1R45A

Adp-ribosyltransferase c3bot2 from clostridium botulinum, triclinic form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
DTFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal structure of ADP-ribosyltransferase C3bot2 from Clostridium botulinum
rcsb
source organism Clostridium phage c-st
molecule tags Transferase
total genus 67
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r45A00
2C8AA 4PKVA 2C8GA 5H03A 1R4BA 1J7NA 5H04A 1GIQA 4DV8A 2A9KB 4H0TA 5DZQA 2C8BX 4XSHB 4H03A 1GZFA 2WN6A 4WF6A 2C8HA 3BUZA 4PKUA 4PKTA 1GXYA 1G24A 3NTSA 1UZIA 1GXZA 1GY0A 3U0JA 1PWVA 2WN4A 1R45A 3BW8A 5D1UA 2C89A 1YQYA 4XM6A 1QS1A 4H0VA 1OG3A 2J3VA 4GF1A 4H0YA 2WN8A 4XM8A 4PKRA 2J3ZA 2A78B 4XM7A 4PKWA 1OG4A 4FK7A 4FMLA 2J3XA 1GIRA 2WN5A 1PWWA 1PWQA 1OJZA 2C8CA 4H0XA 1GZEA 4ELNA 5BWMB 2C8DA 4XSGB 1PWPA 4TR5A 1ZXVA 2C8EE 1OG1A 1PWUA 2BOVB 5GTTA 5D1TA 2GWMA 5D1SA 1OJQA 2C8FE 4FXQA 4PKQA 4GY2A 1QS2A 1JKYA 2WN7A 4PKSA 2GWLA
chains in the Genus database with same CATH superfamily
2C8AA 4PKVA 2C8GA 5H03A 1R4BA 1J7NA 5H04A 1GIQA 4DV8A 2A9KB 4H0TA 5DZQA 2C8BX 4XSHB 4H03A 1GZFA 2WN6A 4WF6A 2C8HA 3BUZA 4PKUA 4PKTA 1GXYA 1G24A 3NTSA 1UZIA 1GXZA 1GY0A 3U0JA 1PWVA 2WN4A 1R45A 3BW8A 5D1UA 2C89A 1YQYA 4XM6A 1QS1A 4H0VA 1OG3A 2J3VA 4GF1A 4H0YA 2WN8A 4XM8A 4PKRA 2J3ZA 2A78B 4XM7A 4PKWA 1OG4A 4FK7A 4FMLA 2J3XA 1GIRA 2WN5A 1PWWA 1PWQA 1OJZA 2C8CA 4H0XA 1GZEA 4ELNA 5BWMB 2C8DA 4XSGB 1PWPA 4TR5A 1ZXVA 2C8EE 1OG1A 1PWUA 2BOVB 5GTTA 5D1TA 2GWMA 5D1SA 1OJQA 2C8FE 4FXQA 4PKQA 4GY2A 1QS2A 1JKYA 2WN7A 4PKSA 2GWLA
chains in the Genus database with same CATH topology
2C8AA 4PKVA 2C8GA 5H03A 1R4BA 1J7NA 5H04A 1GIQA 4DV8A 2A9KB 4H0TA 5DZQA 2C8BX 4XSHB 4H03A 1GZFA 2WN6A 4WF6A 2C8HA 3BUZA 4PKUA 4PKTA 1GXYA 1G24A 3NTSA 1UZIA 1GXZA 1GY0A 3U0JA 1PWVA 2WN4A 1R45A 3BW8A 5D1UA 2C89A 1YQYA 4XM6A 1QS1A 4H0VA 1OG3A 2J3VA 4GF1A 4H0YA 2WN8A 4XM8A 4PKRA 2J3ZA 2A78B 4XM7A 4PKWA 1OG4A 4FK7A 4FMLA 2J3XA 1GIRA 2WN5A 1PWWA 1PWQA 1OJZA 2C8CA 4H0XA 1GZEA 4ELNA 5BWMB 2C8DA 4XSGB 1PWPA 4TR5A 1ZXVA 2C8EE 1OG1A 1PWUA 2BOVB 5GTTA 5D1TA 2GWMA 5D1SA 1OJQA 2C8FE 4FXQA 4PKQA 4GY2A 1QS2A 1JKYA 2WN7A 4PKSA 2GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8A A;  4PKV A;  2C8G A;  5H03 A;  1R4B A;  1J7N A;  5H04 A;  1GIQ A;  4DV8 A;  2A9K B;  4H0T A;  5DZQ A;  2C8B X;  4XSH B;  4H03 A;  1GZF A;  2WN6 A;  4WF6 A;  2C8H A;  3BUZ A;  4PKU A;  