2HL9A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfonic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
217
Chain Sequence
SLVPELNEKDDDQVQKALASRENTQLMNRIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 217
sequence length 220
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl9A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl9A02
2HKPA 2HL9A 2HL8A 3EAYA 1EUVA
chains in the Genus database with same CATH superfamily
2OOYA 2EYNA 3CW7A 4QG5A 1DIZA 3KY9A 5L0OA 2FKMX 3HOPA 1HU0A 3N89A 4LVPA 1P5GX 1DXXA 2VE7A 4RODB 2EQOA 4ROEB 3HORA 1MPGA 3CWAA 1KYFA 1VKAA 1QTSA 2FGTA 2D0CA 5J8EA 2O3OA 3F0ZA 1QN3A 3CO1A 2EE7A 1AOAA 2YA3A 1R4XA 2JV9A 1KFQA 1LXTA 4EAGA 5HSHA 3OSTA 5IYBP 5FMTA 1TBPA 2NVMA 1QN5A 1YTFA 2R5XA 4Q58A 2FUVA 1WYMA 4EDMA 2V9JA 3JALM 4Q11A 1D3UA 1VTOA 1FN7A 3DPTA 2NOEA 1BHDA 1C4GA 1WYLA 2HZMA 2K3SA 3VN5A 2NOHA 2R0OA 1VOKA 2XHIA 1E42A 1PCMX 4D7QA 1SH5A 1UT7A 2D0BA 2QRDA 5KL0A 2D86A 2NOZA 1VKLA 1WKUA 3HOCA 4EJZA 2JHNA 1QN6A 4MRQA 2VE7C 1TBAB 3C04A 1WYRA 4EJYA 1W80A 3I0XA 2YH5A 1YQRA 1LWWA 1KYUA 4EALA 1EBMA 3RPJA 3I0WA 4I8OA 1QNAA 1LWYA 1PCZA 1QTPA 4DULA 2DK9A 1WQAA 2ZFDB 4PY5A 1KYDA 1QNEA 2OOXA 1H67A 1AISA 2F7LA 4EDNA 3REPB 3D4VA 1WYQA 5JMVD 3KMUB 2MJ7A 2NOLA 1C47A 1YQKA 3CWUA 2NWVA 1RM1A 1WYOA 1P5SA 1RT8A 4EAKA 3DPUA 1WYPA 2NLVA 3JARM 3ASMA 3CWTA 2R8UA 1M3QA 1J3MA 2EYIA 2V8QA 3HS8A 2HL8A 3UW2A 5EPCA 1N3CA 1QNBA 2IGPA 1WYNA 1TJTA 1LWVA 2VZGB 1NVPA 5A38A 3VP7A 1P2XA 3EIKA 2E9KA 2MZ8A 2D89A 1PZDA 3CVSA 2DKCA 5A4BA 2VJ0A 2QRCA 1V5SA 5BMPA 3FERA 2QREA 4WZSD 3JAKM 4B7LA 1QN4A 1B9KA 4CFFA 3CVTA 4DDPA 2JPIA 1CDWA 3EAYA 1N39A 3TE5A 1AA2A 5JN5A 2V92A 4Q59A 1PA7A 3PDKA 3OSMA 2HZSA 2RR8A 2WE6A 4Q57B 3T4NA 4LVRA 3D7QA 1Q9UA 2DKDA 1QN9A 4BJUA 4WXAA 3NA5A 4IL8A 2IV8A 3HS9A 1QAGA 3I6XA 4C7PA 1KY6A 1TUOA 5A36A 3OH9A 1YTBA 2WA6A 1UJOA 1VOLB 3F7PA 2YRNA 3ENOC 1YQLA 4EAIA 3OC3C 5AN4A 2LAEA 2L3GA 2D87A 1NH2A 3KTUA 2NOBA 3KMWB 1YQMA 3OLPA 2WFNA 3H1ZA 3OCIA 2VZIB 5FMUA 4D7RA 5IYCP 2D0AA 2H5AX 4WX8A 5IYDP 2K2RA 1T6AA 4TXIA 2IV9A 2VZCA 2DKAA 1BKRA 1SH6A 3I3WA 2Y8LA 1UL7A 1QNCA 2FKFA 2NOIA 1MP9A 5BVRA 4ROCB 2NOFA 1QN8A 1JFIC 1UEGA 3PMGA 2PWWA 4EAJA 3IH7A 5A37A 2I5WA 3BKQX 3ENCA 1WJWA 1UT4A 2QJXA 1K35A 1QN7A 3SNSA 5F9CA 1PCJX 2H4LX 4HJHA 1EUVA 1N3AA 5BMNA 1VTLE 2HL9A 2QJZA 1PVSA 1WJOA 1JDYA 1M3HA 2WA7A 1PXYA 2D88A 3OSEA 4B0AA 4EDLA 2JOIA 1TGHA 1V5KA 2D85A 1MB8A 1M5Q1 1KY7A 2QR1A 2EHBD 2JHJA 2VZDA 1C9BB 2HKPA 3KRMA 3ULXA 2Z8UA 1KFIA 3TDHA 3F10A 1P5DX 1KO9A 1NGMA 3OGDA 3CWSA 2WDTA 2Z0FA 1WIXA 4TXKA 4TPSA 2WA5A 3RSMA 1K2YX 2QLVA 1XSZA 2G30A 2Y8QA 3OH6A
