5DZQA

C3larvin toxin, an adp-ribosyltransferase from paenibacillus larvae, orthorhombic form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
176
Chain Sequence
AWEKKLRANEKELVKEYTANAKPFNTYLRANEGKLGFKPEIDKKILKLDEALKKSKLSETVQVYRGDDTSIFGKEFQNSIYQGNKVNRELFRKLRDEYQGKIRTEYGYLSTSIVSNQQFAMRPVLTTLKVPKGAHAGYVDQYELLLPRNTKYKIDKMYIIVNKGSETIKIEATVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Toxin-like protein
publication title Structural variability of C3larvin toxin. Intrinsic dynamics of the alpha / beta fold of the C3-like group of mono-ADP-ribosyltransferase toxins.
pubmed doi rcsb
source organism Paenibacillus larvae subsp. larvae brl-230010
total genus 54
structure length 176
sequence length 183
chains with identical sequence O
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 5dzqA00
1ZXVA 2A78B 4XM6A 2C8DA 4XM7A 1OG1A 2C8EE 1R45A 4ELNA 1QS1A 5H03A 4PKUA 4H0YA 1GIRA 4PKRA 1UZIA 2C8GA 3BUZA 4WF6A 1R4BA 2J3VA 4H0XA 1PWWA 5H04A 4PKWA 1GXZA 2C8AA 1QS2A 4FMLA 2WN6A 4PKVA 1GXYA 1OJQA 2C8HA 1GY0A 4GY2A 4PKSA 1YQYA 5DZQA 1OG4A 1PWPA 2WN7A 1GZEA 2C8FE 4PKTA 4XM8A 1OJZA 1PWVA 2C8BX 2WN5A 3U0JA 2C89A 2J3XA 1G24A 4PKQA 4XSHB 1GIQA 2GWLA 4FK7A 4GF1A 2A9KB 4H0VA 2J3ZA 5BWMB 5D1TA 1GZFA 5D1UA 1J7NA 1JKYA 2GWMA 3BW8A 2WN8A 5GTTA 4FXQA 1OG3A 1PWUA 4XSGB 5D1SA 4H03A 2C8CA 1PWQA 3NTSA 4TR5A 2BOVB 4DV8A 4H0TA 2WN4A
chains in the Genus database with same CATH superfamily
1ZXVA 2A78B 4XM6A 2C8DA 4XM7A 1OG1A 2C8EE 1R45A 4ELNA 1QS1A 5H03A 4PKUA 4H0YA 1GIRA 4PKRA 1UZIA 2C8GA 3BUZA 4WF6A 1R4BA 2J3VA 4H0XA 1PWWA 5H04A 4PKWA 1GXZA 2C8AA 1QS2A 4FMLA 2WN6A 4PKVA 1GXYA 1OJQA 2C8HA 1GY0A 4GY2A 4PKSA 1YQYA 5DZQA 1OG4A 1PWPA 2WN7A 1GZEA 2C8FE 4PKTA 4XM8A 1OJZA 1PWVA 2C8BX 2WN5A 3U0JA 2C89A 2J3XA 1G24A 4PKQA 4XSHB 1GIQA 2GWLA 4FK7A 4GF1A 2A9KB 4H0VA 2J3ZA 5BWMB 5D1TA 1GZFA 5D1UA 1J7NA 1JKYA 2GWMA 3BW8A 2WN8A 5GTTA 4FXQA 1OG3A 1PWUA 4XSGB 5D1SA 4H03A 2C8CA 1PWQA 3NTSA 4TR5A 2BOVB 4DV8A 4H0TA 2WN4A
chains in the Genus database with same CATH topology
1ZXVA 2A78B 4XM6A 2C8DA 4XM7A 1OG1A 2C8EE 1R45A 4ELNA 1QS1A 5H03A 4PKUA 4H0YA 1GIRA 4PKRA 1UZIA 2C8GA 3BUZA 4WF6A 1R4BA 2J3VA 4H0XA 1PWWA 5H04A 4PKWA 1GXZA 2C8AA 1QS2A 4FMLA 2WN6A 4PKVA 1GXYA 1OJQA 2C8HA 1GY0A 4GY2A 4PKSA 1YQYA 5DZQA 1OG4A 1PWPA 2WN7A 1GZEA 2C8FE 4PKTA 4XM8A 1OJZA 1PWVA 2C8BX 2WN5A 3U0JA 2C89A 2J3XA 1G24A 4PKQA 4XSHB 1GIQA 2GWLA 4FK7A 4GF1A 2A9KB 4H0VA 2J3ZA 5BWMB 5D1TA 1GZFA 5D1UA 1J7NA 1JKYA 2GWMA 3BW8A 2WN8A 5GTTA 4FXQA 1OG3A 1PWUA 4XSGB 5D1SA 4H03A 2C8CA 1PWQA 3NTSA 4TR5A 2BOVB 4DV8A 4H0TA 2WN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXV A;  2A78 B;  4XM6 A;  2C8D A;  4XM7 A;  1OG1 A;  2C8E E;  1R45 A;  4ELN A;  1QS1 A;  5H03 A;  4PKU A;  4H0Y A;  1GIR A;  4PKR A;  1UZI A;  2C8G A;  3BUZ A;  4WF6 A;  1R4B A;  2J3V A;  4H0X A;  1PWW A;  5H04 A;  4PKW A;  1GXZ A;  2C8A A;  1QS2 A;  4FML A;  2WN6 A;  4PKV A;  1GXY A;  1OJQ A;  2C8H A;  1GY0 A;  4GY2 A;  4PKS A;  1YQY A;  5DZQ A;  1OG4 A;  1PWP A;  2WN7 A;  1GZE A;  2C8F E;  4PKT A;  4XM8 A;  1OJZ A;  1PWV A;  2C8B X;  2WN5 A;  3U0J A;  2C89 A;  2J3X A;  1G24 A;  4PKQ A;  4XSH B;  1GIQ A;  2GWL A;  4FK7 A;  4GF1 A;  2A9K B;  4H0V A;  2J3Z A;  5BWM B;  5D1T A;  1GZF A;  5D1U A;  1J7N A;  1JKY A;  2GWM A;  3BW8 A;  2WN8 A;  5GTT A;  4FXQ A;  1OG3 A;  1PWU A;  4XSG B;  5D1S A;  4H03 A;  2C8C A;  1PWQ A;  3NTS A;  4TR5 A;  2BOV B;  4DV8 A;  4H0T A;  2WN4 A; 
#chains in the Genus database with same CATH topology
 1ZXV A;  2A78 B;  4XM6 A;  2C8D A;  4XM7 A;  1OG1 A;  2C8E E;  1R45 A;  4ELN A;  1QS1 A;  5H03 A;  4PKU A;  4H0Y A;  1GIR A;  4PKR A;  1UZI A;  2C8G A;  3BUZ A;  4WF6 A;  1R4B A;  2J3V A;  4H0X A;  1PWW A;  5H04 A;  4PKW A;  1GXZ A;  2C8A A;  1QS2 A;  4FML A;  2WN6 A;  4PKV A;  1GXY A;  1OJQ A;  2C8H A;  1GY0 A;  4GY2 A;  4PKS A;  1YQY A;  5DZQ A;  1OG4 A;  1PWP A;  2WN7 A;  1GZE A;  2C8F E;  4PKT A;  4XM8 A;  1OJZ A;  1PWV A;  2C8B X;  2WN5 A;  3U0J A;  2C89 A;  2J3X A;  1G24 A;  4PKQ A;  4XSH B;  1GIQ A;  2GWL A;  4FK7 A;  4GF1 A;  2A9K B;  4H0V A;  2J3Z A;  5BWM B;  5D1T A;  1GZF A;  5D1U A;  1J7N A;  1JKY A;  2GWM A;  3BW8 A;  2WN8 A;  5GTT A;  4FXQ A;  1OG3 A;  1PWU A;  4XSG B;  5D1S A;  4H03 A;  2C8C A;  1PWQ A;  3NTS A;  4TR5 A;  2BOV B;  4DV8 A;  4H0T A;  2WN4 A; 
#chains in the Genus database with same CATH homology
 1ZXV A;  2A78 B;  4XM6 A;  2C8D A;  4XM7 A;  1OG1 A;  2C8E E;  1R45 A;  4ELN A;  1QS1 A;  5H03 A;  4PKU A;  4H0Y A;  1GIR A;  4PKR A;  1UZI A;  2C8G A;  3BUZ A;  4WF6 A;  1R4B A;  2J3V A;  4H0X A;  1PWW A;  5H04 A;  4PKW A;  1GXZ A;  2C8A A;  1QS2 A;  4FML A;  2WN6 A;  4PKV A;  1GXY A;  1OJQ A;  2C8H A;  1GY0 A;  4GY2 A;  4PKS A;  1YQY A;  5DZQ A;  1OG4 A;  1PWP A;  2WN7 A;  1GZE A;  2C8F E;  4PKT A;  4XM8 A;  1OJZ A;  1PWV A;  2C8B X;  2WN5 A;  3U0J A;  2C89 A;  2J3X A;  1G24 A;  4PKQ A;  4XSH B;  1GIQ A;  2GWL A;  4FK7 A;  4GF1 A;  2A9K B;  4H0V A;  2J3Z A;  5BWM B;  5D1T A;  1GZF A;  5D1U A;  1J7N A;  1JKY A;  2GWM A;  3BW8 A;  2WN8 A;  5GTT A;  4FXQ A;  1OG3 A;  1PWU A;  4XSG B;  5D1S A;  4H03 A;  2C8C A;  1PWQ A;  3NTS A;  4TR5 A;  2BOV B;  4DV8 A;  4H0T A;  2WN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...