4PKT A;  1GXY A;  1G24 A;  3NTS A;  1UZI A;  1GXZ A;  1GY0 A;  3U0J A;  1PWV A;  2WN4 A;  1R45 A;  3BW8 A;  5D1U A;  2C89 A;  1YQY A;  4XM6 A;  1QS1 A;  4H0V A;  1OG3 A;  2J3V A;  4GF1 A;  4H0Y A;  2WN8 A;  4XM8 A;  4PKR A;  2J3Z A;  2A78 B;  4XM7 A;  4PKW A;  1OG4 A;  4FK7 A;  4FML A;  2J3X A;  1GIR A;  2WN5 A;  1PWW A;  1PWQ A;  1OJZ A;  2C8C A;  4H0X A;  1GZE A;  4ELN A;  5BWM B;  2C8D A;  4XSG B;  1PWP A;  4TR5 A;  1ZXV A;  2C8E E;  1OG1 A;  1PWU A;  2BOV B;  5GTT A;  5D1T A;  2GWM A;  5D1S A;  1OJQ A;  2C8F E;  4FXQ A;  4PKQ A;  4GY2 A;  1QS2 A;  1JKY A;  2WN7 A;  4PKS A;  2GWL A; 
#chains in the Genus database with same CATH topology
 2C8A A;  4PKV A;  2C8G A;  5H03 A;  1R4B A;  1J7N A;  5H04 A;  1GIQ A;  4DV8 A;  2A9K B;  4H0T A;  5DZQ A;  2C8B X;  4XSH B;  4H03 A;  1GZF A;  2WN6 A;  4WF6 A;  2C8H A;  3BUZ A;  4PKU A;  4PKT A;  1GXY A;  1G24 A;  3NTS A;  1UZI A;  1GXZ A;  1GY0 A;  3U0J A;  1PWV A;  2WN4 A;  1R45 A;  3BW8 A;  5D1U A;  2C89 A;  1YQY A;  4XM6 A;  1QS1 A;  4H0V A;  1OG3 A;  2J3V A;  4GF1 A;  4H0Y A;  2WN8 A;  4XM8 A;  4PKR A;  2J3Z A;  2A78 B;  4XM7 A;  4PKW A;  1OG4 A;  4FK7 A;  4FML A;  2J3X A;  1GIR A;  2WN5 A;  1PWW A;  1PWQ A;  1OJZ A;  2C8C A;  4H0X A;  1GZE A;  4ELN A;  5BWM B;  2C8D A;  4XSG B;  1PWP A;  4TR5 A;  1ZXV A;  2C8E E;  1OG1 A;  1PWU A;  2BOV B;  5GTT A;  5D1T A;  2GWM A;  5D1S A;  1OJQ A;  2C8F E;  4FXQ A;  4PKQ A;  4GY2 A;  1QS2 A;  1JKY A;  2WN7 A;  4PKS A;  2GWL A; 
#chains in the Genus database with same CATH homology
 2C8A A;  4PKV A;  2C8G A;  5H03 A;  1R4B A;  1J7N A;  5H04 A;  1GIQ A;  4DV8 A;  2A9K B;  4H0T A;  5DZQ A;  2C8B X;  4XSH B;  4H03 A;  1GZF A;  2WN6 A;  4WF6 A;  2C8H A;  3BUZ A;  4PKU A;  4PKT A;  1GXY A;  1G24 A;  3NTS A;  1UZI A;  1GXZ A;  1GY0 A;  3U0J A;  1PWV A;  2WN4 A;  1R45 A;  3BW8 A;  5D1U A;  2C89 A;  1YQY A;  4XM6 A;  1QS1 A;  4H0V A;  1OG3 A;  2J3V A;  4GF1 A;  4H0Y A;  2WN8 A;  4XM8 A;  4PKR A;  2J3Z A;  2A78 B;  4XM7 A;  4PKW A;  1OG4 A;  4FK7 A;  4FML A;  2J3X A;  1GIR A;  2WN5 A;  1PWW A;  1PWQ A;  1OJZ A;  2C8C A;  4H0X A;  1GZE A;  4ELN A;  5BWM B;  2C8D A;  4XSG B;  1PWP A;  4TR5 A;  1ZXV A;  2C8E E;  1OG1 A;  1PWU A;  2BOV B;  5GTT A;  5D1T A;  2GWM A;  5D1S A;  1OJQ A;  2C8F E;  4FXQ A;  4PKQ A;  4GY2 A;  1QS2 A;  1JKY A;  2WN7 A;  4PKS A;  2GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...