4XSGB

The complex structure of c3cer exoenzyme and gtp bound rhoa (nadh-free state)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 67
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4xsgB00
1PWPA 1PWQA 4DV8A 2A78B 2C8FE 5D1UA 3U0JA 5GTTA 1R45A 1R4BA 4XM8A 2J3ZA 5BWMB 4H0YA 2C8BX 4GF1A 4XM6A 1GZEA 2C8HA 5D1SA 4PKQA 1GXZA 4TR5A 4H0XA 3BW8A 2C8EE 1OG3A 1YQYA 4XSGB 4PKTA 4PKUA 1ZXVA 4XSHB 1JKYA 4H0TA 1UZIA 2J3XA 2C8DA 2WN7A 1G24A 4XM7A 1OG4A 5D1TA 1GIQA 2J3VA 1GZFA 2BOVB 2GWMA 4FK7A 3BUZA 1OJQA 1GIRA 1GXYA 1J7NA 4FMLA 4PKWA 4WF6A 2WN8A 1PWUA 3NTSA 4ELNA 2C8CA 1OJZA 4H0VA 1QS1A 5H04A 5H03A 4FXQA 2C8AA 1PWWA 2C8GA 2WN4A 2C89A 1QS2A 5DZQA 2A9KB 4PKVA 4PKRA 2WN6A 1OG1A 4PKSA 1PWVA 4H03A 4GY2A 2WN5A 1GY0A 2GWLA
chains in the Genus database with same CATH superfamily
1PWPA 1PWQA 4DV8A 2A78B 2C8FE 5D1UA 3U0JA 5GTTA 1R45A 1R4BA 4XM8A 2J3ZA 5BWMB 4H0YA 2C8BX 4GF1A 4XM6A 1GZEA 2C8HA 5D1SA 4PKQA 1GXZA 4TR5A 4H0XA 3BW8A 2C8EE 1OG3A 1YQYA 4XSGB 4PKTA 4PKUA 1ZXVA 4XSHB 1JKYA 4H0TA 1UZIA 2J3XA 2C8DA 2WN7A 1G24A 4XM7A 1OG4A 5D1TA 1GIQA 2J3VA 1GZFA 2BOVB 2GWMA 4FK7A 3BUZA 1OJQA 1GIRA 1GXYA 1J7NA 4FMLA 4PKWA 4WF6A 2WN8A 1PWUA 3NTSA 4ELNA 2C8CA 1OJZA 4H0VA 1QS1A 5H04A 5H03A 4FXQA 2C8AA 1PWWA 2C8GA 2WN4A 2C89A 1QS2A 5DZQA 2A9KB 4PKVA 4PKRA 2WN6A 1OG1A 4PKSA 1PWVA 4H03A 4GY2A 2WN5A 1GY0A 2GWLA
chains in the Genus database with same CATH topology
1PWPA 1PWQA 4DV8A 2A78B 2C8FE 5D1UA 3U0JA 5GTTA 1R45A 1R4BA 4XM8A 2J3ZA 5BWMB 4H0YA 2C8BX 4GF1A 4XM6A 1GZEA 2C8HA 5D1SA 4PKQA 1GXZA 4TR5A 4H0XA 3BW8A 2C8EE 1OG3A 1YQYA 4XSGB 4PKTA 4PKUA 1ZXVA 4XSHB 1JKYA 4H0TA 1UZIA 2J3XA 2C8DA 2WN7A 1G24A 4XM7A 1OG4A 5D1TA 1GIQA 2J3VA 1GZFA 2BOVB 2GWMA 4FK7A 3BUZA 1OJQA 1GIRA 1GXYA 1J7NA 4FMLA 4PKWA 4WF6A 2WN8A 1PWUA 3NTSA 4ELNA 2C8CA 1OJZA 4H0VA 1QS1A 5H04A 5H03A 4FXQA 2C8AA 1PWWA 2C8GA 2WN4A 2C89A 1QS2A 5DZQA 2A9KB 4PKVA 4PKRA 2WN6A 1OG1A 4PKSA 1PWVA 4H03A 4GY2A 2WN5A 1GY0A 2GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWP A;  1PWQ A;  4DV8 A;  2A78 B;  2C8F E;  5D1U A;  3U0J A;  5GTT A;  1R45 A;  1R4B A;  4XM8 A;  2J3Z A;  5BWM B;  4H0Y A;  2C8B X;  4GF1 A;  4XM6 A;  1GZE A;  2C8H A;  5D1S A;  4PKQ A;  1GXZ A;  4TR5 A;  4H0X A;  3BW8 A;  2C8E E;  1OG3 A;  1YQY A;  4XSG B;  4PKT A;  4PKU A;  1ZXV A;  4XSH