2C8DA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 63
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8dA00
4H0XA 1GXYA 1ZXVA 2C8GA 4PKVA 4XSGB 4ELNA 1GIRA 4H0VA 1OJQA 5D1SA 2C8EE 3NTSA 1YQYA 2C8DA 5BWMB 4PKUA 2J3VA 4GY2A 1OG1A 4PKWA 5D1UA 1JKYA 2J3ZA 4XM6A 1R4BA 2GWMA 2C8HA 4PKSA 3U0JA 2C89A 2C8AA 4PKTA 4FMLA 1PWUA 1GZFA 4TR5A 4XSHB 4H03A 4XM8A 2WN7A 2C8CA 1OJZA 1QS2A 2BOVB 1R45A 4PKRA 5H03A 1OG3A 3BW8A 1UZIA 4DV8A 2C8BX 5DZQA 3BUZA 2J3XA 1PWVA 2WN8A 2WN5A 1J7NA 5H04A 4FK7A 1GZEA 4XM7A 4GF1A 4PKQA 1PWWA 1OG4A 1GIQA 2WN4A 4FXQA 1PWQA 2WN6A 2A78B 1G24A 5GTTA 1QS1A 2GWLA 5D1TA 4H0YA 1GXZA 1PWPA 2A9KB 1GY0A 4H0TA 4WF6A 2C8FE
chains in the Genus database with same CATH superfamily
4H0XA 1GXYA 1ZXVA 2C8GA 4PKVA 4XSGB 4ELNA 1GIRA 4H0VA 1OJQA 5D1SA 2C8EE 3NTSA 1YQYA 2C8DA 5BWMB 4PKUA 2J3VA 4GY2A 1OG1A 4PKWA 5D1UA 1JKYA 2J3ZA 4XM6A 1R4BA 2GWMA 2C8HA 4PKSA 3U0JA 2C89A 2C8AA 4PKTA 4FMLA 1PWUA 1GZFA 4TR5A 4XSHB 4H03A 4XM8A 2WN7A 2C8CA 1OJZA 1QS2A 2BOVB 1R45A 4PKRA 5H03A 1OG3A 3BW8A 1UZIA 4DV8A 2C8BX 5DZQA 3BUZA 2J3XA 1PWVA 2WN8A 2WN5A 1J7NA 5H04A 4FK7A 1GZEA 4XM7A 4GF1A 4PKQA 1PWWA 1OG4A 1GIQA 2WN4A 4FXQA 1PWQA 2WN6A 2A78B 1G24A 5GTTA 1QS1A 2GWLA 5D1TA 4H0YA 1GXZA 1PWPA 2A9KB 1GY0A 4H0TA 4WF6A 2C8FE
chains in the Genus database with same CATH topology
4H0XA 1GXYA 1ZXVA 2C8GA 4PKVA 4XSGB 4ELNA 1GIRA 4H0VA 1OJQA 5D1SA 2C8EE 3NTSA 1YQYA 2C8DA 5BWMB 4PKUA 2J3VA 4GY2A 1OG1A 4PKWA 5D1UA 1JKYA 2J3ZA 4XM6A 1R4BA 2GWMA 2C8HA 4PKSA 3U0JA 2C89A 2C8AA 4PKTA 4FMLA 1PWUA 1GZFA 4TR5A 4XSHB 4H03A 4XM8A 2WN7A 2C8CA 1OJZA 1QS2A 2BOVB 1R45A 4PKRA 5H03A 1OG3A 3BW8A 1UZIA 4DV8A 2C8BX 5DZQA 3BUZA 2J3XA 1PWVA 2WN8A 2WN5A 1J7NA 5H04A 4FK7A 1GZEA 4XM7A 4GF1A 4PKQA 1PWWA 1OG4A 1GIQA 2WN4A 4FXQA 1PWQA 2WN6A 2A78B 1G24A 5GTTA 1QS1A 2GWLA 5D1TA 4H0YA 1GXZA 1PWPA 2A9KB 1GY0A 4H0TA 4WF6A 2C8FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0X A;  1GXY A;  1ZXV A;  2C8G A;  4PKV A;  4XSG B;  4ELN A;  1GIR A;  4H0V A;  1OJQ A;  5D1S A;  2C8E E;  3NTS A;  1YQY A;  2C8D A;  5BWM B;  4PKU A;  2J3V A;  4GY2 A;  1OG1 A;  4PKW A;  5D1U A;  1JKY A;  2J3Z A;  4XM6 A;  1R4B A;  2GWM A;  2C8H A;  4PKS A;  3U0J A;  2C89 A;  2C8A A;  4PKT A;  4FML A;  1PWU A;  1GZF A;  4TR5 A;  