1R45A

Adp-ribosyltransferase c3bot2 from clostridium botulinum, triclinic form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
DTFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal structure of ADP-ribosyltransferase C3bot2 from Clostridium botulinum
rcsb
source organism Clostridium phage c-st
molecule tags Transferase
total genus 67
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r45A00
4FXQA 1OG3A 4PKRA 1OJQA 3BUZA 4XM6A 4GF1A 4XM8A 1R45A 2WN4A 2C8CA 1PWQA 5D1UA 2J3XA 3BW8A 3NTSA 2GWMA 1QS2A 1PWPA 1GZFA 4FMLA 2A9KB 1GIRA 2C89A 4ELNA 1OG4A 4GY2A 5H04A 2A78B 4H03A 4PKSA 1G24A 4H0VA 5D1TA 4DV8A 2C8HA 1GXYA 1PWWA 4WF6A 4H0YA 4PKVA 2C8DA 1ZXVA 4PKWA 1YQYA 2C8AA 2WN6A 4PKQA 2WN7A 2C8FE 1OJZA 5DZQA 1R4BA 2C8EE 5H03A 1GY0A 2C8BX 1PWUA 4TR5A 5GTTA 1J7NA 4H0XA 2J3ZA 4XSGB 1OG1A 1JKYA 2J3VA 3U0JA 2C8GA 1QS1A 4FK7A 4PKTA 4XM7A 5D1SA 1GZEA 4XSHB 2WN8A 4PKUA 4H0TA 5BWMB 1GIQA 1PWVA 2WN5A 1GXZA 2BOVB 2GWLA 1UZIA
chains in the Genus database with same CATH superfamily
4FXQA 1OG3A 4PKRA 1OJQA 3BUZA 4XM6A 4GF1A 4XM8A 1R45A 2WN4A 2C8CA 1PWQA 5D1UA 2J3XA 3BW8A 3NTSA 2GWMA 1QS2A 1PWPA 1GZFA 4FMLA 2A9KB 1GIRA 2C89A 4ELNA 1OG4A 4GY2A 5H04A 2A78B 4H03A 4PKSA 1G24A 4H0VA 5D1TA 4DV8A 2C8HA 1GXYA 1PWWA 4WF6A 4H0YA 4PKVA 2C8DA 1ZXVA 4PKWA 1YQYA 2C8AA 2WN6A 4PKQA 2WN7A 2C8FE 1OJZA 5DZQA 1R4BA 2C8EE 5H03A 1GY0A 2C8BX 1PWUA 4TR5A 5GTTA 1J7NA 4H0XA 2J3ZA 4XSGB 1OG1A 1JKYA 2J3VA 3U0JA 2C8GA 1QS1A 4FK7A 4PKTA 4XM7A 5D1SA 1GZEA 4XSHB 2WN8A 4PKUA 4H0TA 5BWMB 1GIQA 1PWVA 2WN5A 1GXZA 2BOVB 2GWLA 1UZIA
chains in the Genus database with same CATH topology
4FXQA 1OG3A 4PKRA 1OJQA 3BUZA 4XM6A 4GF1A 4XM8A 1R45A 2WN4A 2C8CA 1PWQA 5D1UA 2J3XA 3BW8A 3NTSA 2GWMA 1QS2A 1PWPA 1GZFA 4FMLA 2A9KB 1GIRA 2C89A 4ELNA 1OG4A 4GY2A 5H04A 2A78B 4H03A 4PKSA 1G24A 4H0VA 5D1TA 4DV8A 2C8HA 1GXYA 1PWWA 4WF6A 4H0YA 4PKVA 2C8DA 1ZXVA 4PKWA 1YQYA 2C8AA 2WN6A 4PKQA 2WN7A 2C8FE 1OJZA 5DZQA 1R4BA 2C8EE 5H03A 1GY0A 2C8BX 1PWUA 4TR5A 5GTTA 1J7NA 4H0XA 2J3ZA 4XSGB 1OG1A 1JKYA 2J3VA 3U0JA 2C8GA 1QS1A 4FK7A 4PKTA 4XM7A 5D1SA 1GZEA 4XSHB 2WN8A 4PKUA 4H0TA 5BWMB 1GIQA 1PWVA 2WN5A 1GXZA 2BOVB 2GWLA 1UZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXQ A;  1OG3 A;  4PKR A;  1OJQ A;  3BUZ A;  4XM6 A;  4GF1 A;  4XM8 A;  1R45 A;  2WN4 A;  2C8C A;  1PWQ A;  5D1U A;  2J3X A;  3BW8 A;  3NTS A;  2GWM A;  1QS2 A;  1PWP A;  1GZF A;  4FML A;  