1OG1A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 in complex with tad
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og1A00
4TR5A 2C8BX 1G24A 3NTSA 2J3ZA 1PWPA 1OJQA 2WN4A 4XSGB 1GXZA 2C8CA 1R4BA 4PKUA 1GY0A 1OG4A 4PKRA 1GIRA 4ELNA 3BUZA 2WN6A 1PWVA 2GWMA 4H0TA 2A78B 2J3XA 2C89A 4XM7A 4PKSA 2C8FE 1PWQA 1PWUA 4GF1A 4H03A 1OG1A 2C8AA 1GZFA 1OJZA 4PKTA 2WN8A 4FXQA 1QS2A 1PWWA 5GTTA 4WF6A 5D1UA 4PKWA 5BWMB 4H0YA 2A9KB 4DV8A 4H0XA 2C8GA 1ZXVA 3U0JA 2WN7A 4FMLA 1OG3A 4XM6A 2WN5A 1R45A 5DZQA 1GXYA 3BW8A 2C8DA 5H03A 1QS1A 2C8EE 4PKVA 1J7NA 4PKQA 4H0VA 1YQYA 1UZIA 4XM8A 2J3VA 4GY2A 4XSHB 2BOVB 1JKYA 4FK7A 2C8HA 5D1TA 5H04A 5D1SA 1GZEA 1GIQA 2GWLA
chains in the Genus database with same CATH superfamily
4TR5A 2C8BX 1G24A 3NTSA 2J3ZA 1PWPA 1OJQA 2WN4A 4XSGB 1GXZA 2C8CA 1R4BA 4PKUA 1GY0A 1OG4A 4PKRA 1GIRA 4ELNA 3BUZA 2WN6A 1PWVA 2GWMA 4H0TA 2A78B 2J3XA 2C89A 4XM7A 4PKSA 2C8FE 1PWQA 1PWUA 4GF1A 4H03A 1OG1A 2C8AA 1GZFA 1OJZA 4PKTA 2WN8A 4FXQA 1QS2A 1PWWA 5GTTA 4WF6A 5D1UA 4PKWA 5BWMB 4H0YA 2A9KB 4DV8A 4H0XA 2C8GA 1ZXVA 3U0JA 2WN7A 4FMLA 1OG3A 4XM6A 2WN5A 1R45A 5DZQA 1GXYA 3BW8A 2C8DA 5H03A 1QS1A 2C8EE 4PKVA 1J7NA 4PKQA 4H0VA 1YQYA 1UZIA 4XM8A 2J3VA 4GY2A 4XSHB 2BOVB 1JKYA 4FK7A 2C8HA 5D1TA 5H04A 5D1SA 1GZEA 1GIQA 2GWLA
chains in the Genus database with same CATH topology
4TR5A 2C8BX 1G24A 3NTSA 2J3ZA 1PWPA 1OJQA 2WN4A 4XSGB 1GXZA 2C8CA 1R4BA 4PKUA 1GY0A 1OG4A 4PKRA 1GIRA 4ELNA 3BUZA 2WN6A 1PWVA 2GWMA 4H0TA 2A78B 2J3XA 2C89A 4XM7A 4PKSA 2C8FE 1PWQA 1PWUA 4GF1A 4H03A 1OG1A 2C8AA 1GZFA 1OJZA 4PKTA 2WN8A 4FXQA 1QS2A 1PWWA 5GTTA 4WF6A 5D1UA 4PKWA 5BWMB 4H0YA 2A9KB 4DV8A 4H0XA 2C8GA 1ZXVA 3U0JA 2WN7A 4FMLA 1OG3A 4XM6A 2WN5A 1R45A 5DZQA 1GXYA 3BW8A 2C8DA 5H03A 1QS1A 2C8EE 4PKVA 1J7NA 4PKQA 4H0VA 1YQYA 1UZIA 4XM8A 2J3VA 4GY2A 4XSHB 2BOVB 1JKYA 4FK7A 2C8HA 5D1TA 5H04A 5D1SA 1GZEA 1GIQA 2GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TR5 A;  2C8B X;  1G24 A;  3NTS A;  2J3Z A;  1PWP A;  1OJQ A;  2WN4 A;  4XSG B;  1GXZ A;  2C8C A;  1R4B A;  4PKU A;  1GY0 A;  1OG4 A;  4PKR A;  1GIR A;  4ELN A;  3BUZ A;  2WN6 A;  1PWV A;  2GWM A;  4H0T A;  2A78 B;  2J3X A;  2C89 A;  4XM7 A;  4PKS A;  2C8F E;  1PWQ A;  1PWU A;  4GF1 A;  4H03 A;  1OG1 A;  2C8A A;  1GZF A;  