4FK7A

Crystal structure of certhrax catalytic domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
203
Chain Sequence
VLDFKWYTRKAESWGVQTFKNWKENLTISEKDIITGYTGSKYDPINEYLRKKALEKIENQIKNLDAALQKSKITENLIVYRRVSELQFGKKYEDYNLRQNGIINEEKVMELESNFKGQTFIQHNYMSTSLVQDPHQSYSNDRYPILLEITIPEGVHGAYIADMSEYPGQYEMLINRGYTFKYDKFSIVKPGKEYLKVNLSIYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative ADP-ribosyltransferase Certhrax
publication title Certhrax Toxin, an Anthrax-related ADP-ribosyltransferase from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 203
sequence length 227
ec nomenclature ec 2.4.2.-:
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4fk7A00
2A78B 2WN5A 4DV8A 1GXZA 1R4BA 4PKUA 5D1UA 5D1SA 4PKSA 2C8DA 4XM8A 4PKQA 3U0JA 2GWMA 1JKYA 1OJQA 1GZEA 1OJZA 1PWWA 3BUZA 1G24A 4GY2A 5GTTA 1PWUA 2WN8A 4TR5A 4XM6A 2C8EE 1YQYA 4GF1A 4PKRA 4H03A 4PKVA 5H03A 2C89A 2C8FE 4H0YA 1GIRA 4XSHB 4FMLA 5D1TA 5BWMB 4PKWA 1OG4A 3NTSA 1ZXVA 2C8GA 2C8BX 1R45A 4PKTA 1PWQA 2C8HA 3BW8A 4XM7A 2BOVB 2J3XA 5DZQA 2A9KB 2WN6A 1GIQA 2C8CA 4XSGB 1QS1A 1QS2A 4FK7A 1J7NA 2GWLA 1GY0A 1UZIA 1PWPA 2WN4A 4FXQA 2WN7A 1OG1A 1OG3A 2J3VA 1GXYA 4H0VA 4ELNA 1GZFA 4WF6A 5H04A 2J3ZA 2C8AA 1PWVA 4H0XA 4H0TA
chains in the Genus database with same CATH superfamily
2A78B 2WN5A 4DV8A 1GXZA 1R4BA 4PKUA 5D1UA 5D1SA 4PKSA 2C8DA 4XM8A 4PKQA 3U0JA 2GWMA 1JKYA 1OJQA 1GZEA 1OJZA 1PWWA 3BUZA 1G24A 4GY2A 5GTTA 1PWUA 2WN8A 4TR5A 4XM6A 2C8EE 1YQYA 4GF1A 4PKRA 4H03A 4PKVA 5H03A 2C89A 2C8FE 4H0YA 1GIRA 4XSHB 4FMLA 5D1TA 5BWMB 4PKWA 1OG4A 3NTSA 1ZXVA 2C8GA 2C8BX 1R45A 4PKTA 1PWQA 2C8HA 3BW8A 4XM7A 2BOVB 2J3XA 5DZQA 2A9KB 2WN6A 1GIQA 2C8CA 4XSGB 1QS1A 1QS2A 4FK7A 1J7NA 2GWLA 1GY0A 1UZIA 1PWPA 2WN4A 4FXQA 2WN7A 1OG1A 1OG3A 2J3VA 1GXYA 4H0VA 4ELNA 1GZFA 4WF6A 5H04A 2J3ZA 2C8AA 1PWVA 4H0XA 4H0TA
chains in the Genus database with same CATH topology
2A78B 2WN5A 4DV8A 1GXZA 1R4BA 4PKUA 5D1UA 5D1SA 4PKSA 2C8DA 4XM8A 4PKQA 3U0JA 2GWMA 1JKYA 1OJQA 1GZEA 1OJZA 1PWWA 3BUZA 1G24A 4GY2A 5GTTA 1PWUA 2WN8A 4TR5A 4XM6A 2C8EE 1YQYA 4GF1A 4PKRA 4H03A 4PKVA 5H03A 2C89A 2C8FE 4H0YA 1GIRA 4XSHB 4FMLA 5D1TA 5BWMB 4PKWA 1OG4A 3NTSA 1ZXVA 2C8GA 2C8BX 1R45A 4PKTA 1PWQA 2C8HA 3BW8A 4XM7A 2BOVB 2J3XA 5DZQA 2A9KB 2WN6A 1GIQA 2C8CA 4XSGB 1QS1A 1QS2A 4FK7A 1J7NA 2GWLA 1GY0A 1UZIA 1PWPA 2WN4A 4FXQA 2WN7A 1OG1A 1OG3A 2J3VA 1GXYA 4H0VA 4ELNA 1GZFA 4WF6A 5H04A 2J3ZA 2C8AA 1PWVA 4H0XA 4H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A78 B;  2WN5 A;  4DV8 A;  1GXZ A;  1R4B A;  4PKU A;  5D1U