2A9K B;  1GIR A;  2C89 A;  4ELN A;  1OG4 A;  4GY2 A;  5H04 A;  2A78 B;  4H03 A;  4PKS A;  1G24 A;  4H0V A;  5D1T A;  4DV8 A;  2C8H A;  1GXY A;  1PWW A;  4WF6 A;  4H0Y A;  4PKV A;  2C8D A;  1ZXV A;  4PKW A;  1YQY A;  2C8A A;  2WN6 A;  4PKQ A;  2WN7 A;  2C8F E;  1OJZ A;  5DZQ A;  1R4B A;  2C8E E;  5H03 A;  1GY0 A;  2C8B X;  1PWU A;  4TR5 A;  5GTT A;  1J7N A;  4H0X A;  2J3Z A;  4XSG B;  1OG1 A;  1JKY A;  2J3V A;  3U0J A;  2C8G A;  1QS1 A;  4FK7 A;  4PKT A;  4XM7 A;  5D1S A;  1GZE A;  4XSH B;  2WN8 A;  4PKU A;  4H0T A;  5BWM B;  1GIQ A;  1PWV A;  2WN5 A;  1GXZ A;  2BOV B;  2GWL A;  1UZI A; 
#chains in the Genus database with same CATH topology
 4FXQ A;  1OG3 A;  4PKR A;  1OJQ A;  3BUZ A;  4XM6 A;  4GF1 A;  4XM8 A;  1R45 A;  2WN4 A;  2C8C A;  1PWQ A;  5D1U A;  2J3X A;  3BW8 A;  3NTS A;  2GWM A;  1QS2 A;  1PWP A;  1GZF A;  4FML A;  2A9K B;  1GIR A;  2C89 A;  4ELN A;  1OG4 A;  4GY2 A;  5H04 A;  2A78 B;  4H03 A;  4PKS A;  1G24 A;  4H0V A;  5D1T A;  4DV8 A;  2C8H A;  1GXY A;  1PWW A;  4WF6 A;  4H0Y A;  4PKV A;  2C8D A;  1ZXV A;  4PKW A;  1YQY A;  2C8A A;  2WN6 A;  4PKQ A;  2WN7 A;  2C8F E;  1OJZ A;  5DZQ A;  1R4B A;  2C8E E;  5H03 A;  1GY0 A;  2C8B X;  1PWU A;  4TR5 A;  5GTT A;  1J7N A;  4H0X A;  2J3Z A;  4XSG B;  1OG1 A;  1JKY A;  2J3V A;  3U0J A;  2C8G A;  1QS1 A;  4FK7 A;  4PKT A;  4XM7 A;  5D1S A;  1GZE A;  4XSH B;  2WN8 A;  4PKU A;  4H0T A;  5BWM B;  1GIQ A;  1PWV A;  2WN5 A;  1GXZ A;  2BOV B;  2GWL A;  1UZI A; 
#chains in the Genus database with same CATH homology
 4FXQ A;  1OG3 A;  4PKR A;  1OJQ A;  3BUZ A;  4XM6 A;  4GF1 A;  4XM8 A;  1R45 A;  2WN4 A;  2C8C A;  1PWQ A;  5D1U A;  2J3X A;  3BW8 A;  3NTS A;  2GWM A;  1QS2 A;  1PWP A;  1GZF A;  4FML A;  2A9K B;  1GIR A;  2C89 A;  4ELN A;  1OG4 A;  4GY2 A;  5H04 A;  2A78 B;  4H03 A;  4PKS A;  1G24 A;  4H0V A;  5D1T A;  4DV8 A;  2C8H A;  1GXY A;  1PWW A;  4WF6 A;  4H0Y A;  4PKV A;  2C8D A;  1ZXV A;  4PKW A;  1YQY A;  2C8A A;  2WN6 A;  4PKQ A;  2WN7 A;  2C8F E;  1OJZ A;  5DZQ A;  1R4B A;  2C8E E;  5H03 A;  1GY0 A;  2C8B X;  1PWU A;  4TR5 A;  5GTT A;  1J7N A;  4H0X A;  2J3Z A;  4XSG B;  1OG1 A;  1JKY A;  2J3V A;  3U0J A;  2C8G A;  1QS1 A;  4FK7 A;  4PKT A;  4XM7 A;  5D1S A;  1GZE A;  4XSH B;  2WN8 A;  4PKU A;  4H0T A;  5BWM B;  1GIQ A;  1PWV A;  2WN5 A;  1GXZ A;  2BOV B;  2GWL A;  1UZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...