1OG1A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 in complex with tad
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Substrate Binding and Catalysis of Ecto-Adp-Ribosyltransferase 2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1og1A00
1GIQA 5D1SA 1PWUA 2J3XA 1OG4A 1JKYA 2C8FE 4GY2A 2GWLA 1R4BA 1PWQA 2C8BX 1QS1A 4DV8A 1ZXVA 4FK7A 4H0TA 5GTTA 4PKUA 3BUZA 4WF6A 5H03A 1R45A 5D1UA 2WN4A 4XSGB 4FMLA 1UZIA 4TR5A 1PWPA 2C8AA 2A9KB 1YQYA 1PWVA 1OJQA 2C89A 5DZQA 4PKWA 4PKQA 1J7NA 1OG1A 2GWMA 2C8CA 4H03A 3BW8A 4H0VA 2J3VA 2J3ZA 2WN5A 4PKVA 1G24A 1OJZA 4PKTA 4H0XA 2WN7A 2C8EE 4PKSA 1QS2A 1GZFA 5BWMB 1GXYA 2C8GA 2C8HA 2A78B 3NTSA 2BOVB 1GY0A 1OG3A 1GXZA 2WN6A 2C8DA 3U0JA 2WN8A 1GIRA 4FXQA 4ELNA 4XM7A 5D1TA 1PWWA 1GZEA 4XM8A 4GF1A 4XM6A 4XSHB 4H0YA 4PKRA 5H04A
chains in the Genus database with same CATH superfamily
1GIQA 5D1SA 1PWUA 2J3XA 1OG4A 1JKYA 2C8FE 4GY2A 2GWLA 1R4BA 1PWQA 2C8BX 1QS1A 4DV8A 1ZXVA 4FK7A 4H0TA 5GTTA 4PKUA 3BUZA 4WF6A 5H03A 1R45A 5D1UA 2WN4A 4XSGB 4FMLA 1UZIA 4TR5A 1PWPA 2C8AA 2A9KB 1YQYA 1PWVA 1OJQA 2C89A 5DZQA 4PKWA 4PKQA 1J7NA 1OG1A 2GWMA 2C8CA 4H03A 3BW8A 4H0VA 2J3VA 2J3ZA 2WN5A 4PKVA 1G24A 1OJZA 4PKTA 4H0XA 2WN7A 2C8EE 4PKSA 1QS2A 1GZFA 5BWMB 1GXYA 2C8GA 2C8HA 2A78B 3NTSA 2BOVB 1GY0A 1OG3A 1GXZA 2WN6A 2C8DA 3U0JA 2WN8A 1GIRA 4FXQA 4ELNA 4XM7A 5D1TA 1PWWA 1GZEA 4XM8A 4GF1A 4XM6A 4XSHB 4H0YA 4PKRA 5H04A
chains in the Genus database with same CATH topology
1GIQA 5D1SA 1PWUA 2J3XA 1OG4A 1JKYA 2C8FE 4GY2A 2GWLA 1R4BA 1PWQA 2C8BX 1QS1A 4DV8A 1ZXVA 4FK7A 4H0TA 5GTTA 4PKUA 3BUZA 4WF6A 5H03A 1R45A 5D1UA 2WN4A 4XSGB 4FMLA 1UZIA 4TR5A 1PWPA 2C8AA 2A9KB 1YQYA 1PWVA 1OJQA 2C89A 5DZQA 4PKWA 4PKQA 1J7NA 1OG1A 2GWMA 2C8CA 4H03A 3BW8A 4H0VA 2J3VA 2J3ZA 2WN5A 4PKVA 1G24A 1OJZA 4PKTA 4H0XA 2WN7A 2C8EE 4PKSA 1QS2A 1GZFA 5BWMB 1GXYA 2C8GA 2C8HA 2A78B 3NTSA 2BOVB 1GY0A 1OG3A 1GXZA 2WN6A 2C8DA 3U0JA 2WN8A 1GIRA 4FXQA 4ELNA 4XM7A 5D1TA 1PWWA 1GZEA 4XM8A 4GF1A 4XM6A 4XSHB 4H0YA 4PKRA 5H04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GIQ A;  5D1S A;  1PWU A;  2J3X A;  1OG4 A;  1JKY A;  2C8F E;  4GY2 A;  2GWL A;  1R4B A;  1PWQ A;  2C8B X;  1QS1 A;  4DV8 A;  1ZXV A;  4FK7 A;  4H0T A;  5GTT A;  4PKU A;  3BUZ A;  4WF6 A;  5H03 A;  1R45 A;  5D1U A;  2WN4 A;  4XSG B;  4FML A;  1UZI A;  4TR5 A;  1PWP