1R45A

Adp-ribosyltransferase c3bot2 from clostridium botulinum, triclinic form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
201
Chain Sequence
DTFTEFTNVEEAKKWGNAQYKKYGLSKPEQEAIKFYTRDASKINGPLRANQGNENGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQFGGRPIVTKFKVTNGSKGGYIDPISYFPGQLEVLLPRNNSYYISDMQISPNNRQIMITAMIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mono-ADP-ribosyltransferase C3
publication title Crystal structure of ADP-ribosyltransferase C3bot2 from Clostridium botulinum
rcsb
source organism Clostridium phage c-st
total genus 67
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1r45A00
2C89A 1QS2A 4XSHB 5D1SA 4H0YA 1PWWA 2WN6A 2C8GA 4PKTA 1PWUA 5GTTA 5H04A 1OJZA 1PWPA 4XSGB 1PWVA 2A9KB 4TR5A 1GIQA 4XM6A 1OG1A 1J7NA 1G24A 1GXZA 2WN4A 4PKSA 5DZQA 1OG4A 2BOVB 1GZEA 4ELNA 4FK7A 2C8DA 4DV8A 2C8AA 1ZXVA 1GZFA 2WN5A 3U0JA 1OG3A 2C8HA 2C8EE 4PKVA 1QS1A 1GXYA 2C8CA 4H0TA 1JKYA 3NTSA 4PKWA 3BW8A 5BWMB 1GY0A 2C8FE 2GWLA 5D1TA 2WN8A 4H0XA 4XM8A 4H0VA 2GWMA 1R45A 1R4BA 4XM7A 4GF1A 4FXQA 3BUZA 5D1UA 5H03A 2J3XA 1GIRA 2J3VA 4PKRA 4PKUA 2C8BX 4H03A 1OJQA 1UZIA 1YQYA 4FMLA 2J3ZA 4GY2A 4PKQA 2WN7A 1PWQA 4WF6A 2A78B
chains in the Genus database with same CATH superfamily
2C89A 1QS2A 4XSHB 5D1SA 4H0YA 1PWWA 2WN6A 2C8GA 4PKTA 1PWUA 5GTTA 5H04A 1OJZA 1PWPA 4XSGB 1PWVA 2A9KB 4TR5A 1GIQA 4XM6A 1OG1A 1J7NA 1G24A 1GXZA 2WN4A 4PKSA 5DZQA 1OG4A 2BOVB 1GZEA 4ELNA 4FK7A 2C8DA 4DV8A 2C8AA 1ZXVA 1GZFA 2WN5A 3U0JA 1OG3A 2C8HA 2C8EE 4PKVA 1QS1A 1GXYA 2C8CA 4H0TA 1JKYA 3NTSA 4PKWA 3BW8A 5BWMB 1GY0A 2C8FE 2GWLA 5D1TA 2WN8A 4H0XA 4XM8A 4H0VA 2GWMA 1R45A 1R4BA 4XM7A 4GF1A 4FXQA 3BUZA 5D1UA 5H03A 2J3XA 1GIRA 2J3VA 4PKRA 4PKUA 2C8BX 4H03A 1OJQA 1UZIA 1YQYA 4FMLA 2J3ZA 4GY2A 4PKQA 2WN7A 1PWQA 4WF6A 2A78B
chains in the Genus database with same CATH topology
2C89A 1QS2A 4XSHB 5D1SA 4H0YA 1PWWA 2WN6A 2C8GA 4PKTA 1PWUA 5GTTA 5H04A 1OJZA 1PWPA 4XSGB 1PWVA 2A9KB 4TR5A 1GIQA 4XM6A 1OG1A 1J7NA 1G24A 1GXZA 2WN4A 4PKSA 5DZQA 1OG4A 2BOVB 1GZEA 4ELNA 4FK7A 2C8DA 4DV8A 2C8AA 1ZXVA 1GZFA 2WN5A 3U0JA 1OG3A 2C8HA 2C8EE 4PKVA 1QS1A 1GXYA 2C8CA 4H0TA 1JKYA 3NTSA 4PKWA 3BW8A 5BWMB 1GY0A 2C8FE 2GWLA 5D1TA 2WN8A 4H0XA 4XM8A 4H0VA 2GWMA 1R45A 1R4BA 4XM7A 4GF1A 4FXQA 3BUZA 5D1UA 5H03A 2J3XA 1GIRA 2J3VA 4PKRA 4PKUA 2C8BX 4H03A 1OJQA 1UZIA 1YQYA 4FMLA 2J3ZA 4GY2A 4PKQA 2WN7A 1PWQA 4WF6A 2A78B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C89 A;  1QS2 A;  4XSH B;  5D1S A;  4H0Y A;  1PWW A;  2WN6 A;  2C8G A;  4PKT A;  