4XSGB

The complex structure of c3cer exoenzyme and gtp bound rhoa (nadh-free state)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4xsgB00
1GXYA 5H03A 2GWMA 2WN6A 1R4BA 4DV8A 4XM6A 4FMLA 4PKQA 1OG4A 4PKVA 3NTSA 4H0YA 5D1TA 5DZQA 1PWVA 4XSGB 2C8DA 1GIRA 1YQYA 2GWLA 4FXQA 3BUZA 4H0TA 5H04A 1QS1A 1JKYA 1J7NA 1OJQA 1QS2A 1OG3A 5D1SA 4PKUA 4H0VA 4XM7A 1PWWA 1R45A 2J3XA 1G24A 4FK7A 5D1UA 2C8CA 2J3VA 1OJZA 4XSHB 1PWQA 1GZFA 4XM8A 4PKTA 3U0JA 2J3ZA 1ZXVA 2C8HA 2BOVB 2C8GA 4TR5A 1GZEA 2C8FE 2C8BX 2WN8A 2C8EE 1GIQA 2A78B 4GY2A 1UZIA 1OG1A 4PKSA 1GXZA 4H0XA 4H03A 2WN7A 5GTTA 1PWPA 3BW8A 2A9KB 5BWMB 2C8AA 4PKWA 4WF6A 2WN4A 2C89A 4PKRA 2WN5A 1GY0A 4ELNA 4GF1A 1PWUA
chains in the Genus database with same CATH superfamily
1GXYA 5H03A 2GWMA 2WN6A 1R4BA 4DV8A 4XM6A 4FMLA 4PKQA 1OG4A 4PKVA 3NTSA 4H0YA 5D1TA 5DZQA 1PWVA 4XSGB 2C8DA 1GIRA 1YQYA 2GWLA 4FXQA 3BUZA 4H0TA 5H04A 1QS1A 1JKYA 1J7NA 1OJQA 1QS2A 1OG3A 5D1SA 4PKUA 4H0VA 4XM7A 1PWWA 1R45A 2J3XA 1G24A 4FK7A 5D1UA 2C8CA 2J3VA 1OJZA 4XSHB 1PWQA 1GZFA 4XM8A 4PKTA 3U0JA 2J3ZA 1ZXVA 2C8HA 2BOVB 2C8GA 4TR5A 1GZEA 2C8FE 2C8BX 2WN8A 2C8EE 1GIQA 2A78B 4GY2A 1UZIA 1OG1A 4PKSA 1GXZA 4H0XA 4H03A 2WN7A 5GTTA 1PWPA 3BW8A 2A9KB 5BWMB 2C8AA 4PKWA 4WF6A 2WN4A 2C89A 4PKRA 2WN5A 1GY0A 4ELNA 4GF1A 1PWUA
chains in the Genus database with same CATH topology
1GXYA 5H03A 2GWMA 2WN6A 1R4BA 4DV8A 4XM6A 4FMLA 4PKQA 1OG4A 4PKVA 3NTSA 4H0YA 5D1TA 5DZQA 1PWVA 4XSGB 2C8DA 1GIRA 1YQYA 2GWLA 4FXQA 3BUZA 4H0TA 5H04A 1QS1A 1JKYA 1J7NA 1OJQA 1QS2A 1OG3A 5D1SA 4PKUA 4H0VA 4XM7A 1PWWA 1R45A 2J3XA 1G24A 4FK7A 5D1UA 2C8CA 2J3VA 1OJZA 4XSHB 1PWQA 1GZFA 4XM8A 4PKTA 3U0JA 2J3ZA 1ZXVA 2C8HA 2BOVB 2C8GA 4TR5A 1GZEA 2C8FE 2C8BX 2WN8A 2C8EE 1GIQA 2A78B 4GY2A 1UZIA 1OG1A 4PKSA 1GXZA 4H0XA 4H03A 2WN7A 5GTTA 1PWPA 3BW8A 2A9KB 5BWMB 2C8AA 4PKWA 4WF6A 2WN4A 2C89A 4PKRA 2WN5A 1GY0A 4ELNA 4GF1A 1PWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXY A;  5H03 A;  2GWM A;  2WN6 A;  1R4B A;  4DV8 A;  4XM6 A;  4FML A;  4PKQ A;  1OG4 A;  4PKV A;  3NTS A;  4H0Y A;  5D1T A;  5DZQ A;  1PWV A;  4XSG B;  2C8D A;  1GIR A;  1YQY A;  2GWL A;  4FXQ A;  3BUZ A;  4H0T A;  5H04 A;  1QS1 A;  1JKY A;  1J7N A;  1OJQ A;  1QS2 A;  1OG3 A;  5D1S A;  4PKU A;  4H0V A;  4XM7 A;  1PWW