5BWMB

The complex structure of c3cer exoenzyme and gdp bound rhoa (nadh-bound state)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 60
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 5bwmB00
1OG1A 4PKTA 1GY0A 4WF6A 1PWUA 4GY2A 1OJZA 4GF1A 2WN4A 2C8GA 2J3XA 2GWLA 4H0VA 1G24A 2J3ZA 2C8HA 4DV8A 1J7NA 3NTSA 2WN7A 2WN6A 1OJQA 2WN5A 5GTTA 3U0JA 4XM6A 4ELNA 4H0XA 1PWWA 3BW8A 2C8FE 1GZFA 1JKYA 4XM8A 4H0TA 4PKWA 1GZEA 4H03A 4FK7A 1PWVA 5H03A 1PWPA 1ZXVA 1UZIA 1GIQA 2C8AA 1OG3A 2BOVB 5BWMB 5D1UA 1R4BA 1OG4A 2WN8A 4PKRA 5DZQA 1GXYA 2C8BX 5D1SA 2C89A 2GWMA 2C8EE 2J3VA 1R45A 4TR5A 2A78B 4XM7A 5H04A 4PKQA 1PWQA 2C8CA 4XSHB 5D1TA 4FMLA 1GIRA 2A9KB 4FXQA 3BUZA 2C8DA 4H0YA 1QS2A 4XSGB 1QS1A 4PKUA 4PKVA 1GXZA 4PKSA 1YQYA
chains in the Genus database with same CATH superfamily
1OG1A 4PKTA 1GY0A 4WF6A 1PWUA 4GY2A 1OJZA 4GF1A 2WN4A 2C8GA 2J3XA 2GWLA 4H0VA 1G24A 2J3ZA 2C8HA 4DV8A 1J7NA 3NTSA 2WN7A 2WN6A 1OJQA 2WN5A 5GTTA 3U0JA 4XM6A 4ELNA 4H0XA 1PWWA 3BW8A 2C8FE 1GZFA 1JKYA 4XM8A 4H0TA 4PKWA 1GZEA 4H03A 4FK7A 1PWVA 5H03A 1PWPA 1ZXVA 1UZIA 1GIQA 2C8AA 1OG3A 2BOVB 5BWMB 5D1UA 1R4BA 1OG4A 2WN8A 4PKRA 5DZQA 1GXYA 2C8BX 5D1SA 2C89A 2GWMA 2C8EE 2J3VA 1R45A 4TR5A 2A78B 4XM7A 5H04A 4PKQA 1PWQA 2C8CA 4XSHB 5D1TA 4FMLA 1GIRA 2A9KB 4FXQA 3BUZA 2C8DA 4H0YA 1QS2A 4XSGB 1QS1A 4PKUA 4PKVA 1GXZA 4PKSA 1YQYA
chains in the Genus database with same CATH topology
1OG1A 4PKTA 1GY0A 4WF6A 1PWUA 4GY2A 1OJZA 4GF1A 2WN4A 2C8GA 2J3XA 2GWLA 4H0VA 1G24A 2J3ZA 2C8HA 4DV8A 1J7NA 3NTSA 2WN7A 2WN6A 1OJQA 2WN5A 5GTTA 3U0JA 4XM6A 4ELNA 4H0XA 1PWWA 3BW8A 2C8FE 1GZFA 1JKYA 4XM8A 4H0TA 4PKWA 1GZEA 4H03A 4FK7A 1PWVA 5H03A 1PWPA 1ZXVA 1UZIA 1GIQA 2C8AA 1OG3A 2BOVB 5BWMB 5D1UA 1R4BA 1OG4A 2WN8A 4PKRA 5DZQA 1GXYA 2C8BX 5D1SA 2C89A 2GWMA 2C8EE 2J3VA 1R45A 4TR5A 2A78B 4XM7A 5H04A 4PKQA 1PWQA 2C8CA 4XSHB 5D1TA 4FMLA 1GIRA 2A9KB 4FXQA 3BUZA 2C8DA 4H0YA 1QS2A 4XSGB 1QS1A 4PKUA 4PKVA 1GXZA 4PKSA 1YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OG1 A;  4PKT A;  1GY0 A;  4WF6 A;  1PWU A;  4GY2 A;  1OJZ A;  4GF1 A;  2WN4 A;  2C8G A;  2J3X A;  2GWL A;  4H0V A;  1G24 A;  2J3Z A;  2C8H A;  4DV8 A;  1J7N A;  3NTS A;  2WN7 A;  2WN6 A;  1OJQ A;  2WN5 A;  5GTT A;  3U0J A;  4XM6 A;  4ELN A;  4H0X A;  1PWW A;  3BW8 A;  2C8F E;  1GZF A;  