2DK9A

Solution structure of calponin homology domain of human mical-1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
MGHHHHHHMGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSELQGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD9-interacting protein with calponin homology and LIM dom
publication title Solution structure of calponin homology domain of Human MICAL-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 1.14.13.225: F-actin monooxygenase.
pdb deposition date 2006-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 2dk9A01
4TXIA 5A36A 1WYNA 1DXXA 5L0OA 2QJZA 1WJOA 3HOCA 1P5SA 2JV9A 5J8EA 2K2RA 2E9KA 1AOAA 5A38A 2EE7A 1WYLA 1UJOA 2K3SA 1TJTA 2EYIA 4EDLA 1BKRA 2WFNA 2D85A 2R0OA 4TXKA 4B7LA 1WIXA 2L3GA 2VZDA 1WYOA 1WKUA 2VZIB 1SH6A 4EDMA 4EDNA 2D88A 1WYPA 2WA7A 1WYQA 3KMUB 1BHDA 5A37A 3F7PA 1AA2A 1V5KA 3FERA 3KY9A 1WYRA 2QJXA 1QAGA 2VZCA 2DK9A 3CO1A 3HOPA 3KMWB 2RR8A 2D86A 2WA5A 3HORA 3JAKM 1RT8A 1MB8A 2VZGB 4Q59A 1PXYA 5A4BA 3I6XA 2EYNA 3JALM 1P2XA 2WA6A 1PA7A 2D89A 1UEGA 1VKAA 4Q57B 2D87A 5BVRA 2YRNA 3JARM 3REPB 4Q58A 2R8UA 1WYMA 1SH5A 1H67A
chains in the Genus database with same CATH superfamily
4TXIA 5FMTA 5A36A 1WYNA 4LVRA 1DXXA 2VE7A 5L0OA 2QJZA 1WJOA 3HOCA 1P5SA 2JV9A 5J8EA 2K2RA 2E9KA 1AOAA 5A38A 2EE7A 1WYLA 4DDPA 1UJOA 2K3SA 1TJTA 2EYIA 3EAYA 4EDLA 1BKRA 2HL8A 2WFNA 2HL9A 2D85A 4LVPA 2R0OA 4TXKA 4B7LA 1WIXA 2L3GA 2VZDA 2WDTA 1WYOA 1EUVA 1WKUA 2IGPA 2VZIB 1SH6A 4EDMA 4EDNA 2D88A 1WYPA 2WA7A 2WE6A 1WYQA 3KMUB 1BHDA 5A37A 2EQOA 3F7PA 1AA2A 1V5KA 3FERA 3KY9A 1WYRA 2QJXA 1QAGA 2VZCA 2DK9A 3CO1A 3HOPA 3KMWB 2RR8A 2D86A 2VE7C 2WA5A 3HORA 3JAKM 1RT8A 1MB8A 2VZGB 4Q59A 1PXYA 5A4BA 3I6XA 2HKPA 2EYNA 3JALM 1P2XA 2WA6A 1PA7A 2D89A 1UEGA 1VKAA 4Q57B 3VP7A 2D87A 5BVRA 5FMUA 2YRNA 3JARM 3REPB 4Q58A 2R8UA 1WYMA 1SH5A 1H67A
chains in the Genus database with same CATH topology
4TXIA 5A36A 1WYNA 1DXXA 5L0OA 2QJZA 1WJOA 3HOCA 1P5SA 2JV9A 5J8EA 2K2RA 2E9KA 1AOAA 5A38A 2EE7A 1WYLA 1UJOA 2K3SA 1TJTA 2EYIA 4EDLA 1BKRA 2WFNA 2D85A 2R0OA 4TXKA 4B7LA 1WIXA 2L3GA 2VZDA 1WYOA 1WKUA 2VZIB 1SH6A 4EDMA 4EDNA 2D88A 1WYPA 2WA7A 1WYQA 3KMUB 1BHDA 5A37A 3F7PA 1AA2A 1V5KA 3FERA 3KY9A 1WYRA 2QJXA 1QAGA 2VZCA 2DK9A 3CO1A 3HOPA 3KMWB 2RR8A 2D86A 2WA5A 3HORA 3JAKM 1RT8A 1MB8A 2VZGB 4Q59A 1PXYA 5A4BA 3I6XA 2EYNA 3JALM 1P2XA 2WA6A 1PA7A 2D89A 1UEGA 1VKAA 4Q57B 2D87A 5BVRA 2YRNA 3JARM 3REPB 4Q58A 2R8UA 1WYMA 1SH5A 1H67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXI A;  5A36 A;  1WYN A;  1DXX A;  5L0O A;  2QJZ A;  1WJO A;  3HOC A;  1P5S A;  2JV9 A;  5J8E A;  2K2R A;  2E9K A;  1AOA A;  5A38 A;  2EE7 A;  