3U0JA

Crystal structure of adp-ribosyltransferase hopu1 of pseudomonas syringae pv. tomato dc3000
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
232
Chain Sequence
ERHYSTGQDRHDFYRFAARLHVDAQCFGLSIDDLMDKFSDKHFRAEHPEYRDVYPEECSAIYMHTAQDYSSHLVRGEIGTPLYREVNNYLRLQHENSGREAHDEKLSPHIKMLSSALNRLMDVAAFRGTVYRGIRGDLDTIARLYHLFDTGGRYVEPAFMSTTRIKDSAQVFEPGTPNNIAFQISLKRGADISGSSQAPSEEEIMLPMMSEFVIEHASALSEGKHLFVLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III effector HopU1
publication title Structure function analysis of an ADP-ribosyltransferase type III effector and its RNA-binding target in plant immunity
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Transferase
total genus 70
structure length 232
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 3u0jA00
4XSGB 1GZFA 5H04A 3BUZA 2A9KB 5D1SA 2BOVB 4PKVA 1OG1A 2J3XA 1OG4A 3NTSA 2J3VA 4PKQA 1GZEA 1UZIA 2J3ZA 4TR5A 2A78B 4GY2A 3U0JA 1GXZA 2C8FE 1J7NA 2C8HA 1OJZA 2C8GA 4GF1A 2WN4A 4H0VA 4XM6A 5D1UA 1GIQA 1R4BA 2C89A 4ELNA 2C8AA 4FMLA 2C8EE 4XSHB 1OJQA 2C8CA 5BWMB 5D1TA 1G24A 4FXQA 1ZXVA 1YQYA 4H0YA 1OG3A 4PKRA 5DZQA 1GY0A 4FK7A 1R45A 2WN6A 2WN8A 4H0XA 4XM7A 1JKYA 5GTTA 4PKWA 1QS2A 4H0TA 1PWVA 4H03A 3BW8A 1PWQA 2C8BX 4PKTA 4PKSA 4PKUA 1PWUA 2WN5A 1PWWA 2GWLA 1GIRA 4XM8A 1PWPA 2C8DA 5H03A 4WF6A 2WN7A 1GXYA 1QS1A 2GWMA 4DV8A
chains in the Genus database with same CATH superfamily
4XSGB 1GZFA 5H04A 3BUZA 2A9KB 5D1SA 2BOVB 4PKVA 1OG1A 2J3XA 1OG4A 3NTSA 2J3VA 4PKQA 1GZEA 1UZIA 2J3ZA 4TR5A 2A78B 4GY2A 3U0JA 1GXZA 2C8FE 1J7NA 2C8HA 1OJZA 2C8GA 4GF1A 2WN4A 4H0VA 4XM6A 5D1UA 1GIQA 1R4BA 2C89A 4ELNA 2C8AA 4FMLA 2C8EE 4XSHB 1OJQA 2C8CA 5BWMB 5D1TA 1G24A 4FXQA 1ZXVA 1YQYA 4H0YA 1OG3A 4PKRA 5DZQA 1GY0A 4FK7A 1R45A 2WN6A 2WN8A 4H0XA 4XM7A 1JKYA 5GTTA 4PKWA 1QS2A 4H0TA 1PWVA 4H03A 3BW8A 1PWQA 2C8BX 4PKTA 4PKSA 4PKUA 1PWUA 2WN5A 1PWWA 2GWLA 1GIRA 4XM8A 1PWPA 2C8DA 5H03A 4WF6A 2WN7A 1GXYA 1QS1A 2GWMA 4DV8A
chains in the Genus database with same CATH topology
4XSGB 1GZFA 5H04A 3BUZA 2A9KB 5D1SA 2BOVB 4PKVA 1OG1A 2J3XA 1OG4A 3NTSA 2J3VA 4PKQA 1GZEA 1UZIA 2J3ZA 4TR5A 2A78B 4GY2A 3U0JA 1GXZA 2C8FE 1J7NA 2C8HA 1OJZA 2C8GA 4GF1A 2WN4A 4H0VA 4XM6A 5D1UA 1GIQA 1R4BA 2C89A 4ELNA 2C8AA 4FMLA 2C8EE 4XSHB 1OJQA 2C8CA 5BWMB 5D1TA 1G24A 4FXQA 1ZXVA 1YQYA 4H0YA 1OG3A 4PKRA 5DZQA 1GY0A 4FK7A 1R45A 2WN6A 2WN8A 4H0XA 4XM7A 1JKYA 5GTTA 4PKWA 1QS2A 4H0TA 1PWVA 4H03A 3BW8A 1PWQA 2C8BX 4PKTA 4PKSA 4PKUA 1PWUA 2WN5A 1PWWA 2GWLA 1GIRA 4XM8A 1PWPA 2C8DA 5H03A 4WF6A 2WN7A 1GXYA 1QS1A 2GWMA 4DV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSG B;  1GZF A;  5H04 A;  3BUZ A;  2A9K B;  5D1S A;  2BOV B;  4PKV A;  1OG1 A;  2J3X A;  1OG4 A;  3NTS A;  2J3V A;  4PKQ A;  1GZE A;  1UZI A;  2J3Z A;  4TR5 A;  2A78 B;  4GY2 A;  3U0J A;  1GXZ A;  2C8F E;  1J7N A;  2C8H A;  1OJZ A;  2C8G A;  4GF1 A;  2WN4 A;  4H0V A;  4XM6 A;  5D1U A;  1GIQ A;  1R4B A;  2C89 A;  4ELN A;  2C8A A;  4FML A;  2C8E E;  4XSH B;  1OJQ A;  2C8C A;  5BWM B;  5D1T A;  1G24 A;  4FXQ A;  1ZXV A;  1YQY A;  4H0Y A;  1OG3 A;  4PKR A;  5DZQ A;  1GY0 A;  4FK7 A;  1R45 A;  2WN6 A;  2WN8 A;  4H0X A;  4XM7 A;  1JKY A;  5GTT A;  4PKW A;  1QS2 A;  4H0T A;  1PWV A;  4H03 A;  3BW8 A;  1PWQ A;  2C8B X;  4PKT A;  4PKS A;  4PKU A;  1PWU A;  2WN5 A;  1PWW A;  2GWL A;  1GIR A;  4XM8 A;  1PWP A;  2C8D A;  5H03 A;  4WF6 A;  2WN7 A;  1GXY A;  1QS1 A;  2GWM A;  4DV8 A; 
#chains in the Genus database with same CATH topology
 4XSG B;  1GZF A;  5H04 A;  3BUZ A;  2A9K B;  5D1S A;  2BOV B;  4PKV A;  1OG1 A;  2J3X A;  1OG4 A;  3NTS A;  2J3V A;  4PKQ A;  1GZE A;  1UZI A;  2J3Z A;  4TR5 A;  2A78 B;  4GY2 A;  3U0J A;  1GXZ A;  2C8F E;  1J7N A;  2C8H A;  1OJZ A;  2C8G A;  4GF1 A;  2WN4 A;  4H0V A;  4XM6 A;  5D1U A;  1GIQ A;  1R4B A;  2C89 A;  4ELN A;  2C8A A;  4FML A;  2C8E E;  4XSH B;  1OJQ A;  2C8C A;  5BWM B;  5D1T A;  1G24 A;  4FXQ A;  1ZXV A;  1YQY A;  4H0Y A;  1OG3 A;  4PKR A;  5DZQ A;  1GY0 A;  4FK7 A;  1R45 A;  2WN6 A;  2WN8 A;  4H0X A;  4XM7 A;  1JKY A;  5GTT A;  4PKW A;  1QS2 A;  4H0T A;  1PWV A;  4H03 A;  3BW8 A;  1PWQ A;  2C8B X;  4PKT A;  4PKS A;  4PKU A;  1PWU A;  2WN5 A;  1PWW A;  2GWL A;  1GIR A;  4XM8 A;  1PWP A;  2C8D A;  5H03 A;  4WF6 A;  2WN7 A;  1GXY A;  1QS1 A;  2GWM A;  4DV8 A; 
#chains in the Genus database with same CATH homology
 4XSG B;  1GZF A;  5H04 A;  3BUZ A;  2A9K B;  5D1S A;  2BOV B;  4PKV A;  1OG1 A;  2J3X A;  1OG4 A;  3NTS A;  2J3V A;  4PKQ A;  1GZE A;  1UZI A;  2J3Z A;  4TR5 A;  2A78 B;  4GY2 A;  3U0J A;  1GXZ A;  2C8F E;  1J7N A;  2C8H A;  1OJZ A;  2C8G A;  4GF1 A;  2WN4 A;  4H0V A;  4XM6 A;  5D1U A;  1GIQ A;  1R4B A;  2C89 A;  4ELN A;  2C8A A;  4FML A;  2C8E E;  4XSH B;  1OJQ A;  2C8C A;  5BWM B;  5D1T A;  1G24 A;  4FXQ A;  1ZXV A;  1YQY A;  4H0Y A;  1OG3 A;  4PKR A;  5DZQ A;  1GY0 A;  4FK7 A;  1R45 A;  2WN6 A;  2WN8 A;  4H0X A;  4XM7 A;  1JKY A;  5GTT A;  4PKW A;  1QS2 A;  4H0T A;  1PWV A;  4H03 A;  3BW8 A;  1PWQ A;  2C8B X;  4PKT A;  4PKS A;  4PKU A;  1PWU A;  2WN5 A;  1PWW A;  2GWL A;  1GIR A;  4XM8 A;  1PWP A;  2C8D A;  5H03 A;  4WF6 A;  2WN7 A;  1GXY A;  1QS1 A;  2GWM A;  4DV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...