2C8DA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 63
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8dA00
5D1TA 3BUZA 4XM6A 3NTSA 4GF1A 2GWLA 2C8HA 4FXQA 1PWUA 4PKQA 1G24A 1GZEA 2C8FE 2WN8A 4PKTA 1GY0A 1PWVA 1QS1A 4XSGB 1GIQA 2C8GA 4XM8A 3U0JA 4H0TA 2C8AA 2WN6A 4DV8A 5DZQA 1PWQA 5BWMB 4FK7A 1OG3A 4GY2A 1GIRA 1GXYA 1R45A 2WN5A 1OJQA 1PWPA 2J3ZA 4PKUA 5D1UA 4PKSA 1UZIA 2A78B 5H03A 2C8CA 1QS2A 3BW8A 2C8EE 4FMLA 1OG1A 2WN4A 1JKYA 1OJZA 4ELNA 2J3XA 2C89A 2WN7A 4WF6A 4H0XA 4PKVA 4H0VA 1PWWA 2C8BX 4XM7A 1R4BA 4TR5A 4XSHB 1J7NA 4PKRA 4PKWA 1GXZA 2A9KB 2BOVB 4H0YA 2GWMA 1GZFA 4H03A 2C8DA 1ZXVA 5GTTA 1YQYA 5H04A 1OG4A 5D1SA 2J3VA
chains in the Genus database with same CATH superfamily
5D1TA 3BUZA 4XM6A 3NTSA 4GF1A 2GWLA 2C8HA 4FXQA 1PWUA 4PKQA 1G24A 1GZEA 2C8FE 2WN8A 4PKTA 1GY0A 1PWVA 1QS1A 4XSGB 1GIQA 2C8GA 4XM8A 3U0JA 4H0TA 2C8AA 2WN6A 4DV8A 5DZQA 1PWQA 5BWMB 4FK7A 1OG3A 4GY2A 1GIRA 1GXYA 1R45A 2WN5A 1OJQA 1PWPA 2J3ZA 4PKUA 5D1UA 4PKSA 1UZIA 2A78B 5H03A 2C8CA 1QS2A 3BW8A 2C8EE 4FMLA 1OG1A 2WN4A 1JKYA 1OJZA 4ELNA 2J3XA 2C89A 2WN7A 4WF6A 4H0XA 4PKVA 4H0VA 1PWWA 2C8BX 4XM7A 1R4BA 4TR5A 4XSHB 1J7NA 4PKRA 4PKWA 1GXZA 2A9KB 2BOVB 4H0YA 2GWMA 1GZFA 4H03A 2C8DA 1ZXVA 5GTTA 1YQYA 5H04A 1OG4A 5D1SA 2J3VA
chains in the Genus database with same CATH topology
5D1TA 3BUZA 4XM6A 3NTSA 4GF1A 2GWLA 2C8HA 4FXQA 1PWUA 4PKQA 1G24A 1GZEA 2C8FE 2WN8A 4PKTA 1GY0A 1PWVA 1QS1A 4XSGB 1GIQA 2C8GA 4XM8A 3U0JA 4H0TA 2C8AA 2WN6A 4DV8A 5DZQA 1PWQA 5BWMB 4FK7A 1OG3A 4GY2A 1GIRA 1GXYA 1R45A 2WN5A 1OJQA 1PWPA 2J3ZA 4PKUA 5D1UA 4PKSA 1UZIA 2A78B 5H03A 2C8CA 1QS2A 3BW8A 2C8EE 4FMLA 1OG1A 2WN4A 1JKYA 1OJZA 4ELNA 2J3XA 2C89A 2WN7A 4WF6A 4H0XA 4PKVA 4H0VA 1PWWA 2C8BX 4XM7A 1R4BA 4TR5A 4XSHB 1J7NA 4PKRA 4PKWA 1GXZA 2A9KB 2BOVB 4H0YA 2GWMA 1GZFA 4H03A 2C8DA 1ZXVA 5GTTA 1YQYA 5H04A 1OG4A 5D1SA 2J3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1T A;  3BUZ A;  4XM6 A;  3NTS A;  4GF1 A;  2GWL A;  2C8H A;  4FXQ A;  1PWU A;  4PKQ A;  1G24 A;  1GZE A;  2C8F E;  2WN8 A;  4PKT A;  1GY0 A;  1PWV A;  1QS1 A;  4XSG B;  1GIQ A;  2C8G A;  4XM8 A;  3U0J A;  4H0T A;  2C8A A;  2WN6 A;  4DV8 A;  5DZQ A;  1PWQ A;  5BWM B;  4FK7 A;  1OG3 A;  4GY2 A;  1GIR A;  1GXY A;  1R45 A;  2WN5 A;  