XM6A 4WF6A 3U0JA 1GIQA 1GIRA 5D1UA 1PWPA 1OJQA 3BUZA 1GY0A 2GWLA 2WN8A 2C8DA 2J3ZA 5H04A 1GZFA 1J7NA 4PKTA 2C8FE 1PWQA 4XSGB 2GWMA 2C8GA 4GF1A 1GZEA 2WN4A 1R45A 2A9KB 2C8AA 1QS1A 2J3VA 5DZQA 4FXQA 5D1SA 1OG1A 1OG4A 2C8HA 4H0VA 4PKQA 2WN5A 2C8CA 2BOVB 1PWVA 4PKRA 4FK7A 1OJZA
chains in the Genus database with same CATH superfamily
4PKSA 2WN7A 1OG3A 4PKVA 2WN6A 4ELNA 2C8BX 4H03A 4XM8A 4H0XA 1ZXVA 2C8EE 1PWUA 1G24A 1R4BA 1YQYA 1UZIA 1QS2A 5H03A 4DV8A 2A78B 2C89A 4H0YA 4XSHB 4PKUA 3NTSA 5BWMB 1JKYA 4GY2A 1GXZA 2J3XA 5GTTA 4FMLA 4H0TA 4TR5A 5D1TA 4XM7A 4PKWA 3BW8A 1GXYA 1PWWA 4XM6A 4WF6A 3U0JA 1GIQA 1GIRA 5D1UA 1PWPA 1OJQA 3BUZA 1GY0A 2GWLA 2WN8A 2C8DA 2J3ZA 5H04A 1GZFA 1J7NA 4PKTA 2C8FE 1PWQA 4XSGB 2GWMA 2C8GA 4GF1A 1GZEA 2WN4A 1R45A 2A9KB 2C8AA 1QS1A 2J3VA 5DZQA 4FXQA 5D1SA 1OG1A 1OG4A 2C8HA 4H0VA 4PKQA 2WN5A 2C8CA 2BOVB 1PWVA 4PKRA 4FK7A 1OJZA
chains in the Genus database with same CATH topology
4PKSA 2WN7A 1OG3A 4PKVA 2WN6A 4ELNA 2C8BX 4H03A 4XM8A 4H0XA 1ZXVA 2C8EE 1PWUA 1G24A 1R4BA 1YQYA 1UZIA 1QS2A 5H03A 4DV8A 2A78B 2C89A 4H0YA 4XSHB 4PKUA 3NTSA 5BWMB 1JKYA 4GY2A 1GXZA 2J3XA 5GTTA 4FMLA 4H0TA 4TR5A 5D1TA 4XM7A 4PKWA 3BW8A 1GXYA 1PWWA 4XM6A 4WF6A 3U0JA 1GIQA 1GIRA 5D1UA 1PWPA 1OJQA 3BUZA 1GY0A 2GWLA 2WN8A 2C8DA 2J3ZA 5H04A 1GZFA 1J7NA 4PKTA 2C8FE 1PWQA 4XSGB 2GWMA 2C8GA 4GF1A 1GZEA 2WN4A 1R45A 2A9KB 2C8AA 1QS1A 2J3VA 5DZQA 4FXQA 5D1SA 1OG1A 1OG4A 2C8HA 4H0VA 4PKQA 2WN5A 2C8CA 2BOVB 1PWVA 4PKRA 4FK7A 1OJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKS A;  2WN7 A;  1OG3 A;  4PKV A;  2WN6 A;  4ELN A;  2C8B X;  4H03 A;  4XM8 A;  4H0X A;  1ZXV A;  2C8E E;  1PWU A;  1G24 A;  1R4B A;  1YQY A;  1UZI A;  1QS2 A;  5H03 A;  4DV8 A;  2A78 B;  2C89 A;  4H0Y A;  4XSH B;  4PKU A;  3NTS A;  5BWM B;  1JKY A;  4GY2 A;  1GXZ A;  2J3X A;  5GTT A;  4FML A;  4H0T A;  4TR5 A;  5D1T A;  4XM7 A;  4PKW A;  3BW8 A;  1GXY A;  1PWW A;  4XM6 A;  4WF6 A;  3U0J A;  1GIQ A;  1GIR A;  5D1U A;  1PWP A;  1OJQ A;  3BUZ A;  1GY0 A;  2GWL A;  2WN8 A;  2C8D A;  2J3Z A;  5H04 A;  1GZF A;  1J7N A;  4PKT A;  2C8F E;  1PWQ A;  4XSG B;  2GWM A;  2C8G A;  4GF1 A;  1GZE A;  2WN4 A;  1R45 A;  2A9K B;  2C8A A;  1QS1 A;  2J3V A;  5DZQ A;  4FXQ A;  5D1S A;  1OG1 A;  1OG4 A;  2C8H A;  4H0V A;  4PKQ A;  2WN5 A;  2C8C A;  2BOV B;  1PWV A;  4PKR A;  4FK7 A;  1OJZ A; 
