2C8BX

Structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form ii)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum d bacteriophage
total genus 61
structure length 201
sequence length 201
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8bX00
4H0XA 4PKQA 2C8AA 4FXQA 1PWPA 1GZEA 4PKWA 4FK7A 1OG3A 5GTTA 4FMLA 1GIRA 2A78B 4PKRA 2GWMA 4PKUA 1OG4A 2WN8A 2C8CA 4PKSA 1R4BA 4H0TA 4WF6A 2C8DA 1QS1A 4XM8A 1G24A 4XSGB 4PKVA 4XSHB 5DZQA 3U0JA 5H04A 2C89A 3BW8A 2WN7A 2WN5A 1GIQA 4H0VA 3BUZA 2J3XA 1PWVA 1PWWA 5D1UA 1QS2A 1PWUA 2C8EE 1GXYA 5H03A 1GZFA 2J3VA 2C8HA 4GF1A 1OJZA 5D1TA 4GY2A 1J7NA 2A9KB 2BOVB 2C8BX 2WN4A 4XM6A 3NTSA 1PWQA 1JKYA 1GXZA 4PKTA 4TR5A 1OG1A 1R45A 1YQYA 2J3ZA 2C8GA 5D1SA 2GWLA 4H03A 1GY0A 2WN6A 1OJQA 1UZIA 4ELNA 4H0YA 4DV8A 5BWMB 2C8FE 1ZXVA 4XM7A
chains in the Genus database with same CATH superfamily
4H0XA 4PKQA 2C8AA 4FXQA 1PWPA 1GZEA 4PKWA 4FK7A 1OG3A 5GTTA 4FMLA 1GIRA 2A78B 4PKRA 2GWMA 4PKUA 1OG4A 2WN8A 2C8CA 4PKSA 1R4BA 4H0TA 4WF6A 2C8DA 1QS1A 4XM8A 1G24A 4XSGB 4PKVA 4XSHB 5DZQA 3U0JA 5H04A 2C89A 3BW8A 2WN7A 2WN5A 1GIQA 4H0VA 3BUZA 2J3XA 1PWVA 1PWWA 5D1UA 1QS2A 1PWUA 2C8EE 1GXYA 5H03A 1GZFA 2J3VA 2C8HA 4GF1A 1OJZA 5D1TA 4GY2A 1J7NA 2A9KB 2BOVB 2C8BX 2WN4A 4XM6A 3NTSA 1PWQA 1JKYA 1GXZA 4PKTA 4TR5A 1OG1A 1R45A 1YQYA 2J3ZA 2C8GA 5D1SA 2GWLA 4H03A 1GY0A 2WN6A 1OJQA 1UZIA 4ELNA 4H0YA 4DV8A 5BWMB 2C8FE 1ZXVA 4XM7A
chains in the Genus database with same CATH topology
4H0XA 4PKQA 2C8AA 4FXQA 1PWPA 1GZEA 4PKWA 4FK7A 1OG3A 5GTTA 4FMLA 1GIRA 2A78B 4PKRA 2GWMA 4PKUA 1OG4A 2WN8A 2C8CA 4PKSA 1R4BA 4H0TA 4WF6A 2C8DA 1QS1A 4XM8A 1G24A 4XSGB 4PKVA 4XSHB 5DZQA 3U0JA 5H04A 2C89A 3BW8A 2WN7A 2WN5A 1GIQA 4H0VA 3BUZA 2J3XA 1PWVA 1PWWA 5D1UA 1QS2A 1PWUA 2C8EE 1GXYA 5H03A 1GZFA 2J3VA 2C8HA 4GF1A 1OJZA 5D1TA 4GY2A 1J7NA 2A9KB 2BOVB 2C8BX 2WN4A 4XM6A 3NTSA 1PWQA 1JKYA 1GXZA 4PKTA 4TR5A 1OG1A 1R45A 1YQYA 2J3ZA 2C8GA 5D1SA 2GWLA 4H03A 1GY0A 2WN6A 1OJQA 1UZIA 4ELNA 4H0YA 4DV8A 5BWMB 2C8FE 1ZXVA 4XM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0X A;  4PKQ A;  2C8A A;  4FXQ A;  1PWP A;  1GZE A;  4PKW A;  4FK7 A;  1OG3 A;  5GTT A;  4FML A;  1GIR A;  2A78 B;  4PKR A;  2GWM A;  4PKU A;  1OG4 A;  2WN8 A;  2C8C A;  4PKS A;  1R4B A;  4H0T A;  4WF6 A;  2C8D A;  1QS1 A;  4XM8 A;  1G24 A;  4XSG B;  4PKV A;  