2C8BX

Structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form ii)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum d bacteriophage
molecule tags Transferase
total genus 61
structure length 201
sequence length 201
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8bX00
4H0TA 2WN4A 2WN7A 4H0VA 4PKRA 2C8FE 1ZXVA 4H03A 1GZEA 4XSGB 1GXYA 1PWVA 4PKTA 2C8DA 5H03A 4H0YA 4DV8A 5D1UA 1JKYA 2C8AA 1OG3A 4GF1A 2WN5A 1OG4A 1GXZA 2C8GA 1OJZA 4PKUA 4XM8A 1PWWA 1UZIA 1R45A 1GIRA 4ELNA 2A78B 4PKSA 4PKQA 2C8HA 1R4BA 2J3XA 2BOVB 2WN6A 4FMLA 2GWMA 1PWPA 5GTTA 2GWLA 5H04A 1QS2A 1PWUA 1OG1A 5BWMB 3NTSA 2C8BX 1GIQA 2C8EE 2C8CA 3BW8A 2J3ZA 1GY0A 1J7NA 4FXQA 2WN8A 4WF6A 2A9KB 4PKVA 5D1SA 4FK7A 1G24A 2J3VA 5D1TA 4XM7A 4XM6A 1PWQA 3BUZA 2C89A 4XSHB 4GY2A 3U0JA 1QS1A 4H0XA 1GZFA 4PKWA 4TR5A 1OJQA 1YQYA 5DZQA
chains in the Genus database with same CATH superfamily
4H0TA 2WN4A 2WN7A 4H0VA 4PKRA 2C8FE 1ZXVA 4H03A 1GZEA 4XSGB 1GXYA 1PWVA 4PKTA 2C8DA 5H03A 4H0YA 4DV8A 5D1UA 1JKYA 2C8AA 1OG3A 4GF1A 2WN5A 1OG4A 1GXZA 2C8GA 1OJZA 4PKUA 4XM8A 1PWWA 1UZIA 1R45A 1GIRA 4ELNA 2A78B 4PKSA 4PKQA 2C8HA 1R4BA 2J3XA 2BOVB 2WN6A 4FMLA 2GWMA 1PWPA 5GTTA 2GWLA 5H04A 1QS2A 1PWUA 1OG1A 5BWMB 3NTSA 2C8BX 1GIQA 2C8EE 2C8CA 3BW8A 2J3ZA 1GY0A 1J7NA 4FXQA 2WN8A 4WF6A 2A9KB 4PKVA 5D1SA 4FK7A 1G24A 2J3VA 5D1TA 4XM7A 4XM6A 1PWQA 3BUZA 2C89A 4XSHB 4GY2A 3U0JA 1QS1A 4H0XA 1GZFA 4PKWA 4TR5A 1OJQA 1YQYA 5DZQA
chains in the Genus database with same CATH topology
4H0TA 2WN4A 2WN7A 4H0VA 4PKRA 2C8FE 1ZXVA 4H03A 1GZEA 4XSGB 1GXYA 1PWVA 4PKTA 2C8DA 5H03A 4H0YA 4DV8A 5D1UA 1JKYA 2C8AA 1OG3A 4GF1A 2WN5A 1OG4A 1GXZA 2C8GA 1OJZA 4PKUA 4XM8A 1PWWA 1UZIA 1R45A 1GIRA 4ELNA 2A78B 4PKSA 4PKQA 2C8HA 1R4BA 2J3XA 2BOVB 2WN6A 4FMLA 2GWMA 1PWPA 5GTTA 2GWLA 5H04A 1QS2A 1PWUA 1OG1A 5BWMB 3NTSA 2C8BX 1GIQA 2C8EE 2C8CA 3BW8A 2J3ZA 1GY0A 1J7NA 4FXQA 2WN8A 4WF6A 2A9KB 4PKVA 5D1SA 4FK7A 1G24A 2J3VA 5D1TA 4XM7A 4XM6A 1PWQA 3BUZA 2C89A 4XSHB 4GY2A 3U0JA 1QS1A 4H0XA 1GZFA 4PKWA 4TR5A 1OJQA 1YQYA 5DZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0T A;  2WN4 A;  2WN7 A;  4H0V A;  4PKR A;  2C8F E;  1ZXV A;  4H03 A;  1GZE A;  4XSG B;  1GXY A;  1PWV A;  4PKT A;  2C8D A;  5H03 A;  4H0Y A;  4DV8 A;  5D1U A;  1JKY A;  2C8A A;  1OG3 A;  4GF1 A;  2WN5 A;  1OG4 A;  1GXZ A;  2C8G A;  1OJZ A;  4PKU