1WYL A;  1UJO A;  2K3S A;  1TJT A;  2EYI A;  4EDL A;  1BKR A;  2WFN A;  2D85 A;  2R0O A;  4TXK A;  4B7L A;  1WIX A;  2L3G A;  2VZD A;  1WYO A;  1WKU A;  2VZI B;  1SH6 A;  4EDM A;  4EDN A;  2D88 A;  1WYP A;  2WA7 A;  1WYQ A;  3KMU B;  1BHD A;  5A37 A;  3F7P A;  1AA2 A;  1V5K A;  3FER A;  3KY9 A;  1WYR A;  2QJX A;  1QAG A;  2VZC A;  2DK9 A;  3CO1 A;  3HOP A;  3KMW B;  2RR8 A;  2D86 A;  2WA5 A;  3HOR A;  3JAK M;  1RT8 A;  1MB8 A;  2VZG B;  4Q59 A;  1PXY A;  5A4B A;  3I6X A;  2EYN A;  3JAL M;  1P2X A;  2WA6 A;  1PA7 A;  2D89 A;  1UEG A;  1VKA A;  4Q57 B;  2D87 A;  5BVR A;  2YRN A;  3JAR M;  3REP B;  4Q58 A;  2R8U A;  1WYM A;  1SH5 A;  1H67 A; 
#chains in the Genus database with same CATH topology
 4TXI A;  5FMT A;  5A36 A;  1WYN A;  4LVR A;  1DXX A;  2VE7 A;  5L0O A;  2QJZ A;  1WJO A;  3HOC A;  1P5S A;  2JV9 A;  5J8E A;  2K2R A;  2E9K A;  1AOA A;  5A38 A;  2EE7 A;  1WYL A;  4DDP A;  1UJO A;  2K3S A;  1TJT A;  2EYI A;  3EAY A;  4EDL A;  1BKR A;  2HL8 A;  2WFN A;  2HL9 A;  2D85 A;  4LVP A;  2R0O A;  4TXK A;  4B7L A;  1WIX A;  2L3G A;  2VZD A;  2WDT A;  1WYO A;  1EUV A;  1WKU A;  2IGP A;  2VZI B;  1SH6 A;  4EDM A;  4EDN A;  2D88 A;  1WYP A;  2WA7 A;  2WE6 A;  1WYQ A;  3KMU B;  1BHD A;  5A37 A;  2EQO A;  3F7P A;  1AA2 A;  1V5K A;  3FER A;  3KY9 A;  1WYR A;  2QJX A;  1QAG A;  2VZC A;  2DK9 A;  3CO1 A;  3HOP A;  3KMW B;  2RR8 A;  2D86 A;  2VE7 C;  2WA5 A;  3HOR A;  3JAK M;  1RT8 A;  1MB8 A;  2VZG B;  4Q59 A;  1PXY A;  5A4B A;  3I6X A;  2HKP A;  2EYN A;  3JAL M;  1P2X A;  2WA6 A;  1PA7 A;  2D89 A;  1UEG A;  1VKA A;  4Q57 B;  3VP7 A;  2D87 A;  5BVR A;  5FMU A;  2YRN A;  3JAR M;  3REP B;  4Q58 A;  2R8U A;  1WYM A;  1SH5 A;  1H67 A; 
#chains in the Genus database with same CATH homology
 4TXI A;  5A36 A;  1WYN A;  1DXX A;  5L0O A;  2QJZ A;  1WJO A;  3HOC A;  1P5S A;  2JV9 A;  5J8E A;  2K2R A;  2E9K A;  1AOA A;  5A38 A;  2EE7 A;  1WYL A;  1UJO A;  2K3S A;  1TJT A;  2EYI A;  4EDL A;  1BKR A;  2WFN A;  2D85 A;  2R0O A;  4TXK A;  4B7L A;  1WIX A;  2L3G A;  2VZD A;  1WYO A;  1WKU A;  2VZI B;  1SH6 A;  4EDM A;  4EDN A;  2D88 A;  1WYP A;  2WA7 A;  1WYQ A;  3KMU B;  1BHD A;  5A37 A;  3F7P A;  1AA2 A;  1V5K A;  3FER A;  3KY9 A;  1WYR A;  2QJX A;  1QAG A;  2VZC A;  2DK9 A;  3CO1 A;  3HOP A;  3KMW B;  2RR8 A;  2D86 A;  2WA5 A;  3HOR A;  3JAK M;  1RT8 A;  1MB8 A;  2VZG B;  4Q59 A;  1PXY A;  5A4B A;  3I6X A;  2EYN A;  3JAL M;  1P2X A;  2WA6 A;  1PA7 A;  2D89 A;  1UEG A;  1VKA A;  4Q57 B;  2D87 A;  5BVR A;  2YRN A;  3JAR M;  3REP B;  4Q58 A;  2R8U A;  1WYM A;  1SH5 A;  1H67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...