2C8CA

Structure of the artt motif q212a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
204
Chain Sequence
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGALEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 63
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8cA00
1YQYA 2A9KB 3BW8A 2GWMA 4WF6A 2C8EE 2C8CA 4PKTA 1R4BA 3NTSA 2BOVB 4H0YA 1GZFA 1ZXVA 2WN5A 2C8AA 3BUZA 5D1TA 2C8BX 1GZEA 1OG3A 1PWQA 2J3VA 1PWVA 1J7NA 4PKUA 2J3ZA 1GXZA 1GXYA 4XSGB 4PKRA 4TR5A 1JKYA 1QS2A 4FK7A 1PWUA 4PKWA 5D1SA 4PKQA 2C8GA 1GY0A 4FMLA 4ELNA 1GIQA 2C8HA 1G24A 1QS1A 1PWWA 2C8DA 4GY2A 2WN6A 1OJZA 1OJQA 5H03A 2J3XA 1GIRA 1R45A 4XM7A 3U0JA 4GF1A 2A78B 4FXQA 5GTTA 4XM6A 4PKVA 5BWMB 5DZQA 4H0TA 4DV8A 2C8FE 1UZIA 4H0VA 5H04A 2WN4A 4H03A 1PWPA 5D1UA 2C89A 4XSHB 2WN8A 1OG1A 2WN7A 2GWLA 4PKSA 1OG4A 4XM8A 4H0XA
chains in the Genus database with same CATH superfamily
1YQYA 2A9KB 3BW8A 2GWMA 4WF6A 2C8EE 2C8CA 4PKTA 1R4BA 3NTSA 2BOVB 4H0YA 1GZFA 1ZXVA 2WN5A 2C8AA 3BUZA 5D1TA 2C8BX 1GZEA 1OG3A 1PWQA 2J3VA 1PWVA 1J7NA 4PKUA 2J3ZA 1GXZA 1GXYA 4XSGB 4PKRA 4TR5A 1JKYA 1QS2A 4FK7A 1PWUA 4PKWA 5D1SA 4PKQA 2C8GA 1GY0A 4FMLA 4ELNA 1GIQA 2C8HA 1G24A 1QS1A 1PWWA 2C8DA 4GY2A 2WN6A 1OJZA 1OJQA 5H03A 2J3XA 1GIRA 1R45A 4XM7A 3U0JA 4GF1A 2A78B 4FXQA 5GTTA 4XM6A 4PKVA 5BWMB 5DZQA 4H0TA 4DV8A 2C8FE 1UZIA 4H0VA 5H04A 2WN4A 4H03A 1PWPA 5D1UA 2C89A 4XSHB 2WN8A 1OG1A 2WN7A 2GWLA 4PKSA 1OG4A 4XM8A 4H0XA
chains in the Genus database with same CATH topology
1YQYA 2A9KB 3BW8A 2GWMA 4WF6A 2C8EE 2C8CA 4PKTA 1R4BA 3NTSA 2BOVB 4H0YA 1GZFA 1ZXVA 2WN5A 2C8AA 3BUZA 5D1TA 2C8BX 1GZEA 1OG3A 1PWQA 2J3VA 1PWVA 1J7NA 4PKUA 2J3ZA 1GXZA 1GXYA 4XSGB 4PKRA 4TR5A 1JKYA 1QS2A 4FK7A 1PWUA 4PKWA 5D1SA 4PKQA 2C8GA 1GY0A 4FMLA 4ELNA 1GIQA 2C8HA 1G24A 1QS1A 1PWWA 2C8DA 4GY2A 2WN6A 1OJZA 1OJQA 5H03A 2J3XA 1GIRA 1R45A 4XM7A 3U0JA 4GF1A 2A78B 4FXQA 5GTTA 4XM6A 4PKVA 5BWMB 5DZQA 4H0TA 4DV8A 2C8FE 1UZIA 4H0VA 5H04A 2WN4A 4H03A 1PWPA 5D1UA 2C89A 4XSHB 2WN8A 1OG1A 2WN7A 2GWLA 4PKSA 1OG4A 4XM8A 4H0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQY A;  2A9K B;  3BW8 A;  2GWM A;  4WF6 A;  2C8E E;  2C8C A;  4PKT A;  1R4B A;  3NTS A;  2BOV B;  4H0Y A;  1GZF A;  1ZXV A;  2WN5 A;  2C8A A;  3BUZ A;  5D1T A;  2C8B X;  1GZE A;  1OG3 A;  1PWQ A;  2J3V A;  1PWV A;  1J7N A;  4PKU A;  2J3Z A;  1GXZ A;  1GXY A;  4XSG B;  4PKR A;  4TR5 A;  1JKY A;  1QS2 A;  4FK7 A;  1PWU A;  4PKW A;  5D1S A;  4PKQ A;  2C8G A;  1GY0 A;  4FML A;  4ELN A;  1GIQ A;  2C8H A;  1G24 A;  1QS1 A;  1PWW A;  2C8D A;  4GY2 A;  2WN6 A;  1OJZ A;  1OJQ A;  5H03 A;  2J3X A;  1GIR A;  1R45 A;  4XM7 A;  3U0J A;  4GF1 A;  2A78 B;  4FXQ A;  5GTT A;  4XM6 A;  4PKV A;  5BWM B;  5DZQ A;  4H0T A;  4DV8 A;  2C8F E;  1UZI A;  4H0V A;  5H04 A;  2WN4 A;  4H03 A;  1PWP A;  5D1U A;  2C89 A;  4XSH B;  2WN8 A;  1OG1 A;  2WN7 A;  2GWL A;  4PKS A;  1OG4 A;  4XM8 A;  4H0X A; 
#chains in the Genus database with same CATH topology
 1YQY A;  2A9K B;  3BW8 A;  2GWM A;  4WF6 A;  2C8E E;  2C8C A;  4PKT A;  1R4B A;  3NTS A;  2BOV B;  4H0Y A;  1GZF A;  1ZXV A;  2WN5 A;  2C8A A;  3BUZ A;  5D1T A;  2C8B X;  1GZE A;  1OG3 A;  1PWQ A;  2J3V A;  1PWV A;  1J7N A;  4PKU A;  2J3Z A;  1GXZ A;  1GXY A;  4XSG B;  4PKR A;  4TR5 A;  1JKY A;  1QS2 A;  4FK7 A;  1PWU A;  4PKW A;  5D1S A;  4PKQ A;  2C8G A;  1GY0 A;  4FML A;  4ELN A;  1GIQ A;  2C8H A;  1G24 A;  1QS1 A;  1PWW A;  2C8D A;  4GY2 A;  2WN6 A;  1OJZ A;  1OJQ A;  5H03 A;  2J3X A;  1GIR A;  1R45 A;  4XM7 A;  3U0J A;  4GF1 A;  2A78 B;  4FXQ A;  5GTT A;  4XM6 A;  4PKV A;  5BWM B;  5DZQ A;  4H0T A;  4DV8 A;  2C8F E;  1UZI A;  4H0V A;  5H04 A;  2WN4 A;  4H03 A;  1PWP A;  5D1U A;  2C89 A;  4XSH B;  2WN8 A;  1OG1 A;  2WN7 A;  2GWL A;  4PKS A;  1OG4 A;  4XM8 A;  4H0X A; 
#chains in the Genus database with same CATH homology
 1YQY A;  2A9K B;  3BW8 A;  2GWM A;  4WF6 A;  2C8E E;  2C8C A;  4PKT A;  1R4B A;  3NTS A;  2BOV B;  4H0Y A;  1GZF A;  1ZXV A;  2WN5 A;  2C8A A;  3BUZ A;  5D1T A;  2C8B X;  1GZE A;  1OG3 A;  1PWQ A;  2J3V A;  1PWV A;  1J7N A;  4PKU A;  2J3Z A;  1GXZ A;  1GXY A;  4XSG B;  4PKR A;  4TR5 A;  1JKY A;  1QS2 A;  4FK7 A;  1PWU A;  4PKW A;  5D1S A;  4PKQ A;  2C8G A;  1GY0 A;  4FML A;  4ELN A;  1GIQ A;  2C8H A;  1G24 A;  1QS1 A;  1PWW A;  2C8D A;  4GY2 A;  2WN6 A;  1OJZ A;  1OJQ A;  5H03 A;  2J3X A;  1GIR A;  1R45 A;  4XM7 A;  3U0J A;  4GF1 A;  2A78 B;  4FXQ A;  5GTT A;  4XM6 A;  4PKV A;  5BWM B;  5DZQ A;  4H0T A;  4DV8 A;  2C8F E;  1UZI A;  4H0V A;  5H04 A;  2WN4 A;  4H03 A;  1PWP A;  5D1U A;  2C89 A;  4XSH B;  2WN8 A;  1OG1 A;  2WN7 A;  2GWL A;  4PKS A;  1OG4 A;  4XM8 A;  4H0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...