5DZQA

C3larvin toxin, an adp-ribosyltransferase from paenibacillus larvae, orthorhombic form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
183
structure length
176
Chain Sequence
AWEKKLRANEKELVKEYTANAKPFNTYLRANEGKLGFKPEIDKKILKLDEALKKSKLSETVQVYRGDDTSIFGKEFQNSIYQGNKVNRELFRKLRDEYQGKIRTEYGYLSTSIVSNQQFAMRPVLTTLKVPKGAHAGYVDQYELLLPRNTKYKIDKMYIIVNKGSETIKIEATVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin-like protein
publication title Structural variability of C3larvin toxin. Intrinsic dynamics of the alpha / beta fold of the C3-like group of mono-ADP-ribosyltransferase toxins.
pubmed doi rcsb
source organism Paenibacillus larvae subsp. larvae brl-230010
molecule tags Transferase
total genus 54
structure length 176
sequence length 183
chains with identical sequence O
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 5dzqA00
1ZXVA 4DV8A 4GF1A 5BWMB 2C8CA 4FK7A 2WN8A 2BOVB 3BUZA 4ELNA 1OG3A 4XM7A 5DZQA 1R4BA 4PKWA 4XSHB 1PWVA 5H03A 1GY0A 2C8BX 1R45A 4H0TA 4PKRA 4TR5A 4H0XA 2J3XA 4PKSA 1GXYA 2J3ZA 3NTSA 1GIRA 1GIQA 1UZIA 4PKQA 2WN7A 5GTTA 4GY2A 1PWQA 4PKTA 1JKYA 4H0VA 1J7NA 1OG4A 2C8GA 4H0YA 1PWPA 5D1UA 2C8EE 3U0JA 2J3VA 1OG1A 4FXQA 3BW8A 5D1SA 2C8HA 1G24A 4FMLA 1GXZA 1OJZA 5D1TA 4PKVA 1GZEA 1QS2A 1PWWA 1PWUA 1GZFA 5H04A 2C8DA 1OJQA 2GWLA 4WF6A 4XM6A 2A78B 4XSGB 4H03A 1YQYA 2WN6A 2WN5A 4PKUA 2C89A 1QS1A 2WN4A 4XM8A 2A9KB 2GWMA 2C8FE 2C8AA
chains in the Genus database with same CATH superfamily
1ZXVA 4DV8A 4GF1A 5BWMB 2C8CA 4FK7A 2WN8A 2BOVB 3BUZA 4ELNA 1OG3A 4XM7A 5DZQA 1R4BA 4PKWA 4XSHB 1PWVA 5H03A 1GY0A 2C8BX 1R45A 4H0TA 4PKRA 4TR5A 4H0XA 2J3XA 4PKSA 1GXYA 2J3ZA 3NTSA 1GIRA 1GIQA 1UZIA 4PKQA 2WN7A 5GTTA 4GY2A 1PWQA 4PKTA 1JKYA 4H0VA 1J7NA 1OG4A 2C8GA 4H0YA 1PWPA 5D1UA 2C8EE 3U0JA 2J3VA 1OG1A 4FXQA 3BW8A 5D1SA 2C8HA 1G24A 4FMLA 1GXZA 1OJZA 5D1TA 4PKVA 1GZEA 1QS2A 1PWWA 1PWUA 1GZFA 5H04A 2C8DA 1OJQA 2GWLA 4WF6A 4XM6A 2A78B 4XSGB 4H03A 1YQYA 2WN6A 2WN5A 4PKUA 2C89A 1QS1A 2WN4A 4XM8A 2A9KB 2GWMA 2C8FE 2C8AA
chains in the Genus database with same CATH topology
1ZXVA 4DV8A 4GF1A 5BWMB 2C8CA 4FK7A 2WN8A 2BOVB 3BUZA 4ELNA 1OG3A 4XM7A 5DZQA 1R4BA 4PKWA 4XSHB 1PWVA 5H03A 1GY0A 2C8BX 1R45A 4H0TA 4PKRA 4TR5A 4H0XA 2J3XA 4PKSA 1GXYA 2J3ZA 3NTSA 1GIRA 1GIQA 1UZIA 4PKQA 2WN7A 5GTTA 4GY2A 1PWQA 4PKTA 1JKYA 4H0VA 1J7NA 1OG4A 2C8GA 4H0YA 1PWPA 5D1UA 2C8EE 3U0JA 2J3VA 1OG1A 4FXQA 3BW8A 5D1SA 2C8HA 1G24A 4FMLA 1GXZA 1OJZA 5D1TA 4PKVA 1GZEA 1QS2A 1PWWA 1PWUA 1GZFA 5H04A 2C8DA 1OJQA 2GWLA 4WF6A 4XM6A 2A78B 4XSGB 4H03A 1YQYA 2WN6A 2WN5A 4PKUA 2C89A 1QS1A 2WN4A 4XM8A 2A9KB 2GWMA 2C8FE 