2C8DA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 63
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8dA00
1GIQA 1GXYA 2J3ZA 4GF1A 4H03A 1J7NA 2C8HA 2WN8A 1R4BA 5BWMB 4DV8A 4FK7A 1R45A 4XSHB 2C8EE 4PKTA 1OG1A 1UZIA 2C8CA 4H0YA 4H0XA 1YQYA 2WN4A 4H0VA 4PKVA 1GZFA 5D1SA 2C8BX 4PKRA 4TR5A 1JKYA 4GY2A 2GWLA 5GTTA 1QS2A 2J3VA 4ELNA 1G24A 1OJZA 4XM8A 2C8GA 3U0JA 1PWWA 2WN7A 2WN6A 2GWMA 2BOVB 1QS1A 2C8AA 1PWQA 1ZXVA 2A78B 5D1TA 4PKUA 1PWVA 1PWPA 2C8DA 5D1UA 4FXQA 3NTSA 4FMLA 4XSGB 3BUZA 4WF6A 4H0TA 1OG3A 2C8FE 1GIRA 5H03A 1GY0A 5DZQA 4XM6A 2A9KB 1OJQA 2C89A 1PWUA 1GZEA 2WN5A 4PKQA 3BW8A 1OG4A 2J3XA 4PKWA 5H04A 4PKSA 4XM7A 1GXZA
chains in the Genus database with same CATH superfamily
1GIQA 1GXYA 2J3ZA 4GF1A 4H03A 1J7NA 2C8HA 2WN8A 1R4BA 5BWMB 4DV8A 4FK7A 1R45A 4XSHB 2C8EE 4PKTA 1OG1A 1UZIA 2C8CA 4H0YA 4H0XA 1YQYA 2WN4A 4H0VA 4PKVA 1GZFA 5D1SA 2C8BX 4PKRA 4TR5A 1JKYA 4GY2A 2GWLA 5GTTA 1QS2A 2J3VA 4ELNA 1G24A 1OJZA 4XM8A 2C8GA 3U0JA 1PWWA 2WN7A 2WN6A 2GWMA 2BOVB 1QS1A 2C8AA 1PWQA 1ZXVA 2A78B 5D1TA 4PKUA 1PWVA 1PWPA 2C8DA 5D1UA 4FXQA 3NTSA 4FMLA 4XSGB 3BUZA 4WF6A 4H0TA 1OG3A 2C8FE 1GIRA 5H03A 1GY0A 5DZQA 4XM6A 2A9KB 1OJQA 2C89A 1PWUA 1GZEA 2WN5A 4PKQA 3BW8A 1OG4A 2J3XA 4PKWA 5H04A 4PKSA 4XM7A 1GXZA
chains in the Genus database with same CATH topology
1GIQA 1GXYA 2J3ZA 4GF1A 4H03A 1J7NA 2C8HA 2WN8A 1R4BA 5BWMB 4DV8A 4FK7A 1R45A 4XSHB 2C8EE 4PKTA 1OG1A 1UZIA 2C8CA 4H0YA 4H0XA 1YQYA 2WN4A 4H0VA 4PKVA 1GZFA 5D1SA 2C8BX 4PKRA 4TR5A 1JKYA 4GY2A 2GWLA 5GTTA 1QS2A 2J3VA 4ELNA 1G24A 1OJZA 4XM8A 2C8GA 3U0JA 1PWWA 2WN7A 2WN6A 2GWMA 2BOVB 1QS1A 2C8AA 1PWQA 1ZXVA 2A78B 5D1TA 4PKUA 1PWVA 1PWPA 2C8DA 5D1UA 4FXQA 3NTSA 4FMLA 4XSGB 3BUZA 4WF6A 4H0TA 1OG3A 2C8FE 1GIRA 5H03A 1GY0A 5DZQA 4XM6A 2A9KB 1OJQA 2C89A 1PWUA 1GZEA 2WN5A 4PKQA 3BW8A 1OG4A 2J3XA 4PKWA 5H04A 4PKSA 4XM7A 1GXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GIQ A;  1GXY A;  2J3Z A;  4GF1 A;  4H03 A;  1J7N A;  2C8H A;  2WN8 A;  1R4B A;  5BWM B;  4DV8 A;  4FK7 A;  1R45 A;  4XSH B;  2C8E E;  4PKT A;  1OG1 A;  1UZI A;  2C8C A;  4H0Y A;  4H0X A;  1YQY A;  2WN4 A;  4H0V A;  4PKV A;  1GZF A;  5D1S A;  2C8B X;  4PKR A;  4TR5 A;  1JKY A;  4GY2 A;  2GWL A;  5GTT A;  1QS2 A;  2J3V A;  4ELN A;  