1OJZ A;  4PKT A;  2WN8 A;  4FXQ A;  1QS2 A;  1PWW A;  5GTT A;  4WF6 A;  5D1U A;  4PKW A;  5BWM B;  4H0Y A;  2A9K B;  4DV8 A;  4H0X A;  2C8G A;  1ZXV A;  3U0J A;  2WN7 A;  4FML A;  1OG3 A;  4XM6 A;  2WN5 A;  1R45 A;  5DZQ A;  1GXY A;  3BW8 A;  2C8D A;  5H03 A;  1QS1 A;  2C8E E;  4PKV A;  1J7N A;  4PKQ A;  4H0V A;  1YQY A;  1UZI A;  4XM8 A;  2J3V A;  4GY2 A;  4XSH B;  2BOV B;  1JKY A;  4FK7 A;  2C8H A;  5D1T A;  5H04 A;  5D1S A;  1GZE A;  1GIQ A;  2GWL A; 
#chains in the Genus database with same CATH topology
 4TR5 A;  2C8B X;  1G24 A;  3NTS A;  2J3Z A;  1PWP A;  1OJQ A;  2WN4 A;  4XSG B;  1GXZ A;  2C8C A;  1R4B A;  4PKU A;  1GY0 A;  1OG4 A;  4PKR A;  1GIR A;  4ELN A;  3BUZ A;  2WN6 A;  1PWV A;  2GWM A;  4H0T A;  2A78 B;  2J3X A;  2C89 A;  4XM7 A;  4PKS A;  2C8F E;  1PWQ A;  1PWU A;  4GF1 A;  4H03 A;  1OG1 A;  2C8A A;  1GZF A;  1OJZ A;  4PKT A;  2WN8 A;  4FXQ A;  1QS2 A;  1PWW A;  5GTT A;  4WF6 A;  5D1U A;  4PKW A;  5BWM B;  4H0Y A;  2A9K B;  4DV8 A;  4H0X A;  2C8G A;  1ZXV A;  3U0J A;  2WN7 A;  4FML A;  1OG3 A;  4XM6 A;  2WN5 A;  1R45 A;  5DZQ A;  1GXY A;  3BW8 A;  2C8D A;  5H03 A;  1QS1 A;  2C8E E;  4PKV A;  1J7N A;  4PKQ A;  4H0V A;  1YQY A;  1UZI A;  4XM8 A;  2J3V A;  4GY2 A;  4XSH B;  2BOV B;  1JKY A;  4FK7 A;  2C8H A;  5D1T A;  5H04 A;  5D1S A;  1GZE A;  1GIQ A;  2GWL A; 
#chains in the Genus database with same CATH homology
 4TR5 A;  2C8B X;  1G24 A;  3NTS A;  2J3Z A;  1PWP A;  1OJQ A;  2WN4 A;  4XSG B;  1GXZ A;  2C8C A;  1R4B A;  4PKU A;  1GY0 A;  1OG4 A;  4PKR A;  1GIR A;  4ELN A;  3BUZ A;  2WN6 A;  1PWV A;  2GWM A;  4H0T A;  2A78 B;  2J3X A;  2C89 A;  4XM7 A;  4PKS A;  2C8F E;  1PWQ A;  1PWU A;  4GF1 A;  4H03 A;  1OG1 A;  2C8A A;  1GZF A;  1OJZ A;  4PKT A;  2WN8 A;  4FXQ A;  1QS2 A;  1PWW A;  5GTT A;  4WF6 A;  5D1U A;  4PKW A;  5BWM B;  4H0Y A;  2A9K B;  4DV8 A;  4H0X A;  2C8G A;  1ZXV A;  3U0J A;  2WN7 A;  4FML A;  1OG3 A;  4XM6 A;  2WN5 A;  1R45 A;  5DZQ A;  1GXY A;  3BW8 A;  2C8D A;  5H03 A;  1QS1 A;  2C8E E;  4PKV A;  1J7N A;  4PKQ A;  4H0V A;  1YQY A;  1UZI A;  4XM8 A;  2J3V A;  4GY2 A;  4XSH B;  2BOV B;  1JKY A;  4FK7 A;  2C8H A;  5D1T A;  5H04 A;  5D1S A;  1GZE A;  1GIQ A;  2GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...