2C8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXV A;  4DV8 A;  4GF1 A;  5BWM B;  2C8C A;  4FK7 A;  2WN8 A;  2BOV B;  3BUZ A;  4ELN A;  1OG3 A;  4XM7 A;  5DZQ A;  1R4B A;  4PKW A;  4XSH B;  1PWV A;  5H03 A;  1GY0 A;  2C8B X;  1R45 A;  4H0T A;  4PKR A;  4TR5 A;  4H0X A;  2J3X A;  4PKS A;  1GXY A;  2J3Z A;  3NTS A;  1GIR A;  1GIQ A;  1UZI A;  4PKQ A;  2WN7 A;  5GTT A;  4GY2 A;  1PWQ A;  4PKT A;  1JKY A;  4H0V A;  1J7N A;  1OG4 A;  2C8G A;  4H0Y A;  1PWP A;  5D1U A;  2C8E E;  3U0J A;  2J3V A;  1OG1 A;  4FXQ A;  3BW8 A;  5D1S A;  2C8H A;  1G24 A;  4FML A;  1GXZ A;  1OJZ A;  5D1T A;  4PKV A;  1GZE A;  1QS2 A;  1PWW A;  1PWU A;  1GZF A;  5H04 A;  2C8D A;  1OJQ A;  2GWL A;  4WF6 A;  4XM6 A;  2A78 B;  4XSG B;  4H03 A;  1YQY A;  2WN6 A;  2WN5 A;  4PKU A;  2C89 A;  1QS1 A;  2WN4 A;  4XM8 A;  2A9K B;  2GWM A;  2C8F E;  2C8A A; 
#chains in the Genus database with same CATH topology
 1ZXV A;  4DV8 A;  4GF1 A;  5BWM B;  2C8C A;  4FK7 A;  2WN8 A;  2BOV B;  3BUZ A;  4ELN A;  1OG3 A;  4XM7 A;  5DZQ A;  1R4B A;  4PKW A;  4XSH B;  1PWV A;  5H03 A;  1GY0 A;  2C8B X;  1R45 A;  4H0T A;  4PKR A;  4TR5 A;  4H0X A;  2J3X A;  4PKS A;  1GXY A;  2J3Z A;  3NTS A;  1GIR A;  1GIQ A;  1UZI A;  4PKQ A;  2WN7 A;  5GTT A;  4GY2 A;  1PWQ A;  4PKT A;  1JKY A;  4H0V A;  1J7N A;  1OG4 A;  2C8G A;  4H0Y A;  1PWP A;  5D1U A;  2C8E E;  3U0J A;  2J3V A;  1OG1 A;  4FXQ A;  3BW8 A;  5D1S A;  2C8H A;  1G24 A;  4FML A;  1GXZ A;  1OJZ A;  5D1T A;  4PKV A;  1GZE A;  1QS2 A;  1PWW A;  1PWU A;  1GZF A;  5H04 A;  2C8D A;  1OJQ A;  2GWL A;  4WF6 A;  4XM6 A;  2A78 B;  4XSG B;  4H03 A;  1YQY A;  2WN6 A;  2WN5 A;  4PKU A;  2C89 A;  1QS1 A;  2WN4 A;  4XM8 A;  2A9K B;  2GWM A;  2C8F E;  2C8A A; 
#chains in the Genus database with same CATH homology
 1ZXV A;  4DV8 A;  4GF1 A;  5BWM B;  2C8C A;  4FK7 A;  2WN8 A;  2BOV B;  3BUZ A;  4ELN A;  1OG3 A;  4XM7 A;  5DZQ A;  1R4B A;  4PKW A;  4XSH B;  1PWV A;  5H03 A;  1GY0 A;  2C8B X;  1R45 A;  4H0T A;  4PKR A;  4TR5 A;  4H0X A;  2J3X A;  4PKS A;  1GXY A;  2J3Z A;  3NTS A;  1GIR A;  1GIQ A;  1UZI A;  4PKQ A;  2WN7 A;  5GTT A;  4GY2 A;  1PWQ A;  4PKT A;  1JKY A;  4H0V A;  1J7N A;  1OG4 A;  2C8G A;  4H0Y A;  1PWP A;  5D1U A;  2C8E E;  3U0J A;  2J3V A;  1OG1 A;  4FXQ A;  3BW8 A;  5D1S A;  2C8H A;  1G24 A;  4FML A;  1GXZ A;  1OJZ A;  5D1T A;  4PKV A;  1GZE A;  1QS2 A;  1PWW A;  1PWU A;  1GZF A;  5H04 A;  2C8D A;  1OJQ A;  2GWL A;  4WF6 A;  4XM6 A;  2A78 B;  4XSG B;  4H03 A;  1YQY A;  2WN6 A;  2WN5 A;  4PKU A;  2C89 A;  1QS1 A;  2WN4 A;  4XM8 A;  2A9K B;  2GWM A;  2C8F E;  2C8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...