2C8CA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
204
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 63
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8cA00
4DV8A 1R45A 2C8AA 4XM8A 4H0XA 2C8BX 1PWVA 4FMLA 1GY0A 2J3ZA 2C8FE 1PWQA 4PKQA 1GXYA 4PKSA 1JKYA 1PWUA 2C8HA 5GTTA 5D1SA 1GZEA 4PKTA 1PWWA 2GWLA 3NTSA 3BW8A 2WN5A 1UZIA 2A78B 3BUZA 4H0YA 4XSHB 5DZQA 4H03A 2C8EE 1GIRA 1ZXVA 1OJZA 5H03A 4PKWA 2A9KB 5BWMB 5H04A 2WN7A 1OG1A 2C8CA 1PWPA 4GY2A 2WN6A 4H0TA 4GF1A 1QS1A 1J7NA 1YQYA 5D1UA 4PKVA 4TR5A 1GIQA 4XSGB 4ELNA 5D1TA 1R4BA 2BOVB 2C8DA 2C8GA 4PKUA 4H0VA 1QS2A 4XM6A 1GZFA 1GXZA 4WF6A 3U0JA 2WN8A 4PKRA 2C89A 2J3XA 1OG4A 4FK7A 1G24A 2GWMA 2J3VA 4FXQA 4XM7A 1OJQA 1OG3A 2WN4A
chains in the Genus database with same CATH superfamily
4DV8A 1R45A 2C8AA 4XM8A 4H0XA 2C8BX 1PWVA 4FMLA 1GY0A 2J3ZA 2C8FE 1PWQA 4PKQA 1GXYA 4PKSA 1JKYA 1PWUA 2C8HA 5GTTA 5D1SA 1GZEA 4PKTA 1PWWA 2GWLA 3NTSA 3BW8A 2WN5A 1UZIA 2A78B 3BUZA 4H0YA 4XSHB 5DZQA 4H03A 2C8EE 1GIRA 1ZXVA 1OJZA 5H03A 4PKWA 2A9KB 5BWMB 5H04A 2WN7A 1OG1A 2C8CA 1PWPA 4GY2A 2WN6A 4H0TA 4GF1A 1QS1A 1J7NA 1YQYA 5D1UA 4PKVA 4TR5A 1GIQA 4XSGB 4ELNA 5D1TA 1R4BA 2BOVB 2C8DA 2C8GA 4PKUA 4H0VA 1QS2A 4XM6A 1GZFA 1GXZA 4WF6A 3U0JA 2WN8A 4PKRA 2C89A 2J3XA 1OG4A 4FK7A 1G24A 2GWMA 2J3VA 4FXQA 4XM7A 1OJQA 1OG3A 2WN4A
chains in the Genus database with same CATH topology
4DV8A 1R45A 2C8AA 4XM8A 4H0XA 2C8BX 1PWVA 4FMLA 1GY0A 2J3ZA 2C8FE 1PWQA 4PKQA 1GXYA 4PKSA 1JKYA 1PWUA 2C8HA 5GTTA 5D1SA 1GZEA 4PKTA 1PWWA 2GWLA 3NTSA 3BW8A 2WN5A 1UZIA 2A78B 3BUZA 4H0YA 4XSHB 5DZQA 4H03A 2C8EE 1GIRA 1ZXVA 1OJZA 5H03A 4PKWA 2A9KB 5BWMB 5H04A 2WN7A 1OG1A 2C8CA 1PWPA 4GY2A 2WN6A 4H0TA 4GF1A 1QS1A 1J7NA 1YQYA 5D1UA 4PKVA 4TR5A 1GIQA 4XSGB 4ELNA 5D1TA 1R4BA 2BOVB 2C8DA 2C8GA 4PKUA 4H0VA 1QS2A 4XM6A 1GZFA 1GXZA 4WF6A 3U0JA 2WN8A 4PKRA 2C89A 2J3XA 1OG4A 4FK7A 1G24A 2GWMA 2J3VA 4FXQA 4XM7A 1OJQA 1OG3A 2WN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV8 A;  1R45 A;  2C8A A;  4XM8 A;  4H0X A;  2C8B X;  1PWV A;  4FML A;  1GY0 A;  2J3Z A;  2C8F E;  1PWQ A;  4PKQ A;  1GXY A;  4PKS A;  1JKY A;  1PWU A;  2C8H A;  5GTT A;  5D1S A;  1GZE A;  4PKT A;  1PWW A;  2GWL A;  3NTS A;  3BW8 A;  2WN5 A;  1UZI A;  2A78 B;  3BUZ A;  4H0Y A;  4XSH B;  5DZQ A;  4H03 