A;  4XM8 A;  1PWW A;  1UZI A;  1R45 A;  1GIR A;  4ELN A;  2A78 B;  4PKS A;  4PKQ A;  2C8H A;  1R4B A;  2J3X A;  2BOV B;  2WN6 A;  4FML A;  2GWM A;  1PWP A;  5GTT A;  2GWL A;  5H04 A;  1QS2 A;  1PWU A;  1OG1 A;  5BWM B;  3NTS A;  2C8B X;  1GIQ A;  2C8E E;  2C8C A;  3BW8 A;  2J3Z A;  1GY0 A;  1J7N A;  4FXQ A;  2WN8 A;  4WF6 A;  2A9K B;  4PKV A;  5D1S A;  4FK7 A;  1G24 A;  2J3V A;  5D1T A;  4XM7 A;  4XM6 A;  1PWQ A;  3BUZ A;  2C89 A;  4XSH B;  4GY2 A;  3U0J A;  1QS1 A;  4H0X A;  1GZF A;  4PKW A;  4TR5 A;  1OJQ A;  1YQY A;  5DZQ A; 
#chains in the Genus database with same CATH topology
 4H0T A;  2WN4 A;  2WN7 A;  4H0V A;  4PKR A;  2C8F E;  1ZXV A;  4H03 A;  1GZE A;  4XSG B;  1GXY A;  1PWV A;  4PKT A;  2C8D A;  5H03 A;  4H0Y A;  4DV8 A;  5D1U A;  1JKY A;  2C8A A;  1OG3 A;  4GF1 A;  2WN5 A;  1OG4 A;  1GXZ A;  2C8G A;  1OJZ A;  4PKU A;  4XM8 A;  1PWW A;  1UZI A;  1R45 A;  1GIR A;  4ELN A;  2A78 B;  4PKS A;  4PKQ A;  2C8H A;  1R4B A;  2J3X A;  2BOV B;  2WN6 A;  4FML A;  2GWM A;  1PWP A;  5GTT A;  2GWL A;  5H04 A;  1QS2 A;  1PWU A;  1OG1 A;  5BWM B;  3NTS A;  2C8B X;  1GIQ A;  2C8E E;  2C8C A;  3BW8 A;  2J3Z A;  1GY0 A;  1J7N A;  4FXQ A;  2WN8 A;  4WF6 A;  2A9K B;  4PKV A;  5D1S A;  4FK7 A;  1G24 A;  2J3V A;  5D1T A;  4XM7 A;  4XM6 A;  1PWQ A;  3BUZ A;  2C89 A;  4XSH B;  4GY2 A;  3U0J A;  1QS1 A;  4H0X A;  1GZF A;  4PKW A;  4TR5 A;  1OJQ A;  1YQY A;  5DZQ A; 
#chains in the Genus database with same CATH homology
 4H0T A;  2WN4 A;  2WN7 A;  4H0V A;  4PKR A;  2C8F E;  1ZXV A;  4H03 A;  1GZE A;  4XSG B;  1GXY A;  1PWV A;  4PKT A;  2C8D A;  5H03 A;  4H0Y A;  4DV8 A;  5D1U A;  1JKY A;  2C8A A;  1OG3 A;  4GF1 A;  2WN5 A;  1OG4 A;  1GXZ A;  2C8G A;  1OJZ A;  4PKU A;  4XM8 A;  1PWW A;  1UZI A;  1R45 A;  1GIR A;  4ELN A;  2A78 B;  4PKS A;  4PKQ A;  2C8H A;  1R4B A;  2J3X A;  2BOV B;  2WN6 A;  4FML A;  2GWM A;  1PWP A;  5GTT A;  2GWL A;  5H04 A;  1QS2 A;  1PWU A;  1OG1 A;  5BWM B;  3NTS A;  2C8B X;  1GIQ A;  2C8E E;  2C8C A;  3BW8 A;  2J3Z A;  1GY0 A;  1J7N A;  4FXQ A;  2WN8 A;  4WF6 A;  2A9K B;  4PKV A;  5D1S A;  4FK7 A;  1G24 A;  2J3V A;  5D1T A;  4XM7 A;  4XM6 A;  1PWQ A;  3BUZ A;  2C89 A;  4XSH B;  4GY2 A;  3U0J A;  1QS1 A;  4H0X A;  1GZF A;  4PKW A;  4TR5 A;  1OJQ A;  1YQY A;  5DZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...