A;  5D1S A;  4PKS A;  2C8D A;  4XM8 A;  4PKQ A;  3U0J A;  2GWM A;  1JKY A;  1OJQ A;  1GZE A;  1OJZ A;  1PWW A;  3BUZ A;  1G24 A;  4GY2 A;  5GTT A;  1PWU A;  2WN8 A;  4TR5 A;  4XM6 A;  2C8E E;  1YQY A;  4GF1 A;  4PKR A;  4H03 A;  4PKV A;  5H03 A;  2C89 A;  2C8F E;  4H0Y A;  1GIR A;  4XSH B;  4FML A;  5D1T A;  5BWM B;  4PKW A;  1OG4 A;  3NTS A;  1ZXV A;  2C8G A;  2C8B X;  1R45 A;  4PKT A;  1PWQ A;  2C8H A;  3BW8 A;  4XM7 A;  2BOV B;  2J3X A;  5DZQ A;  2A9K B;  2WN6 A;  1GIQ A;  2C8C A;  4XSG B;  1QS1 A;  1QS2 A;  4FK7 A;  1J7N A;  2GWL A;  1GY0 A;  1UZI A;  1PWP A;  2WN4 A;  4FXQ A;  2WN7 A;  1OG1 A;  1OG3 A;  2J3V A;  1GXY A;  4H0V A;  4ELN A;  1GZF A;  4WF6 A;  5H04 A;  2J3Z A;  2C8A A;  1PWV A;  4H0X A;  4H0T A; 
#chains in the Genus database with same CATH topology
 2A78 B;  2WN5 A;  4DV8 A;  1GXZ A;  1R4B A;  4PKU A;  5D1U A;  5D1S A;  4PKS A;  2C8D A;  4XM8 A;  4PKQ A;  3U0J A;  2GWM A;  1JKY A;  1OJQ A;  1GZE A;  1OJZ A;  1PWW A;  3BUZ A;  1G24 A;  4GY2 A;  5GTT A;  1PWU A;  2WN8 A;  4TR5 A;  4XM6 A;  2C8E E;  1YQY A;  4GF1 A;  4PKR A;  4H03 A;  4PKV A;  5H03 A;  2C89 A;  2C8F E;  4H0Y A;  1GIR A;  4XSH B;  4FML A;  5D1T A;  5BWM B;  4PKW A;  1OG4 A;  3NTS A;  1ZXV A;  2C8G A;  2C8B X;  1R45 A;  4PKT A;  1PWQ A;  2C8H A;  3BW8 A;  4XM7 A;  2BOV B;  2J3X A;  5DZQ A;  2A9K B;  2WN6 A;  1GIQ A;  2C8C A;  4XSG B;  1QS1 A;  1QS2 A;  4FK7 A;  1J7N A;  2GWL A;  1GY0 A;  1UZI A;  1PWP A;  2WN4 A;  4FXQ A;  2WN7 A;  1OG1 A;  1OG3 A;  2J3V A;  1GXY A;  4H0V A;  4ELN A;  1GZF A;  4WF6 A;  5H04 A;  2J3Z A;  2C8A A;  1PWV A;  4H0X A;  4H0T A; 
#chains in the Genus database with same CATH homology
 2A78 B;  2WN5 A;  4DV8 A;  1GXZ A;  1R4B A;  4PKU A;  5D1U A;  5D1S A;  4PKS A;  2C8D A;  4XM8 A;  4PKQ A;  3U0J A;  2GWM A;  1JKY A;  1OJQ A;  1GZE A;  1OJZ A;  1PWW A;  3BUZ A;  1G24 A;  4GY2 A;  5GTT A;  1PWU A;  2WN8 A;  4TR5 A;  4XM6 A;  2C8E E;  1YQY A;  4GF1 A;  4PKR A;  4H03 A;  4PKV A;  5H03 A;  2C89 A;  2C8F E;  4H0Y A;  1GIR A;  4XSH B;  4FML A;  5D1T A;  5BWM B;  4PKW A;  1OG4 A;  3NTS A;  1ZXV A;  2C8G A;  2C8B X;  1R45 A;  4PKT A;  1PWQ A;  2C8H A;  3BW8 A;  4XM7 A;  2BOV B;  2J3X A;  5DZQ A;  2A9K B;  2WN6 A;  1GIQ A;  2C8C A;  4XSG B;  1QS1 A;  1QS2 A;  4FK7 A;  1J7N A;  2GWL A;  1GY0 A;  1UZI A;  1PWP A;  2WN4 A;  4FXQ A;  2WN7 A;  1OG1 A;  1OG3 A;  2J3V A;  1GXY A;  4H0V A;  4ELN A;  1GZF A;  4WF6 A;  5H04 A;  2J3Z A;  2C8A A;  1PWV A;  4H0X A;  4H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...