2C8CA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
204
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 63
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8cA00
2C8FE 4WF6A 5D1SA 2C8DA 1YQYA 1GXZA 4PKVA 2C8GA 2J3ZA 4H0VA 5DZQA 4PKUA 1PWVA 1GZFA 4PKTA 5H04A 2A78B 4PKRA 2C8BX 1OG3A 4GY2A 4FXQA 2C8HA 2C8EE 5D1TA 3BW8A 1GZEA 5GTTA 4XM6A 1OG4A 4ELNA 1QS2A 1UZIA 2J3XA 3U0JA 4GF1A 4H0XA 1R45A 4XM8A 1GXYA 2GWLA 2C8CA 1R4BA 1GIQA 1J7NA 2WN5A 5BWMB 4H03A 1G24A 2WN8A 5H03A 4PKWA 2GWMA 2A9KB 1OJZA 4PKQA 1GIRA 4XSHB 2WN4A 4H0TA 1JKYA 2WN6A 2BOVB 1ZXVA 4FK7A 5D1UA 2WN7A 4FMLA 2C89A 4PKSA 1PWPA 2C8AA 1OG1A 4TR5A 2J3VA 4H0YA 1QS1A 1PWUA 1PWQA 3NTSA 4XM7A 4DV8A 3BUZA 4XSGB 1PWWA 1OJQA 1GY0A
chains in the Genus database with same CATH superfamily
2C8FE 4WF6A 5D1SA 2C8DA 1YQYA 1GXZA 4PKVA 2C8GA 2J3ZA 4H0VA 5DZQA 4PKUA 1PWVA 1GZFA 4PKTA 5H04A 2A78B 4PKRA 2C8BX 1OG3A 4GY2A 4FXQA 2C8HA 2C8EE 5D1TA 3BW8A 1GZEA 5GTTA 4XM6A 1OG4A 4ELNA 1QS2A 1UZIA 2J3XA 3U0JA 4GF1A 4H0XA 1R45A 4XM8A 1GXYA 2GWLA 2C8CA 1R4BA 1GIQA 1J7NA 2WN5A 5BWMB 4H03A 1G24A 2WN8A 5H03A 4PKWA 2GWMA 2A9KB 1OJZA 4PKQA 1GIRA 4XSHB 2WN4A 4H0TA 1JKYA 2WN6A 2BOVB 1ZXVA 4FK7A 5D1UA 2WN7A 4FMLA 2C89A 4PKSA 1PWPA 2C8AA 1OG1A 4TR5A 2J3VA 4H0YA 1QS1A 1PWUA 1PWQA 3NTSA 4XM7A 4DV8A 3BUZA 4XSGB 1PWWA 1OJQA 1GY0A
chains in the Genus database with same CATH topology
2C8FE 4WF6A 5D1SA 2C8DA 1YQYA 1GXZA 4PKVA 2C8GA 2J3ZA 4H0VA 5DZQA 4PKUA 1PWVA 1GZFA 4PKTA 5H04A 2A78B 4PKRA 2C8BX 1OG3A 4GY2A 4FXQA 2C8HA 2C8EE 5D1TA 3BW8A 1GZEA 5GTTA 4XM6A 1OG4A 4ELNA 1QS2A 1UZIA 2J3XA 3U0JA 4GF1A 4H0XA 1R45A 4XM8A 1GXYA 2GWLA 2C8CA 1R4BA 1GIQA 1J7NA 2WN5A 5BWMB 4H03A 1G24A 2WN8A 5H03A 4PKWA 2GWMA 2A9KB 1OJZA 4PKQA 1GIRA 4XSHB 2WN4A 4H0TA 1JKYA 2WN6A 2BOVB 1ZXVA 4FK7A 5D1UA 2WN7A 4FMLA 2C89A 4PKSA 1PWPA 2C8AA 1OG1A 4TR5A 2J3VA 4H0YA 1QS1A 1PWUA 1PWQA 3NTSA 4XM7A 4DV8A 3BUZA 4XSGB 1PWWA 1OJQA 1GY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8F E;  4WF6 A;  5D1S A;  2C8D A;  1YQY A;  1GXZ A;  4PKV A;  2C8G A;  2J3Z A;  4H0V A;  5DZQ A;  4PKU A;  1PWV A;  1GZF A;  4PKT A;  5H04 A;  2A78 B;  4PKR A;  2C8B X;  1OG3 A;  4GY2 A;  4FXQ A;  2C8H A;  2C8E E;  5D1T A;  3BW8 A;  1GZE A;  5GTT A;  4XM6 A;  1OG4 A;  4ELN A;  1QS2 A;  1UZI A;  2J3X