4XSH B;  4H03 A;  4XM8 A;  2WN7 A;  2C8C A;  1OJZ A;  1QS2 A;  2BOV B;  1R45 A;  4PKR A;  5H03 A;  1OG3 A;  3BW8 A;  1UZI A;  4DV8 A;  2C8B X;  5DZQ A;  3BUZ A;  2J3X A;  1PWV A;  2WN8 A;  2WN5 A;  1J7N A;  5H04 A;  4FK7 A;  1GZE A;  4XM7 A;  4GF1 A;  4PKQ A;  1PWW A;  1OG4 A;  1GIQ A;  2WN4 A;  4FXQ A;  1PWQ A;  2WN6 A;  2A78 B;  1G24 A;  5GTT A;  1QS1 A;  2GWL A;  5D1T A;  4H0Y A;  1GXZ A;  1PWP A;  2A9K B;  1GY0 A;  4H0T A;  4WF6 A;  2C8F E; 
#chains in the Genus database with same CATH topology
 4H0X A;  1GXY A;  1ZXV A;  2C8G A;  4PKV A;  4XSG B;  4ELN A;  1GIR A;  4H0V A;  1OJQ A;  5D1S A;  2C8E E;  3NTS A;  1YQY A;  2C8D A;  5BWM B;  4PKU A;  2J3V A;  4GY2 A;  1OG1 A;  4PKW A;  5D1U A;  1JKY A;  2J3Z A;  4XM6 A;  1R4B A;  2GWM A;  2C8H A;  4PKS A;  3U0J A;  2C89 A;  2C8A A;  4PKT A;  4FML A;  1PWU A;  1GZF A;  4TR5 A;  4XSH B;  4H03 A;  4XM8 A;  2WN7 A;  2C8C A;  1OJZ A;  1QS2 A;  2BOV B;  1R45 A;  4PKR A;  5H03 A;  1OG3 A;  3BW8 A;  1UZI A;  4DV8 A;  2C8B X;  5DZQ A;  3BUZ A;  2J3X A;  1PWV A;  2WN8 A;  2WN5 A;  1J7N A;  5H04 A;  4FK7 A;  1GZE A;  4XM7 A;  4GF1 A;  4PKQ A;  1PWW A;  1OG4 A;  1GIQ A;  2WN4 A;  4FXQ A;  1PWQ A;  2WN6 A;  2A78 B;  1G24 A;  5GTT A;  1QS1 A;  2GWL A;  5D1T A;  4H0Y A;  1GXZ A;  1PWP A;  2A9K B;  1GY0 A;  4H0T A;  4WF6 A;  2C8F E; 
#chains in the Genus database with same CATH homology
 4H0X A;  1GXY A;  1ZXV A;  2C8G A;  4PKV A;  4XSG B;  4ELN A;  1GIR A;  4H0V A;  1OJQ A;  5D1S A;  2C8E E;  3NTS A;  1YQY A;  2C8D A;  5BWM B;  4PKU A;  2J3V A;  4GY2 A;  1OG1 A;  4PKW A;  5D1U A;  1JKY A;  2J3Z A;  4XM6 A;  1R4B A;  2GWM A;  2C8H A;  4PKS A;  3U0J A;  2C89 A;  2C8A A;  4PKT A;  4FML A;  1PWU A;  1GZF A;  4TR5 A;  4XSH B;  4H03 A;  4XM8 A;  2WN7 A;  2C8C A;  1OJZ A;  1QS2 A;  2BOV B;  1R45 A;  4PKR A;  5H03 A;  1OG3 A;  3BW8 A;  1UZI A;  4DV8 A;  2C8B X;  5DZQ A;  3BUZ A;  2J3X A;  1PWV A;  2WN8 A;  2WN5 A;  1J7N A;  5H04 A;  4FK7 A;  1GZE A;  4XM7 A;  4GF1 A;  4PKQ A;  1PWW A;  1OG4 A;  1GIQ A;  2WN4 A;  4FXQ A;  1PWQ A;  2WN6 A;  2A78 B;  1G24 A;  5GTT A;  1QS1 A;  2GWL A;  5D1T A;  4H0Y A;  1GXZ A;  1PWP A;  2A9K B;  1GY0 A;  4H0T A;  4WF6 A;  2C8F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...