4XSH B;  5DZQ A;  3U0J A;  5H04 A;  2C89 A;  3BW8 A;  2WN7 A;  2WN5 A;  1GIQ A;  4H0V A;  3BUZ A;  2J3X A;  1PWV A;  1PWW A;  5D1U A;  1QS2 A;  1PWU A;  2C8E E;  1GXY A;  5H03 A;  1GZF A;  2J3V A;  2C8H A;  4GF1 A;  1OJZ A;  5D1T A;  4GY2 A;  1J7N A;  2A9K B;  2BOV B;  2C8B X;  2WN4 A;  4XM6 A;  3NTS A;  1PWQ A;  1JKY A;  1GXZ A;  4PKT A;  4TR5 A;  1OG1 A;  1R45 A;  1YQY A;  2J3Z A;  2C8G A;  5D1S A;  2GWL A;  4H03 A;  1GY0 A;  2WN6 A;  1OJQ A;  1UZI A;  4ELN A;  4H0Y A;  4DV8 A;  5BWM B;  2C8F E;  1ZXV A;  4XM7 A; 
#chains in the Genus database with same CATH topology
 4H0X A;  4PKQ A;  2C8A A;  4FXQ A;  1PWP A;  1GZE A;  4PKW A;  4FK7 A;  1OG3 A;  5GTT A;  4FML A;  1GIR A;  2A78 B;  4PKR A;  2GWM A;  4PKU A;  1OG4 A;  2WN8 A;  2C8C A;  4PKS A;  1R4B A;  4H0T A;  4WF6 A;  2C8D A;  1QS1 A;  4XM8 A;  1G24 A;  4XSG B;  4PKV A;  4XSH B;  5DZQ A;  3U0J A;  5H04 A;  2C89 A;  3BW8 A;  2WN7 A;  2WN5 A;  1GIQ A;  4H0V A;  3BUZ A;  2J3X A;  1PWV A;  1PWW A;  5D1U A;  1QS2 A;  1PWU A;  2C8E E;  1GXY A;  5H03 A;  1GZF A;  2J3V A;  2C8H A;  4GF1 A;  1OJZ A;  5D1T A;  4GY2 A;  1J7N A;  2A9K B;  2BOV B;  2C8B X;  2WN4 A;  4XM6 A;  3NTS A;  1PWQ A;  1JKY A;  1GXZ A;  4PKT A;  4TR5 A;  1OG1 A;  1R45 A;  1YQY A;  2J3Z A;  2C8G A;  5D1S A;  2GWL A;  4H03 A;  1GY0 A;  2WN6 A;  1OJQ A;  1UZI A;  4ELN A;  4H0Y A;  4DV8 A;  5BWM B;  2C8F E;  1ZXV A;  4XM7 A; 
#chains in the Genus database with same CATH homology
 4H0X A;  4PKQ A;  2C8A A;  4FXQ A;  1PWP A;  1GZE A;  4PKW A;  4FK7 A;  1OG3 A;  5GTT A;  4FML A;  1GIR A;  2A78 B;  4PKR A;  2GWM A;  4PKU A;  1OG4 A;  2WN8 A;  2C8C A;  4PKS A;  1R4B A;  4H0T A;  4WF6 A;  2C8D A;  1QS1 A;  4XM8 A;  1G24 A;  4XSG B;  4PKV A;  4XSH B;  5DZQ A;  3U0J A;  5H04 A;  2C89 A;  3BW8 A;  2WN7 A;  2WN5 A;  1GIQ A;  4H0V A;  3BUZ A;  2J3X A;  1PWV A;  1PWW A;  5D1U A;  1QS2 A;  1PWU A;  2C8E E;  1GXY A;  5H03 A;  1GZF A;  2J3V A;  2C8H A;  4GF1 A;  1OJZ A;  5D1T A;  4GY2 A;  1J7N A;  2A9K B;  2BOV B;  2C8B X;  2WN4 A;  4XM6 A;  3NTS A;  1PWQ A;  1JKY A;  1GXZ A;  4PKT A;  4TR5 A;  1OG1 A;  1R45 A;  1YQY A;  2J3Z A;  2C8G A;  5D1S A;  2GWL A;  4H03 A;  1GY0 A;  2WN6 A;  1OJQ A;  1UZI A;  4ELN A;  4H0Y A;  4DV8 A;  5BWM B;  2C8F E;  1ZXV A;  4XM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...