3U0JA

Crystal structure of adp-ribosyltransferase hopu1 of pseudomonas syringae pv. tomato dc3000
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
232
Chain Sequence
ERHYSTGQDRHDFYRFAARLHVDAQCFGLSIDDLMDKFSDKHFRAEHPEYRDVYPEECSAIYMHTAQDYSSHLVRGEIGTPLYREVNNYLRLQHENSGREAHDEKLSPHIKMLSSALNRLMDVAAFRGTVYRGIRGDLDTIARLYHLFDTGGRYVEPAFMSTTRIKDSAQVFEPGTPNNIAFQISLKRGADISGSSQAPSEEEIMLPMMSEFVIEHASALSEGKHLFVLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III effector HopU1
publication title Structure function analysis of an ADP-ribosyltransferase type III effector and its RNA-binding target in plant immunity
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Transferase
total genus 70
structure length 232
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 3u0jA00
1GZEA 5GTTA 1YQYA 1PWWA 3BW8A 1QS1A 4H0YA 4PKUA 1UZIA 1OG1A 2WN6A 4DV8A 1PWPA 1OG4A 4H0VA 2C8EE 1G24A 1PWUA 2J3VA 1JKYA 2BOVB 2WN4A 3U0JA 3BUZA 1OJZA 4XSHB 4XM6A 2J3XA 5D1UA 4H03A 1GZFA 5D1TA 4FMLA 1PWQA 2J3ZA 1GY0A 2WN8A 4XM7A 5BWMB 2C8HA 4ELNA 1R4BA 2C8DA 2C8BX 2GWLA 2C8FE 4WF6A 1GXYA 4H0TA 4PKQA 3NTSA 4H0XA 4XSGB 2A78B 2WN5A 1GXZA 2C8AA 4PKTA 1PWVA 4XM8A 1ZXVA 4FXQA 5DZQA 1OJQA 4PKRA 5D1SA 4FK7A 1J7NA 2WN7A 2C89A 4GY2A 1OG3A 1R45A 1GIQA 5H03A 2C8CA 4GF1A 4TR5A 2GWMA 4PKWA 4PKVA 5H04A 1GIRA 4PKSA 2A9KB 2C8GA 1QS2A
chains in the Genus database with same CATH superfamily
1GZEA 5GTTA 1YQYA 1PWWA 3BW8A 1QS1A 4H0YA 4PKUA 1UZIA 1OG1A 2WN6A 4DV8A 1PWPA 1OG4A 4H0VA 2C8EE 1G24A 1PWUA 2J3VA 1JKYA 2BOVB 2WN4A 3U0JA 3BUZA 1OJZA 4XSHB 4XM6A 2J3XA 5D1UA 4H03A 1GZFA 5D1TA 4FMLA 1PWQA 2J3ZA 1GY0A 2WN8A 4XM7A 5BWMB 2C8HA 4ELNA 1R4BA 2C8DA 2C8BX 2GWLA 2C8FE 4WF6A 1GXYA 4H0TA 4PKQA 3NTSA 4H0XA 4XSGB 2A78B 2WN5A 1GXZA 2C8AA 4PKTA 1PWVA 4XM8A 1ZXVA 4FXQA 5DZQA 1OJQA 4PKRA 5D1SA 4FK7A 1J7NA 2WN7A 2C89A 4GY2A 1OG3A 1R45A 1GIQA 5H03A 2C8CA 4GF1A 4TR5A 2GWMA 4PKWA 4PKVA 5H04A 1GIRA 4PKSA 2A9KB 2C8GA 1QS2A
chains in the Genus database with same CATH topology
1GZEA 5GTTA 1YQYA 1PWWA 3BW8A 1QS1A 4H0YA 4PKUA 1UZIA 1OG1A 2WN6A 4DV8A 1PWPA 1OG4A 4H0VA 2C8EE 1G24A 1PWUA 2J3VA 1JKYA 2BOVB 2WN4A 3U0JA 3BUZA 1OJZA 4XSHB 4XM6A 2J3XA 5D1UA 4H03A 1GZFA 5D1TA 4FMLA 1PWQA 2J3ZA 1GY0A 2WN8A 4XM7A 5BWMB 2C8HA 4ELNA 1R4BA 2C8DA 2C8BX 2GWLA 2C8FE 4WF6A 1GXYA 4H0TA 4PKQA 3NTSA 4H0XA 4XSGB 2A78B 2WN5A 1GXZA 2C8AA 4PKTA 1PWVA 4XM8A 1ZXVA 4FXQA 5DZQA 1OJQA 4PKRA 5D1SA 4FK7A 1J7NA 2WN7A 2C89A 4GY2A 1OG3A 1R45A 1GIQA 5H03A 2C8CA 4GF1A 4TR5A 2GWMA 4PKWA 4PKVA 5H04A 1GIRA 4PKSA 2A9KB 2C8GA 1QS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZE A;  5GTT A;  1YQY A;  1PWW A;  3BW8 A;  1QS1 A;  4H0Y A;  4PKU A;  1UZI A;  1OG1 A;  2WN6 A;  4DV8 A;  1PWP A;  1OG4 A;  4H0V A;  2C8E E;  1G24 A;  1PWU A;  2J3V A;  1JKY A;  2BOV B;  2WN4 A;  3U0J A;  3BUZ A;  1OJZ A;  4XSH B;  4XM6 A;  2J3X A;  5D1U A;  4H03 A;  1GZF A;  5D1T A;  4FML A;  1PWQ A;  2J3Z A;  1GY0 A;  2WN8 A;  4XM7 A;  5BWM B;  2C8H A;  4ELN A;  1R4B A;  2C8D A;  2C8B X;  2GWL A;  2C8F E;  4WF6 A;  1GXY A;  4H0T A;  4PKQ A;  3NTS A;  4H0X A;  4XSG B;  2A78 B;  2WN5 A;  1GXZ A;  2C8A A;  4PKT A;  1PWV A;  4XM8 A;  1ZXV A;  4FXQ A;  5DZQ A;  1OJQ A;  4PKR A;  5D1S A;  4FK7 A;  1J7N A;  2WN7 A;  2C89 A;  4GY2 A;  1OG3 A;  1R45 A;  1GIQ A;  5H03 A;  2C8C A;  4GF1 A;  4TR5 A;  2GWM A;  4PKW A;  4PKV A;  5H04 A;  1GIR A;  4PKS A;  2A9K B;  2C8G A;  1QS2 A; 
#chains in the Genus database with same CATH topology
 1GZE A;  5GTT A;  1YQY A;  1PWW A;  3BW8 A;  1QS1 A;  4H0Y A;  4PKU A;  1UZI A;  1OG1 A;  2WN6 A;  4DV8 A;  1PWP A;  1OG4 A;  4H0V A;  2C8E E;  1G24 A;  1PWU A;  2J3V A;  1JKY A;  2BOV B;  2WN4 A;  3U0J A;  3BUZ A;  1OJZ A;  4XSH B;  4XM6 A;  2J3X A;  5D1U A;  4H03 A;  1GZF A;  5D1T A;  4FML A;  1PWQ A;  2J3Z A;  1GY0 A;  2WN8 A;  4XM7 A;  5BWM B;  2C8H A;  4ELN A;  1R4B A;  2C8D A;  2C8B X;  2GWL A;  2C8F E;  4WF6 A;  1GXY A;  4H0T A;  4PKQ A;  3NTS A;  4H0X A;  4XSG B;  2A78 B;  2WN5 A;  1GXZ A;  2C8A A;  4PKT A;  1PWV A;  4XM8 A;  1ZXV A;  4FXQ A;  5DZQ A;  1OJQ A;  4PKR A;  5D1S A;  4FK7 A;  1J7N A;  2WN7 A;  2C89 A;  4GY2 A;  1OG3 A;  1R45 A;  1GIQ A;  5H03 A;  2C8C A;  4GF1 A;  4TR5 A;  2GWM A;  4PKW A;  4PKV A;  5H04 A;  1GIR A;  4PKS A;  2A9K B;  2C8G A;  1QS2 A; 
#chains in the Genus database with same CATH homology
 1GZE A;  5GTT A;  1YQY A;  1PWW A;  3BW8 A;  1QS1 A;  4H0Y A;  4PKU A;  1UZI A;  1OG1 A;  2WN6 A;  4DV8 A;  1PWP A;  1OG4 A;  4H0V A;  2C8E E;  1G24 A;  1PWU A;  2J3V A;  1JKY A;  2BOV B;  2WN4 A;  3U0J A;  3BUZ A;  1OJZ A;  4XSH B;  4XM6 A;  2J3X A;  5D1U A;  4H03 A;  1GZF A;  5D1T A;  4FML A;  1PWQ A;  2J3Z A;  1GY0 A;  2WN8 A;  4XM7 A;  5BWM B;  2C8H A;  4ELN A;  1R4B A;  2C8D A;  2C8B X;  2GWL A;  2C8F E;  4WF6 A;  1GXY A;  4H0T A;  4PKQ A;  3NTS A;  4H0X A;  4XSG B;  2A78 B;  2WN5 A;  1GXZ A;  2C8A A;  4PKT A;  1PWV A;  4XM8 A;  1ZXV A;  4FXQ A;  5DZQ A;  1OJQ A;  4PKR A;  5D1S A;  4FK7 A;  1J7N A;  2WN7 A;  2C89 A;  4GY2 A;  1OG3 A;  1R45 A;  1GIQ A;  5H03 A;  2C8C A;  4GF1 A;  4TR5 A;  2GWM A;  4PKW A;  4PKV A;  5H04 A;  1GIR A;  4PKS A;  2A9K B;  2C8G A;  1QS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...