1VKAA

Southeast collaboratory for structural genomics: hypothetical human protein q15691 n-terminal fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
SAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Southeast Collaboratory for Structural Genomics: Hypothetical Human Protein Q15691 N-Terminal Fragment
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 42
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1vkaA00
3HOCA 1H67A 1TJTA 5J8EA 1WYPA 3JAKM 1AA2A 1UEGA 4B7LA 2QJZA 1BKRA 1WIXA 2D85A 4TXIA 2D87A 1AOAA 1WYQA 3CO1A 2WA5A 2D86A 1WYLA 1WYMA 4EDLA 2WA7A 2VZCA 5BVRA 3FERA 1UJOA 1MB8A 2JV9A 1DXXA 2VZIB 1WJOA 5A38A 1WKUA 1WYRA 4EDNA 5A37A 3JARM 3JALM 2WFNA 1QAGA 2R8UA 2VZDA 3F7PA 4EDMA 1SH6A 3HORA 1WYOA 2D89A 2D88A 2QJXA 1WYNA 5A36A 2L3GA 3KY9A 1PXYA 4TXKA 3REPB 1V5KA 3I6XA 1P2XA 1PA7A 1RT8A 2RR8A 2EE7A 3KMWB 2VZGB 4Q59A 1P5SA 2YRNA 4Q57B 5A4BA 2WA6A 3KMUB 2EYIA 1SH5A 1BHDA 5L0OA 1VKAA 2R0OA 2DK9A 2E9KA 3HOPA 2K3SA 2EYNA 4Q58A 2K2RA
chains in the Genus database with same CATH superfamily
3HOCA 1H67A 1TJTA 5J8EA 1WYPA 3JAKM 1AA2A 1UEGA 4B7LA 2QJZA 1BKRA 1WIXA 2D85A 4TXIA 2D87A 1AOAA 1WYQA 3CO1A 2WA5A 2D86A 1WYLA 1WYMA 4EDLA 2WA7A 4DDPA 2VZCA 5BVRA 2IGPA 3FERA 1UJOA 2HL9A 1MB8A 2JV9A 1DXXA 1EUVA 2VZIB 1WJOA 5A38A 1WKUA 5FMUA 3VP7A 1WYRA 4EDNA 5A37A 3JARM 3JALM 2HKPA 2HL8A 2WFNA 1QAGA 2R8UA 2VZDA 3F7PA 5FMTA 4EDMA 1SH6A 3HORA 2EQOA 2WE6A 1WYOA 2D89A 2D88A 2QJXA 1WYNA 5A36A 2L3GA 3KY9A 1PXYA 4TXKA 2VE7A 3REPB 1V5KA 3I6XA 1P2XA 1PA7A 1RT8A 2RR8A 2EE7A 3KMWB 2VZGB 4Q59A 4LVRA 1P5SA 2YRNA 4Q57B 5A4BA 2WA6A 3KMUB 2EYIA 1SH5A 1BHDA 2WDTA 5L0OA 3EAYA 1VKAA 2R0OA 4LVPA 2DK9A 2E9KA 2VE7C 3HOPA 2K3SA 2EYNA 4Q58A 2K2RA
chains in the Genus database with same CATH topology
3HOCA 1H67A 1TJTA 5J8EA 1WYPA 3JAKM 1AA2A 1UEGA 4B7LA 2QJZA 1BKRA 1WIXA 2D85A 4TXIA 2D87A 1AOAA 1WYQA 3CO1A 2WA5A 2D86A 1WYLA 1WYMA 4EDLA 2WA7A 2VZCA 5BVRA 3FERA 1UJOA 1MB8A 2JV9A 1DXXA 2VZIB 1WJOA 5A38A 1WKUA 1WYRA 4EDNA 5A37A 3JARM 3JALM 2WFNA 1QAGA 2R8UA 2VZDA 3F7PA 4EDMA 1SH6A 3HORA 1WYOA 2D89A 2D88A 2QJXA 1WYNA 5A36A 2L3GA 3KY9A 1PXYA 4TXKA 3REPB 1V5KA 3I6XA 1P2XA 1PA7A 1RT8A 2RR8A 2EE7A 3KMWB 2VZGB 4Q59A 1P5SA 2YRNA 4Q57B 5A4BA 2WA6A 3KMUB 2EYIA 1SH5A 1BHDA 5L0OA 1VKAA 2R0OA 2DK9A 2E9KA 3HOPA 2K3SA 2EYNA 4Q58A 2K2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOC A;  1H67 A;  1TJT A;  5J8E A;  1WYP A;  3JAK M;  1AA2 A;  1UEG A;  4B7L A;  2QJZ A;  1BKR A;  1WIX A;  2D85 A;  4TXI A;  2D87 A;  1AOA A;  1WYQ A;  3CO1 A;  2WA5 A;  2D86 A;  1WYL A;  1WYM A;  4EDL A;  