5BWMB

The complex structure of c3cer exoenzyme and gdp bound rhoa (nadh-bound state)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 5bwmB00
3U0JA 4DV8A 2WN4A 1GZEA 3BW8A 4H03A 5D1TA 4H0VA 1QS1A 2C8FE 4GF1A 4XM7A 1OJZA 4FXQA 4H0XA 2A9KB 5GTTA 5D1SA 4FMLA 5DZQA 1YQYA 2J3XA 4GY2A 1GY0A 4PKWA 2J3ZA 4XSHB 5BWMB 4PKQA 5D1UA 2J3VA 4PKTA 4ELNA 4H0TA 1PWPA 3NTSA 4FK7A 1R4BA 2C8DA 1PWVA 1J7NA 4WF6A 1OG4A 4H0YA 4PKSA 1OG3A 1PWWA 2C8GA 2C8EE 1PWUA 2A78B 1GIQA 4XM6A 1GIRA 1PWQA 1OG1A 4XSGB 4PKUA 1G24A 2WN5A 2C89A 1R45A 3BUZA 2C8CA 2C8HA 4XM8A 2C8AA 2GWLA 4PKVA 1GXYA 1GZFA 2WN6A 1GXZA 1ZXVA 5H04A 1JKYA 2WN7A 2GWMA 1UZIA 4TR5A 4PKRA 2C8BX 2WN8A 2BOVB 1QS2A 5H03A 1OJQA
chains in the Genus database with same CATH superfamily
3U0JA 4DV8A 2WN4A 1GZEA 3BW8A 4H03A 5D1TA 4H0VA 1QS1A 2C8FE 4GF1A 4XM7A 1OJZA 4FXQA 4H0XA 2A9KB 5GTTA 5D1SA 4FMLA 5DZQA 1YQYA 2J3XA 4GY2A 1GY0A 4PKWA 2J3ZA 4XSHB 5BWMB 4PKQA 5D1UA 2J3VA 4PKTA 4ELNA 4H0TA 1PWPA 3NTSA 4FK7A 1R4BA 2C8DA 1PWVA 1J7NA 4WF6A 1OG4A 4H0YA 4PKSA 1OG3A 1PWWA 2C8GA 2C8EE 1PWUA 2A78B 1GIQA 4XM6A 1GIRA 1PWQA 1OG1A 4XSGB 4PKUA 1G24A 2WN5A 2C89A 1R45A 3BUZA 2C8CA 2C8HA 4XM8A 2C8AA 2GWLA 4PKVA 1GXYA 1GZFA 2WN6A 1GXZA 1ZXVA 5H04A 1JKYA 2WN7A 2GWMA 1UZIA 4TR5A 4PKRA 2C8BX 2WN8A 2BOVB 1QS2A 5H03A 1OJQA
chains in the Genus database with same CATH topology
3U0JA 4DV8A 2WN4A 1GZEA 3BW8A 4H03A 5D1TA 4H0VA 1QS1A 2C8FE 4GF1A 4XM7A 1OJZA 4FXQA 4H0XA 2A9KB 5GTTA 5D1SA 4FMLA 5DZQA 1YQYA 2J3XA 4GY2A 1GY0A 4PKWA 2J3ZA 4XSHB 5BWMB 4PKQA 5D1UA 2J3VA 4PKTA 4ELNA 4H0TA 1PWPA 3NTSA 4FK7A 1R4BA 2C8DA 1PWVA 1J7NA 4WF6A 1OG4A 4H0YA 4PKSA 1OG3A 1PWWA 2C8GA 2C8EE 1PWUA 2A78B 1GIQA 4XM6A 1GIRA 1PWQA 1OG1A 4XSGB 4PKUA 1G24A 2WN5A 2C89A 1R45A 3BUZA 2C8CA 2C8HA 4XM8A 2C8AA 2GWLA 4PKVA 1GXYA 1GZFA 2WN6A 1GXZA 1ZXVA 5H04A 1JKYA 2WN7A 2GWMA 1UZIA 4TR5A 4PKRA 2C8BX 2WN8A 2BOVB 1QS2A 5H03A 1OJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U0J A;  4DV8 A;  2WN4 A;  1GZE A;  3BW8 A;  4H03 A;  5D1T A;  4H0V A;  1QS1 A;  2C8F E;  4GF1 A;  4XM7 A;  1OJZ A;  4FXQ A;  4H0X A;  2A9K B;  5GTT A;  5D1S A;  4FML A;  5DZQ A;  1YQY A;  2J3X A;  4GY2 A;  1GY0 A;  4PKW A;  2J3Z A;  4XSH B;  5BWM B;  4PKQ A;  5D1U A;  2J3V A;  4PKT A;  4ELN A;  4H0T A;  1PWP A;  3NTS