1OJQ A;  1PWP A;  2J3Z A;  4PKU A;  5D1U A;  4PKS A;  1UZI A;  2A78 B;  5H03 A;  2C8C A;  1QS2 A;  3BW8 A;  2C8E E;  4FML A;  1OG1 A;  2WN4 A;  1JKY A;  1OJZ A;  4ELN A;  2J3X A;  2C89 A;  2WN7 A;  4WF6 A;  4H0X A;  4PKV A;  4H0V A;  1PWW A;  2C8B X;  4XM7 A;  1R4B A;  4TR5 A;  4XSH B;  1J7N A;  4PKR A;  4PKW A;  1GXZ A;  2A9K B;  2BOV B;  4H0Y A;  2GWM A;  1GZF A;  4H03 A;  2C8D A;  1ZXV A;  5GTT A;  1YQY A;  5H04 A;  1OG4 A;  5D1S A;  2J3V A; 
#chains in the Genus database with same CATH topology
 5D1T A;  3BUZ A;  4XM6 A;  3NTS A;  4GF1 A;  2GWL A;  2C8H A;  4FXQ A;  1PWU A;  4PKQ A;  1G24 A;  1GZE A;  2C8F E;  2WN8 A;  4PKT A;  1GY0 A;  1PWV A;  1QS1 A;  4XSG B;  1GIQ A;  2C8G A;  4XM8 A;  3U0J A;  4H0T A;  2C8A A;  2WN6 A;  4DV8 A;  5DZQ A;  1PWQ A;  5BWM B;  4FK7 A;  1OG3 A;  4GY2 A;  1GIR A;  1GXY A;  1R45 A;  2WN5 A;  1OJQ A;  1PWP A;  2J3Z A;  4PKU A;  5D1U A;  4PKS A;  1UZI A;  2A78 B;  5H03 A;  2C8C A;  1QS2 A;  3BW8 A;  2C8E E;  4FML A;  1OG1 A;  2WN4 A;  1JKY A;  1OJZ A;  4ELN A;  2J3X A;  2C89 A;  2WN7 A;  4WF6 A;  4H0X A;  4PKV A;  4H0V A;  1PWW A;  2C8B X;  4XM7 A;  1R4B A;  4TR5 A;  4XSH B;  1J7N A;  4PKR A;  4PKW A;  1GXZ A;  2A9K B;  2BOV B;  4H0Y A;  2GWM A;  1GZF A;  4H03 A;  2C8D A;  1ZXV A;  5GTT A;  1YQY A;  5H04 A;  1OG4 A;  5D1S A;  2J3V A; 
#chains in the Genus database with same CATH homology
 5D1T A;  3BUZ A;  4XM6 A;  3NTS A;  4GF1 A;  2GWL A;  2C8H A;  4FXQ A;  1PWU A;  4PKQ A;  1G24 A;  1GZE A;  2C8F E;  2WN8 A;  4PKT A;  1GY0 A;  1PWV A;  1QS1 A;  4XSG B;  1GIQ A;  2C8G A;  4XM8 A;  3U0J A;  4H0T A;  2C8A A;  2WN6 A;  4DV8 A;  5DZQ A;  1PWQ A;  5BWM B;  4FK7 A;  1OG3 A;  4GY2 A;  1GIR A;  1GXY A;  1R45 A;  2WN5 A;  1OJQ A;  1PWP A;  2J3Z A;  4PKU A;  5D1U A;  4PKS A;  1UZI A;  2A78 B;  5H03 A;  2C8C A;  1QS2 A;  3BW8 A;  2C8E E;  4FML A;  1OG1 A;  2WN4 A;  1JKY A;  1OJZ A;  4ELN A;  2J3X A;  2C89 A;  2WN7 A;  4WF6 A;  4H0X A;  4PKV A;  4H0V A;  1PWW A;  2C8B X;  4XM7 A;  1R4B A;  4TR5 A;  4XSH B;  1J7N A;  4PKR A;  4PKW A;  1GXZ A;  2A9K B;  2BOV B;  4H0Y A;  2GWM A;  1GZF A;  4H03 A;  2C8D A;  1ZXV A;  5GTT A;  1YQY A;  5H04 A;  1OG4 A;  5D1S A;  2J3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...