1JKY A;  4XM8 A;  4H0T A;  4PKW A;  1GZE A;  4H03 A;  4FK7 A;  1PWV A;  5H03 A;  1PWP A;  1ZXV A;  1UZI A;  1GIQ A;  2C8A A;  1OG3 A;  2BOV B;  5BWM B;  5D1U A;  1R4B A;  1OG4 A;  2WN8 A;  4PKR A;  5DZQ A;  1GXY A;  2C8B X;  5D1S A;  2C89 A;  2GWM A;  2C8E E;  2J3V A;  1R45 A;  4TR5 A;  2A78 B;  4XM7 A;  5H04 A;  4PKQ A;  1PWQ A;  2C8C A;  4XSH B;  5D1T A;  4FML A;  1GIR A;  2A9K B;  4FXQ A;  3BUZ A;  2C8D A;  4H0Y A;  1QS2 A;  4XSG B;  1QS1 A;  4PKU A;  4PKV A;  1GXZ A;  4PKS A;  1YQY A; 
#chains in the Genus database with same CATH topology
 1OG1 A;  4PKT A;  1GY0 A;  4WF6 A;  1PWU A;  4GY2 A;  1OJZ A;  4GF1 A;  2WN4 A;  2C8G A;  2J3X A;  2GWL A;  4H0V A;  1G24 A;  2J3Z A;  2C8H A;  4DV8 A;  1J7N A;  3NTS A;  2WN7 A;  2WN6 A;  1OJQ A;  2WN5 A;  5GTT A;  3U0J A;  4XM6 A;  4ELN A;  4H0X A;  1PWW A;  3BW8 A;  2C8F E;  1GZF A;  1JKY A;  4XM8 A;  4H0T A;  4PKW A;  1GZE A;  4H03 A;  4FK7 A;  1PWV A;  5H03 A;  1PWP A;  1ZXV A;  1UZI A;  1GIQ A;  2C8A A;  1OG3 A;  2BOV B;  5BWM B;  5D1U A;  1R4B A;  1OG4 A;  2WN8 A;  4PKR A;  5DZQ A;  1GXY A;  2C8B X;  5D1S A;  2C89 A;  2GWM A;  2C8E E;  2J3V A;  1R45 A;  4TR5 A;  2A78 B;  4XM7 A;  5H04 A;  4PKQ A;  1PWQ A;  2C8C A;  4XSH B;  5D1T A;  4FML A;  1GIR A;  2A9K B;  4FXQ A;  3BUZ A;  2C8D A;  4H0Y A;  1QS2 A;  4XSG B;  1QS1 A;  4PKU A;  4PKV A;  1GXZ A;  4PKS A;  1YQY A; 
#chains in the Genus database with same CATH homology
 1OG1 A;  4PKT A;  1GY0 A;  4WF6 A;  1PWU A;  4GY2 A;  1OJZ A;  4GF1 A;  2WN4 A;  2C8G A;  2J3X A;  2GWL A;  4H0V A;  1G24 A;  2J3Z A;  2C8H A;  4DV8 A;  1J7N A;  3NTS A;  2WN7 A;  2WN6 A;  1OJQ A;  2WN5 A;  5GTT A;  3U0J A;  4XM6 A;  4ELN A;  4H0X A;  1PWW A;  3BW8 A;  2C8F E;  1GZF A;  1JKY A;  4XM8 A;  4H0T A;  4PKW A;  1GZE A;  4H03 A;  4FK7 A;  1PWV A;  5H03 A;  1PWP A;  1ZXV A;  1UZI A;  1GIQ A;  2C8A A;  1OG3 A;  2BOV B;  5BWM B;  5D1U A;  1R4B A;  1OG4 A;  2WN8 A;  4PKR A;  5DZQ A;  1GXY A;  2C8B X;  5D1S A;  2C89 A;  2GWM A;  2C8E E;  2J3V A;  1R45 A;  4TR5 A;  2A78 B;  4XM7 A;  5H04 A;  4PKQ A;  1PWQ A;  2C8C A;  4XSH B;  5D1T A;  4FML A;  1GIR A;  2A9K B;  4FXQ A;  3BUZ A;  2C8D A;  4H0Y A;  1QS2 A;  4XSG B;  1QS1 A;  4PKU A;  4PKV A;  1GXZ A;  4PKS A;  1YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...