A;  3U0J A;  4GF1 A;  4H0X A;  1R45 A;  4XM8 A;  1GXY A;  2GWL A;  2C8C A;  1R4B A;  1GIQ A;  1J7N A;  2WN5 A;  5BWM B;  4H03 A;  1G24 A;  2WN8 A;  5H03 A;  4PKW A;  2GWM A;  2A9K B;  1OJZ A;  4PKQ A;  1GIR A;  4XSH B;  2WN4 A;  4H0T A;  1JKY A;  2WN6 A;  2BOV B;  1ZXV A;  4FK7 A;  5D1U A;  2WN7 A;  4FML A;  2C89 A;  4PKS A;  1PWP A;  2C8A A;  1OG1 A;  4TR5 A;  2J3V A;  4H0Y A;  1QS1 A;  1PWU A;  1PWQ A;  3NTS A;  4XM7 A;  4DV8 A;  3BUZ A;  4XSG B;  1PWW A;  1OJQ A;  1GY0 A; 
#chains in the Genus database with same CATH topology
 2C8F E;  4WF6 A;  5D1S A;  2C8D A;  1YQY A;  1GXZ A;  4PKV A;  2C8G A;  2J3Z A;  4H0V A;  5DZQ A;  4PKU A;  1PWV A;  1GZF A;  4PKT A;  5H04 A;  2A78 B;  4PKR A;  2C8B X;  1OG3 A;  4GY2 A;  4FXQ A;  2C8H A;  2C8E E;  5D1T A;  3BW8 A;  1GZE A;  5GTT A;  4XM6 A;  1OG4 A;  4ELN A;  1QS2 A;  1UZI A;  2J3X A;  3U0J A;  4GF1 A;  4H0X A;  1R45 A;  4XM8 A;  1GXY A;  2GWL A;  2C8C A;  1R4B A;  1GIQ A;  1J7N A;  2WN5 A;  5BWM B;  4H03 A;  1G24 A;  2WN8 A;  5H03 A;  4PKW A;  2GWM A;  2A9K B;  1OJZ A;  4PKQ A;  1GIR A;  4XSH B;  2WN4 A;  4H0T A;  1JKY A;  2WN6 A;  2BOV B;  1ZXV A;  4FK7 A;  5D1U A;  2WN7 A;  4FML A;  2C89 A;  4PKS A;  1PWP A;  2C8A A;  1OG1 A;  4TR5 A;  2J3V A;  4H0Y A;  1QS1 A;  1PWU A;  1PWQ A;  3NTS A;  4XM7 A;  4DV8 A;  3BUZ A;  4XSG B;  1PWW A;  1OJQ A;  1GY0 A; 
#chains in the Genus database with same CATH homology
 2C8F E;  4WF6 A;  5D1S A;  2C8D A;  1YQY A;  1GXZ A;  4PKV A;  2C8G A;  2J3Z A;  4H0V A;  5DZQ A;  4PKU A;  1PWV A;  1GZF A;  4PKT A;  5H04 A;  2A78 B;  4PKR A;  2C8B X;  1OG3 A;  4GY2 A;  4FXQ A;  2C8H A;  2C8E E;  5D1T A;  3BW8 A;  1GZE A;  5GTT A;  4XM6 A;  1OG4 A;  4ELN A;  1QS2 A;  1UZI A;  2J3X A;  3U0J A;  4GF1 A;  4H0X A;  1R45 A;  4XM8 A;  1GXY A;  2GWL A;  2C8C A;  1R4B A;  1GIQ A;  1J7N A;  2WN5 A;  5BWM B;  4H03 A;  1G24 A;  2WN8 A;  5H03 A;  4PKW A;  2GWM A;  2A9K B;  1OJZ A;  4PKQ A;  1GIR A;  4XSH B;  2WN4 A;  4H0T A;  1JKY A;  2WN6 A;  2BOV B;  1ZXV A;  4FK7 A;  5D1U A;  2WN7 A;  4FML A;  2C89 A;  4PKS A;  1PWP A;  2C8A A;  1OG1 A;  4TR5 A;  2J3V A;  4H0Y A;  1QS1 A;  1PWU A;  1PWQ A;  3NTS A;  4XM7 A;  4DV8 A;  3BUZ A;  4XSG B;  1PWW A;  1OJQ A;  1GY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...