A;  2C8A A;  2A9K B;  1YQY A;  1PWV A;  1OJQ A;  2C89 A;  5DZQ A;  4PKW A;  4PKQ A;  1J7N A;  1OG1 A;  2GWM A;  2C8C A;  4H03 A;  3BW8 A;  4H0V A;  2J3V A;  2J3Z A;  2WN5 A;  4PKV A;  1G24 A;  1OJZ A;  4PKT A;  4H0X A;  2WN7 A;  2C8E E;  4PKS A;  1QS2 A;  1GZF A;  5BWM B;  1GXY A;  2C8G A;  2C8H A;  2A78 B;  3NTS A;  2BOV B;  1GY0 A;  1OG3 A;  1GXZ A;  2WN6 A;  2C8D A;  3U0J A;  2WN8 A;  1GIR A;  4FXQ A;  4ELN A;  4XM7 A;  5D1T A;  1PWW A;  1GZE A;  4XM8 A;  4GF1 A;  4XM6 A;  4XSH B;  4H0Y A;  4PKR A;  5H04 A; 
#chains in the Genus database with same CATH topology
 1GIQ A;  5D1S A;  1PWU A;  2J3X A;  1OG4 A;  1JKY A;  2C8F E;  4GY2 A;  2GWL A;  1R4B A;  1PWQ A;  2C8B X;  1QS1 A;  4DV8 A;  1ZXV A;  4FK7 A;  4H0T A;  5GTT A;  4PKU A;  3BUZ A;  4WF6 A;  5H03 A;  1R45 A;  5D1U A;  2WN4 A;  4XSG B;  4FML A;  1UZI A;  4TR5 A;  1PWP A;  2C8A A;  2A9K B;  1YQY A;  1PWV A;  1OJQ A;  2C89 A;  5DZQ A;  4PKW A;  4PKQ A;  1J7N A;  1OG1 A;  2GWM A;  2C8C A;  4H03 A;  3BW8 A;  4H0V A;  2J3V A;  2J3Z A;  2WN5 A;  4PKV A;  1G24 A;  1OJZ A;  4PKT A;  4H0X A;  2WN7 A;  2C8E E;  4PKS A;  1QS2 A;  1GZF A;  5BWM B;  1GXY A;  2C8G A;  2C8H A;  2A78 B;  3NTS A;  2BOV B;  1GY0 A;  1OG3 A;  1GXZ A;  2WN6 A;  2C8D A;  3U0J A;  2WN8 A;  1GIR A;  4FXQ A;  4ELN A;  4XM7 A;  5D1T A;  1PWW A;  1GZE A;  4XM8 A;  4GF1 A;  4XM6 A;  4XSH B;  4H0Y A;  4PKR A;  5H04 A; 
#chains in the Genus database with same CATH homology
 1GIQ A;  5D1S A;  1PWU A;  2J3X A;  1OG4 A;  1JKY A;  2C8F E;  4GY2 A;  2GWL A;  1R4B A;  1PWQ A;  2C8B X;  1QS1 A;  4DV8 A;  1ZXV A;  4FK7 A;  4H0T A;  5GTT A;  4PKU A;  3BUZ A;  4WF6 A;  5H03 A;  1R45 A;  5D1U A;  2WN4 A;  4XSG B;  4FML A;  1UZI A;  4TR5 A;  1PWP A;  2C8A A;  2A9K B;  1YQY A;  1PWV A;  1OJQ A;  2C89 A;  5DZQ A;  4PKW A;  4PKQ A;  1J7N A;  1OG1 A;  2GWM A;  2C8C A;  4H03 A;  3BW8 A;  4H0V A;  2J3V A;  2J3Z A;  2WN5 A;  4PKV A;  1G24 A;  1OJZ A;  4PKT A;  4H0X A;  2WN7 A;  2C8E E;  4PKS A;  1QS2 A;  1GZF A;  5BWM B;  1GXY A;  2C8G A;  2C8H A;  2A78 B;  3NTS A;  2BOV B;  1GY0 A;  1OG3 A;  1GXZ A;  2WN6 A;  2C8D A;  3U0J A;  2WN8 A;  1GIR A;  4FXQ A;  4ELN A;  4XM7 A;  5D1T A;  1PWW A;  1GZE A;  4XM8 A;  4GF1 A;  4XM6 A;  4XSH B;  4H0Y A;  4PKR A;  5H04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...