A;  2C8E E;  1GIR A;  1ZXV A;  1OJZ A;  5H03 A;  4PKW A;  2A9K B;  5BWM B;  5H04 A;  2WN7 A;  1OG1 A;  2C8C A;  1PWP A;  4GY2 A;  2WN6 A;  4H0T A;  4GF1 A;  1QS1 A;  1J7N A;  1YQY A;  5D1U A;  4PKV A;  4TR5 A;  1GIQ A;  4XSG B;  4ELN A;  5D1T A;  1R4B A;  2BOV B;  2C8D A;  2C8G A;  4PKU A;  4H0V A;  1QS2 A;  4XM6 A;  1GZF A;  1GXZ A;  4WF6 A;  3U0J A;  2WN8 A;  4PKR A;  2C89 A;  2J3X A;  1OG4 A;  4FK7 A;  1G24 A;  2GWM A;  2J3V A;  4FXQ A;  4XM7 A;  1OJQ A;  1OG3 A;  2WN4 A; 
#chains in the Genus database with same CATH topology
 4DV8 A;  1R45 A;  2C8A A;  4XM8 A;  4H0X A;  2C8B X;  1PWV A;  4FML A;  1GY0 A;  2J3Z A;  2C8F E;  1PWQ A;  4PKQ A;  1GXY A;  4PKS A;  1JKY A;  1PWU A;  2C8H A;  5GTT A;  5D1S A;  1GZE A;  4PKT A;  1PWW A;  2GWL A;  3NTS A;  3BW8 A;  2WN5 A;  1UZI A;  2A78 B;  3BUZ A;  4H0Y A;  4XSH B;  5DZQ A;  4H03 A;  2C8E E;  1GIR A;  1ZXV A;  1OJZ A;  5H03 A;  4PKW A;  2A9K B;  5BWM B;  5H04 A;  2WN7 A;  1OG1 A;  2C8C A;  1PWP A;  4GY2 A;  2WN6 A;  4H0T A;  4GF1 A;  1QS1 A;  1J7N A;  1YQY A;  5D1U A;  4PKV A;  4TR5 A;  1GIQ A;  4XSG B;  4ELN A;  5D1T A;  1R4B A;  2BOV B;  2C8D A;  2C8G A;  4PKU A;  4H0V A;  1QS2 A;  4XM6 A;  1GZF A;  1GXZ A;  4WF6 A;  3U0J A;  2WN8 A;  4PKR A;  2C89 A;  2J3X A;  1OG4 A;  4FK7 A;  1G24 A;  2GWM A;  2J3V A;  4FXQ A;  4XM7 A;  1OJQ A;  1OG3 A;  2WN4 A; 
#chains in the Genus database with same CATH homology
 4DV8 A;  1R45 A;  2C8A A;  4XM8 A;  4H0X A;  2C8B X;  1PWV A;  4FML A;  1GY0 A;  2J3Z A;  2C8F E;  1PWQ A;  4PKQ A;  1GXY A;  4PKS A;  1JKY A;  1PWU A;  2C8H A;  5GTT A;  5D1S A;  1GZE A;  4PKT A;  1PWW A;  2GWL A;  3NTS A;  3BW8 A;  2WN5 A;  1UZI A;  2A78 B;  3BUZ A;  4H0Y A;  4XSH B;  5DZQ A;  4H03 A;  2C8E E;  1GIR A;  1ZXV A;  1OJZ A;  5H03 A;  4PKW A;  2A9K B;  5BWM B;  5H04 A;  2WN7 A;  1OG1 A;  2C8C A;  1PWP A;  4GY2 A;  2WN6 A;  4H0T A;  4GF1 A;  1QS1 A;  1J7N A;  1YQY A;  5D1U A;  4PKV A;  4TR5 A;  1GIQ A;  4XSG B;  4ELN A;  5D1T A;  1R4B A;  2BOV B;  2C8D A;  2C8G A;  4PKU A;  4H0V A;  1QS2 A;  4XM6 A;  1GZF A;  1GXZ A;  4WF6 A;  3U0J A;  2WN8 A;  4PKR A;  2C89 A;  2J3X A;  1OG4 A;  4FK7 A;  1G24 A;  2GWM A;  2J3V A;  4FXQ A;  4XM7 A;  1OJQ A;  1OG3 A;  2WN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...