B;  1JKY A;  4H0T A;  1UZI A;  2J3X A;  2C8D A;  2WN7 A;  1G24 A;  4XM7 A;  1OG4 A;  5D1T A;  1GIQ A;  2J3V A;  1GZF A;  2BOV B;  2GWM A;  4FK7 A;  3BUZ A;  1OJQ A;  1GIR A;  1GXY A;  1J7N A;  4FML A;  4PKW A;  4WF6 A;  2WN8 A;  1PWU A;  3NTS A;  4ELN A;  2C8C A;  1OJZ A;  4H0V A;  1QS1 A;  5H04 A;  5H03 A;  4FXQ A;  2C8A A;  1PWW A;  2C8G A;  2WN4 A;  2C89 A;  1QS2 A;  5DZQ A;  2A9K B;  4PKV A;  4PKR A;  2WN6 A;  1OG1 A;  4PKS A;  1PWV A;  4H03 A;  4GY2 A;  2WN5 A;  1GY0 A;  2GWL A; 
#chains in the Genus database with same CATH topology
 1PWP A;  1PWQ A;  4DV8 A;  2A78 B;  2C8F E;  5D1U A;  3U0J A;  5GTT A;  1R45 A;  1R4B A;  4XM8 A;  2J3Z A;  5BWM B;  4H0Y A;  2C8B X;  4GF1 A;  4XM6 A;  1GZE A;  2C8H A;  5D1S A;  4PKQ A;  1GXZ A;  4TR5 A;  4H0X A;  3BW8 A;  2C8E E;  1OG3 A;  1YQY A;  4XSG B;  4PKT A;  4PKU A;  1ZXV A;  4XSH B;  1JKY A;  4H0T A;  1UZI A;  2J3X A;  2C8D A;  2WN7 A;  1G24 A;  4XM7 A;  1OG4 A;  5D1T A;  1GIQ A;  2J3V A;  1GZF A;  2BOV B;  2GWM A;  4FK7 A;  3BUZ A;  1OJQ A;  1GIR A;  1GXY A;  1J7N A;  4FML A;  4PKW A;  4WF6 A;  2WN8 A;  1PWU A;  3NTS A;  4ELN A;  2C8C A;  1OJZ A;  4H0V A;  1QS1 A;  5H04 A;  5H03 A;  4FXQ A;  2C8A A;  1PWW A;  2C8G A;  2WN4 A;  2C89 A;  1QS2 A;  5DZQ A;  2A9K B;  4PKV A;  4PKR A;  2WN6 A;  1OG1 A;  4PKS A;  1PWV A;  4H03 A;  4GY2 A;  2WN5 A;  1GY0 A;  2GWL A; 
#chains in the Genus database with same CATH homology
 1PWP A;  1PWQ A;  4DV8 A;  2A78 B;  2C8F E;  5D1U A;  3U0J A;  5GTT A;  1R45 A;  1R4B A;  4XM8 A;  2J3Z A;  5BWM B;  4H0Y A;  2C8B X;  4GF1 A;  4XM6 A;  1GZE A;  2C8H A;  5D1S A;  4PKQ A;  1GXZ A;  4TR5 A;  4H0X A;  3BW8 A;  2C8E E;  1OG3 A;  1YQY A;  4XSG B;  4PKT A;  4PKU A;  1ZXV A;  4XSH B;  1JKY A;  4H0T A;  1UZI A;  2J3X A;  2C8D A;  2WN7 A;  1G24 A;  4XM7 A;  1OG4 A;  5D1T A;  1GIQ A;  2J3V A;  1GZF A;  2BOV B;  2GWM A;  4FK7 A;  3BUZ A;  1OJQ A;  1GIR A;  1GXY A;  1J7N A;  4FML A;  4PKW A;  4WF6 A;  2WN8 A;  1PWU A;  3NTS A;  4ELN A;  2C8C A;  1OJZ A;  4H0V A;  1QS1 A;  5H04 A;  5H03 A;  4FXQ A;  2C8A A;  1PWW A;  2C8G A;  2WN4 A;  2C89 A;  1QS2 A;  5DZQ A;  2A9K B;  4PKV A;  4PKR A;  2WN6 A;  1OG1 A;  4PKS A;  1PWV A;  4H03 A;  4GY2 A;  2WN5 A;  1GY0 A;  2GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...