A;  1R45 A;  2J3X A;  1G24 A;  4FK7 A;  5D1U A;  2C8C A;  2J3V A;  1OJZ A;  4XSH B;  1PWQ A;  1GZF A;  4XM8 A;  4PKT A;  3U0J A;  2J3Z A;  1ZXV A;  2C8H A;  2BOV B;  2C8G A;  4TR5 A;  1GZE A;  2C8F E;  2C8B X;  2WN8 A;  2C8E E;  1GIQ A;  2A78 B;  4GY2 A;  1UZI A;  1OG1 A;  4PKS A;  1GXZ A;  4H0X A;  4H03 A;  2WN7 A;  5GTT A;  1PWP A;  3BW8 A;  2A9K B;  5BWM B;  2C8A A;  4PKW A;  4WF6 A;  2WN4 A;  2C89 A;  4PKR A;  2WN5 A;  1GY0 A;  4ELN A;  4GF1 A;  1PWU A; 
#chains in the Genus database with same CATH topology
 1GXY A;  5H03 A;  2GWM A;  2WN6 A;  1R4B A;  4DV8 A;  4XM6 A;  4FML A;  4PKQ A;  1OG4 A;  4PKV A;  3NTS A;  4H0Y A;  5D1T A;  5DZQ A;  1PWV A;  4XSG B;  2C8D A;  1GIR A;  1YQY A;  2GWL A;  4FXQ A;  3BUZ A;  4H0T A;  5H04 A;  1QS1 A;  1JKY A;  1J7N A;  1OJQ A;  1QS2 A;  1OG3 A;  5D1S A;  4PKU A;  4H0V A;  4XM7 A;  1PWW A;  1R45 A;  2J3X A;  1G24 A;  4FK7 A;  5D1U A;  2C8C A;  2J3V A;  1OJZ A;  4XSH B;  1PWQ A;  1GZF A;  4XM8 A;  4PKT A;  3U0J A;  2J3Z A;  1ZXV A;  2C8H A;  2BOV B;  2C8G A;  4TR5 A;  1GZE A;  2C8F E;  2C8B X;  2WN8 A;  2C8E E;  1GIQ A;  2A78 B;  4GY2 A;  1UZI A;  1OG1 A;  4PKS A;  1GXZ A;  4H0X A;  4H03 A;  2WN7 A;  5GTT A;  1PWP A;  3BW8 A;  2A9K B;  5BWM B;  2C8A A;  4PKW A;  4WF6 A;  2WN4 A;  2C89 A;  4PKR A;  2WN5 A;  1GY0 A;  4ELN A;  4GF1 A;  1PWU A; 
#chains in the Genus database with same CATH homology
 1GXY A;  5H03 A;  2GWM A;  2WN6 A;  1R4B A;  4DV8 A;  4XM6 A;  4FML A;  4PKQ A;  1OG4 A;  4PKV A;  3NTS A;  4H0Y A;  5D1T A;  5DZQ A;  1PWV A;  4XSG B;  2C8D A;  1GIR A;  1YQY A;  2GWL A;  4FXQ A;  3BUZ A;  4H0T A;  5H04 A;  1QS1 A;  1JKY A;  1J7N A;  1OJQ A;  1QS2 A;  1OG3 A;  5D1S A;  4PKU A;  4H0V A;  4XM7 A;  1PWW A;  1R45 A;  2J3X A;  1G24 A;  4FK7 A;  5D1U A;  2C8C A;  2J3V A;  1OJZ A;  4XSH B;  1PWQ A;  1GZF A;  4XM8 A;  4PKT A;  3U0J A;  2J3Z A;  1ZXV A;  2C8H A;  2BOV B;  2C8G A;  4TR5 A;  1GZE A;  2C8F E;  2C8B X;  2WN8 A;  2C8E E;  1GIQ A;  2A78 B;  4GY2 A;  1UZI A;  1OG1 A;  4PKS A;  1GXZ A;  4H0X A;  4H03 A;  2WN7 A;  5GTT A;  1PWP A;  3BW8 A;  2A9K B;  5BWM B;  2C8A A;  4PKW A;  4WF6 A;  2WN4 A;  2C89 A;  4PKR A;  2WN5 A;  1GY0 A;  4ELN A;  4GF1 A;  1PWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...