1G24 A;  1OJZ A;  4XM8 A;  2C8G A;  3U0J A;  1PWW A;  2WN7 A;  2WN6 A;  2GWM A;  2BOV B;  1QS1 A;  2C8A A;  1PWQ A;  1ZXV A;  2A78 B;  5D1T A;  4PKU A;  1PWV A;  1PWP A;  2C8D A;  5D1U A;  4FXQ A;  3NTS A;  4FML A;  4XSG B;  3BUZ A;  4WF6 A;  4H0T A;  1OG3 A;  2C8F E;  1GIR A;  5H03 A;  1GY0 A;  5DZQ A;  4XM6 A;  2A9K B;  1OJQ A;  2C89 A;  1PWU A;  1GZE A;  2WN5 A;  4PKQ A;  3BW8 A;  1OG4 A;  2J3X A;  4PKW A;  5H04 A;  4PKS A;  4XM7 A;  1GXZ A; 
#chains in the Genus database with same CATH topology
 1GIQ A;  1GXY A;  2J3Z A;  4GF1 A;  4H03 A;  1J7N A;  2C8H A;  2WN8 A;  1R4B A;  5BWM B;  4DV8 A;  4FK7 A;  1R45 A;  4XSH B;  2C8E E;  4PKT A;  1OG1 A;  1UZI A;  2C8C A;  4H0Y A;  4H0X A;  1YQY A;  2WN4 A;  4H0V A;  4PKV A;  1GZF A;  5D1S A;  2C8B X;  4PKR A;  4TR5 A;  1JKY A;  4GY2 A;  2GWL A;  5GTT A;  1QS2 A;  2J3V A;  4ELN A;  1G24 A;  1OJZ A;  4XM8 A;  2C8G A;  3U0J A;  1PWW A;  2WN7 A;  2WN6 A;  2GWM A;  2BOV B;  1QS1 A;  2C8A A;  1PWQ A;  1ZXV A;  2A78 B;  5D1T A;  4PKU A;  1PWV A;  1PWP A;  2C8D A;  5D1U A;  4FXQ A;  3NTS A;  4FML A;  4XSG B;  3BUZ A;  4WF6 A;  4H0T A;  1OG3 A;  2C8F E;  1GIR A;  5H03 A;  1GY0 A;  5DZQ A;  4XM6 A;  2A9K B;  1OJQ A;  2C89 A;  1PWU A;  1GZE A;  2WN5 A;  4PKQ A;  3BW8 A;  1OG4 A;  2J3X A;  4PKW A;  5H04 A;  4PKS A;  4XM7 A;  1GXZ A; 
#chains in the Genus database with same CATH homology
 1GIQ A;  1GXY A;  2J3Z A;  4GF1 A;  4H03 A;  1J7N A;  2C8H A;  2WN8 A;  1R4B A;  5BWM B;  4DV8 A;  4FK7 A;  1R45 A;  4XSH B;  2C8E E;  4PKT A;  1OG1 A;  1UZI A;  2C8C A;  4H0Y A;  4H0X A;  1YQY A;  2WN4 A;  4H0V A;  4PKV A;  1GZF A;  5D1S A;  2C8B X;  4PKR A;  4TR5 A;  1JKY A;  4GY2 A;  2GWL A;  5GTT A;  1QS2 A;  2J3V A;  4ELN A;  1G24 A;  1OJZ A;  4XM8 A;  2C8G A;  3U0J A;  1PWW A;  2WN7 A;  2WN6 A;  2GWM A;  2BOV B;  1QS1 A;  2C8A A;  1PWQ A;  1ZXV A;  2A78 B;  5D1T A;  4PKU A;  1PWV A;  1PWP A;  2C8D A;  5D1U A;  4FXQ A;  3NTS A;  4FML A;  4XSG B;  3BUZ A;  4WF6 A;  4H0T A;  1OG3 A;  2C8F E;  1GIR A;  5H03 A;  1GY0 A;  5DZQ A;  4XM6 A;  2A9K B;  1OJQ A;  2C89 A;  1PWU A;  1GZE A;  2WN5 A;  4PKQ A;  3BW8 A;  1OG4 A;  2J3X A;  4PKW A;  5H04 A;  4PKS A;  4XM7 A;  1GXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...