1PWU A;  5GTT A;  5H04 A;  1OJZ A;  1PWP A;  4XSG B;  1PWV A;  2A9K B;  4TR5 A;  1GIQ A;  4XM6 A;  1OG1 A;  1J7N A;  1G24 A;  1GXZ A;  2WN4 A;  4PKS A;  5DZQ A;  1OG4 A;  2BOV B;  1GZE A;  4ELN A;  4FK7 A;  2C8D A;  4DV8 A;  2C8A A;  1ZXV A;  1GZF A;  2WN5 A;  3U0J A;  1OG3 A;  2C8H A;  2C8E E;  4PKV A;  1QS1 A;  1GXY A;  2C8C A;  4H0T A;  1JKY A;  3NTS A;  4PKW A;  3BW8 A;  5BWM B;  1GY0 A;  2C8F E;  2GWL A;  5D1T A;  2WN8 A;  4H0X A;  4XM8 A;  4H0V A;  2GWM A;  1R45 A;  1R4B A;  4XM7 A;  4GF1 A;  4FXQ A;  3BUZ A;  5D1U A;  5H03 A;  2J3X A;  1GIR A;  2J3V A;  4PKR A;  4PKU A;  2C8B X;  4H03 A;  1OJQ A;  1UZI A;  1YQY A;  4FML A;  2J3Z A;  4GY2 A;  4PKQ A;  2WN7 A;  1PWQ A;  4WF6 A;  2A78 B; 
#chains in the Genus database with same CATH topology
 2C89 A;  1QS2 A;  4XSH B;  5D1S A;  4H0Y A;  1PWW A;  2WN6 A;  2C8G A;  4PKT A;  1PWU A;  5GTT A;  5H04 A;  1OJZ A;  1PWP A;  4XSG B;  1PWV A;  2A9K B;  4TR5 A;  1GIQ A;  4XM6 A;  1OG1 A;  1J7N A;  1G24 A;  1GXZ A;  2WN4 A;  4PKS A;  5DZQ A;  1OG4 A;  2BOV B;  1GZE A;  4ELN A;  4FK7 A;  2C8D A;  4DV8 A;  2C8A A;  1ZXV A;  1GZF A;  2WN5 A;  3U0J A;  1OG3 A;  2C8H A;  2C8E E;  4PKV A;  1QS1 A;  1GXY A;  2C8C A;  4H0T A;  1JKY A;  3NTS A;  4PKW A;  3BW8 A;  5BWM B;  1GY0 A;  2C8F E;  2GWL A;  5D1T A;  2WN8 A;  4H0X A;  4XM8 A;  4H0V A;  2GWM A;  1R45 A;  1R4B A;  4XM7 A;  4GF1 A;  4FXQ A;  3BUZ A;  5D1U A;  5H03 A;  2J3X A;  1GIR A;  2J3V A;  4PKR A;  4PKU A;  2C8B X;  4H03 A;  1OJQ A;  1UZI A;  1YQY A;  4FML A;  2J3Z A;  4GY2 A;  4PKQ A;  2WN7 A;  1PWQ A;  4WF6 A;  2A78 B; 
#chains in the Genus database with same CATH homology
 2C89 A;  1QS2 A;  4XSH B;  5D1S A;  4H0Y A;  1PWW A;  2WN6 A;  2C8G A;  4PKT A;  1PWU A;  5GTT A;  5H04 A;  1OJZ A;  1PWP A;  4XSG B;  1PWV A;  2A9K B;  4TR5 A;  1GIQ A;  4XM6 A;  1OG1 A;  1J7N A;  1G24 A;  1GXZ A;  2WN4 A;  4PKS A;  5DZQ A;  1OG4 A;  2BOV B;  1GZE A;  4ELN A;  4FK7 A;  2C8D A;  4DV8 A;  2C8A A;  1ZXV A;  1GZF A;  2WN5 A;  3U0J A;  1OG3 A;  2C8H A;  2C8E E;  4PKV A;  1QS1 A;  1GXY A;  2C8C A;  4H0T A;  1JKY A;  3NTS A;  4PKW A;  3BW8 A;  5BWM B;  1GY0 A;  2C8F E;  2GWL A;  5D1T A;  2WN8 A;  4H0X A;  4XM8 A;  4H0V A;  2GWM A;  1R45 A;  1R4B A;  4XM7 A;  4GF1 A;  4FXQ A;  3BUZ A;  5D1U A;  5H03 A;  2J3X A;  1GIR A;  2J3V A;  4PKR A;  4PKU A;  2C8B X;  4H03 A;  1OJQ A;  1UZI A;  1YQY A;  4FML A;  2J3Z A;  4GY2 A;  4PKQ A;  2WN7 A;  1PWQ A;  4WF6 A;  2A78 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...