A;  4FK7 A;  1R4B A;  2C8D A;  1PWV A;  1J7N A;  4WF6 A;  1OG4 A;  4H0Y A;  4PKS A;  1OG3 A;  1PWW A;  2C8G A;  2C8E E;  1PWU A;  2A78 B;  1GIQ A;  4XM6 A;  1GIR A;  1PWQ A;  1OG1 A;  4XSG B;  4PKU A;  1G24 A;  2WN5 A;  2C89 A;  1R45 A;  3BUZ A;  2C8C A;  2C8H A;  4XM8 A;  2C8A A;  2GWL A;  4PKV A;  1GXY A;  1GZF A;  2WN6 A;  1GXZ A;  1ZXV A;  5H04 A;  1JKY A;  2WN7 A;  2GWM A;  1UZI A;  4TR5 A;  4PKR A;  2C8B X;  2WN8 A;  2BOV B;  1QS2 A;  5H03 A;  1OJQ A; 
#chains in the Genus database with same CATH topology
 3U0J A;  4DV8 A;  2WN4 A;  1GZE A;  3BW8 A;  4H03 A;  5D1T A;  4H0V A;  1QS1 A;  2C8F E;  4GF1 A;  4XM7 A;  1OJZ A;  4FXQ A;  4H0X A;  2A9K B;  5GTT A;  5D1S A;  4FML A;  5DZQ A;  1YQY A;  2J3X A;  4GY2 A;  1GY0 A;  4PKW A;  2J3Z A;  4XSH B;  5BWM B;  4PKQ A;  5D1U A;  2J3V A;  4PKT A;  4ELN A;  4H0T A;  1PWP A;  3NTS A;  4FK7 A;  1R4B A;  2C8D A;  1PWV A;  1J7N A;  4WF6 A;  1OG4 A;  4H0Y A;  4PKS A;  1OG3 A;  1PWW A;  2C8G A;  2C8E E;  1PWU A;  2A78 B;  1GIQ A;  4XM6 A;  1GIR A;  1PWQ A;  1OG1 A;  4XSG B;  4PKU A;  1G24 A;  2WN5 A;  2C89 A;  1R45 A;  3BUZ A;  2C8C A;  2C8H A;  4XM8 A;  2C8A A;  2GWL A;  4PKV A;  1GXY A;  1GZF A;  2WN6 A;  1GXZ A;  1ZXV A;  5H04 A;  1JKY A;  2WN7 A;  2GWM A;  1UZI A;  4TR5 A;  4PKR A;  2C8B X;  2WN8 A;  2BOV B;  1QS2 A;  5H03 A;  1OJQ A; 
#chains in the Genus database with same CATH homology
 3U0J A;  4DV8 A;  2WN4 A;  1GZE A;  3BW8 A;  4H03 A;  5D1T A;  4H0V A;  1QS1 A;  2C8F E;  4GF1 A;  4XM7 A;  1OJZ A;  4FXQ A;  4H0X A;  2A9K B;  5GTT A;  5D1S A;  4FML A;  5DZQ A;  1YQY A;  2J3X A;  4GY2 A;  1GY0 A;  4PKW A;  2J3Z A;  4XSH B;  5BWM B;  4PKQ A;  5D1U A;  2J3V A;  4PKT A;  4ELN A;  4H0T A;  1PWP A;  3NTS A;  4FK7 A;  1R4B A;  2C8D A;  1PWV A;  1J7N A;  4WF6 A;  1OG4 A;  4H0Y A;  4PKS A;  1OG3 A;  1PWW A;  2C8G A;  2C8E E;  1PWU A;  2A78 B;  1GIQ A;  4XM6 A;  1GIR A;  1PWQ A;  1OG1 A;  4XSG B;  4PKU A;  1G24 A;  2WN5 A;  2C89 A;  1R45 A;  3BUZ A;  2C8C A;  2C8H A;  4XM8 A;  2C8A A;  2GWL A;  4PKV A;  1GXY A;  1GZF A;  2WN6 A;  1GXZ A;  1ZXV A;  5H04 A;  1JKY A;  2WN7 A;  2GWM A;  1UZI A;  4TR5 A;  4PKR A;  2C8B X;  2WN8 A;  2BOV B;  1QS2 A;  5H03 A;  1OJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...