2WA7 A;  2VZC A;  5BVR A;  3FER A;  1UJO A;  1MB8 A;  2JV9 A;  1DXX A;  2VZI B;  1WJO A;  5A38 A;  1WKU A;  1WYR A;  4EDN A;  5A37 A;  3JAR M;  3JAL M;  2WFN A;  1QAG A;  2R8U A;  2VZD A;  3F7P A;  4EDM A;  1SH6 A;  3HOR A;  1WYO A;  2D89 A;  2D88 A;  2QJX A;  1WYN A;  5A36 A;  2L3G A;  3KY9 A;  1PXY A;  4TXK A;  3REP B;  1V5K A;  3I6X A;  1P2X A;  1PA7 A;  1RT8 A;  2RR8 A;  2EE7 A;  3KMW B;  2VZG B;  4Q59 A;  1P5S A;  2YRN A;  4Q57 B;  5A4B A;  2WA6 A;  3KMU B;  2EYI A;  1SH5 A;  1BHD A;  5L0O A;  1VKA A;  2R0O A;  2DK9 A;  2E9K A;  3HOP A;  2K3S A;  2EYN A;  4Q58 A;  2K2R A; 
#chains in the Genus database with same CATH topology
 3HOC A;  1H67 A;  1TJT A;  5J8E A;  1WYP A;  3JAK M;  1AA2 A;  1UEG A;  4B7L A;  2QJZ A;  1BKR A;  1WIX A;  2D85 A;  4TXI A;  2D87 A;  1AOA A;  1WYQ A;  3CO1 A;  2WA5 A;  2D86 A;  1WYL A;  1WYM A;  4EDL A;  2WA7 A;  4DDP A;  2VZC A;  5BVR A;  2IGP A;  3FER A;  1UJO A;  2HL9 A;  1MB8 A;  2JV9 A;  1DXX A;  1EUV A;  2VZI B;  1WJO A;  5A38 A;  1WKU A;  5FMU A;  3VP7 A;  1WYR A;  4EDN A;  5A37 A;  3JAR M;  3JAL M;  2HKP A;  2HL8 A;  2WFN A;  1QAG A;  2R8U A;  2VZD A;  3F7P A;  5FMT A;  4EDM A;  1SH6 A;  3HOR A;  2EQO A;  2WE6 A;  1WYO A;  2D89 A;  2D88 A;  2QJX A;  1WYN A;  5A36 A;  2L3G A;  3KY9 A;  1PXY A;  4TXK A;  2VE7 A;  3REP B;  1V5K A;  3I6X A;  1P2X A;  1PA7 A;  1RT8 A;  2RR8 A;  2EE7 A;  3KMW B;  2VZG B;  4Q59 A;  4LVR A;  1P5S A;  2YRN A;  4Q57 B;  5A4B A;  2WA6 A;  3KMU B;  2EYI A;  1SH5 A;  1BHD A;  2WDT A;  5L0O A;  3EAY A;  1VKA A;  2R0O A;  4LVP A;  2DK9 A;  2E9K A;  2VE7 C;  3HOP A;  2K3S A;  2EYN A;  4Q58 A;  2K2R A; 
#chains in the Genus database with same CATH homology
 3HOC A;  1H67 A;  1TJT A;  5J8E A;  1WYP A;  3JAK M;  1AA2 A;  1UEG A;  4B7L A;  2QJZ A;  1BKR A;  1WIX A;  2D85 A;  4TXI A;  2D87 A;  1AOA A;  1WYQ A;  3CO1 A;  2WA5 A;  2D86 A;  1WYL A;  1WYM A;  4EDL A;  2WA7 A;  2VZC A;  5BVR A;  3FER A;  1UJO A;  1MB8 A;  2JV9 A;  1DXX A;  2VZI B;  1WJO A;  5A38 A;  1WKU A;  1WYR A;  4EDN A;  5A37 A;  3JAR M;  3JAL M;  2WFN A;  1QAG A;  2R8U A;  2VZD A;  3F7P A;  4EDM A;  1SH6 A;  3HOR A;  1WYO A;  2D89 A;  2D88 A;  2QJX A;  1WYN A;  5A36 A;  2L3G A;  3KY9 A;  1PXY A;  4TXK A;  3REP B;  1V5K A;  3I6X A;  1P2X A;  1PA7 A;  1RT8 A;  2RR8 A;  2EE7 A;  3KMW B;  2VZG B;  4Q59 A;  1P5S A;  2YRN A;  4Q57 B;  5A4B A;  2WA6 A;  3KMU B;  2EYI A;  1SH5 A;  1BHD A;  5L0O A;  1VKA A;  2R0O A;  2DK9 A;  2E9K A;  3HOP A;  2K3S A;  2EYN A;  4Q58 A;  2K2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...