#chains in the Genus database with same CATH topology
 4PKS A;  2WN7 A;  1OG3 A;  4PKV A;  2WN6 A;  4ELN A;  2C8B X;  4H03 A;  4XM8 A;  4H0X A;  1ZXV A;  2C8E E;  1PWU A;  1G24 A;  1R4B A;  1YQY A;  1UZI A;  1QS2 A;  5H03 A;  4DV8 A;  2A78 B;  2C89 A;  4H0Y A;  4XSH B;  4PKU A;  3NTS A;  5BWM B;  1JKY A;  4GY2 A;  1GXZ A;  2J3X A;  5GTT A;  4FML A;  4H0T A;  4TR5 A;  5D1T A;  4XM7 A;  4PKW A;  3BW8 A;  1GXY A;  1PWW A;  4XM6 A;  4WF6 A;  3U0J A;  1GIQ A;  1GIR A;  5D1U A;  1PWP A;  1OJQ A;  3BUZ A;  1GY0 A;  2GWL A;  2WN8 A;  2C8D A;  2J3Z A;  5H04 A;  1GZF A;  1J7N A;  4PKT A;  2C8F E;  1PWQ A;  4XSG B;  2GWM A;  2C8G A;  4GF1 A;  1GZE A;  2WN4 A;  1R45 A;  2A9K B;  2C8A A;  1QS1 A;  2J3V A;  5DZQ A;  4FXQ A;  5D1S A;  1OG1 A;  1OG4 A;  2C8H A;  4H0V A;  4PKQ A;  2WN5 A;  2C8C A;  2BOV B;  1PWV A;  4PKR A;  4FK7 A;  1OJZ A; 
#chains in the Genus database with same CATH homology
 4PKS A;  2WN7 A;  1OG3 A;  4PKV A;  2WN6 A;  4ELN A;  2C8B X;  4H03 A;  4XM8 A;  4H0X A;  1ZXV A;  2C8E E;  1PWU A;  1G24 A;  1R4B A;  1YQY A;  1UZI A;  1QS2 A;  5H03 A;  4DV8 A;  2A78 B;  2C89 A;  4H0Y A;  4XSH B;  4PKU A;  3NTS A;  5BWM B;  1JKY A;  4GY2 A;  1GXZ A;  2J3X A;  5GTT A;  4FML A;  4H0T A;  4TR5 A;  5D1T A;  4XM7 A;  4PKW A;  3BW8 A;  1GXY A;  1PWW A;  4XM6 A;  4WF6 A;  3U0J A;  1GIQ A;  1GIR A;  5D1U A;  1PWP A;  1OJQ A;  3BUZ A;  1GY0 A;  2GWL A;  2WN8 A;  2C8D A;  2J3Z A;  5H04 A;  1GZF A;  1J7N A;  4PKT A;  2C8F E;  1PWQ A;  4XSG B;  2GWM A;  2C8G A;  4GF1 A;  1GZE A;  2WN4 A;  1R45 A;  2A9K B;  2C8A A;  1QS1 A;  2J3V A;  5DZQ A;  4FXQ A;  5D1S A;  1OG1 A;  1OG4 A;  2C8H A;  4H0V A;  4PKQ A;  2WN5 A;  2C8C A;  2BOV B;  1PWV A;  4PKR A;  4FK7 A;  1OJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...