chains in the Genus database with same CATH topology
2EQOA 2HKPA 4LVPA 4LVRA 2HL9A 2IGPA 3VP7A 2HL8A 2VE7C 2VE7A 2WDTA 1EUVA 3EAYA 5FMUA 4DDPA 2WE6A 5FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKP A;  2HL9 A;  2HL8 A;  3EAY A;  1EUV A; 
#chains in the Genus database with same CATH topology
 2OOY A;  2EYN A;  3CW7 A;  4QG5 A;  1DIZ A;  3KY9 A;  5L0O A;  2FKM X;  3HOP A;  1HU0 A;  3N89 A;  4LVP A;  1P5G X;  1DXX A;  2VE7 A;  4ROD B;  2EQO A;  4ROE B;  3HOR A;  1MPG A;  3CWA A;  1KYF A;  1VKA A;  1QTS A;  2FGT A;  2D0C A;  5J8E A;  2O3O A;  3F0Z A;  1QN3 A;  3CO1 A;  2EE7 A;  1AOA A;  2YA3 A;  1R4X A;  2JV9 A;  1KFQ A;  1LXT A;  4EAG A;  5HSH A;  3OST A;  5IYB P;  5FMT A;  1TBP A;  2NVM A;  1QN5 A;  1YTF A;  2R5X A;  4Q58 A;  2FUV A;  1WYM A;  4EDM A;  2V9J A;  3JAL M;  4Q11 A;  1D3U A;  1VTO A;  1FN7 A;  3DPT A;  2NOE A;  1BHD A;  1C4G A;  1WYL A;  2HZM A;  2K3S A;  3VN5 A;  2NOH A;  2R0O A;  1VOK A;  2XHI A;  1E42 A;  1PCM X;  4D7Q A;  1SH5 A;  1UT7 A;  2D0B A;  2QRD A;  5KL0 A;  2D86 A;  2NOZ A;  1VKL A;  1WKU A;  3HOC A;  4EJZ A;  2JHN A;  1QN6 A;  4MRQ A;  2VE7 C;  1TBA B;  3C04 A;  1WYR A;  4EJY A;  1W80 A;  3I0X A;  2YH5 A;  1YQR A;  1LWW A;  1KYU A;  4EAL A;  1EBM A;  3RPJ A;  3I0W A;  4I8O A;  1QNA A;  1LWY A;  1PCZ A;  1QTP A;  4DUL A;  2DK9 A;  1WQA A;  2ZFD B;  4PY5 A;  1KYD A;  1QNE A;  2OOX A;  1H67 A;  1AIS A;  2F7L A;  4EDN A;  3REP B;  3D4V A;  1WYQ A;  5JMV D;  3KMU B;  2MJ7 A;  2NOL A;  1C47 A;  1YQK A;  3CWU A;  2NWV A;  1RM1 A;  1WYO A;  1P5S A;  1RT8 A;  4EAK A;  3DPU A;  1WYP A;  2NLV A;  3JAR M;  3ASM A;  3CWT A;  2R8U A;  1M3Q A;  1J3M A;  2EYI A;  2V8Q A;  3HS8 A;  2HL8 A;  3UW2 A;  5EPC A;  1N3C A;  1QNB A;  2IGP A;  1WYN A;  1TJT A;  1LWV A;  2VZG B;  1NVP A;  5A38 A;  3VP7 A;  1P2X A;  3EIK A;  2E9K A;  2MZ8 A;  2D89 A;  1PZD A;  3CVS A;  2DKC A;  5A4B A;  2VJ0 A;  2QRC A;  1V5S A;  5BMP A;  3FER A;  2QRE A;  4WZS D;  3JAK M;  4B7L A;  1QN4 A;  1B9K A;  4CFF A;  3CVT A;  4DDP A;  2JPI A;  1CDW A;  3EAY A;  1N39 A;  3TE5 A;  1AA2 A;  5JN5 A;  2V92 A;  4Q59 A;  1PA7 A;  3PDK A;  3OSM A;  2HZS A;  2RR8 A;  2WE6 A;  4Q57 B;  3T4N A;  4LVR A;  3D7Q A;  1Q9U A;  2DKD A;  1QN9 A;  4BJU A;  4WXA A;  3NA5 A;  4IL8 A;  2IV8 A;  3HS9 A;  1QAG A;  3I6X A;  4C7P A;  1KY6 A;  1TUO A;  5A36 A;  3OH9 A;  1YTB A;  2WA6 A;  1UJO A;  1VOL B;  3F7P A;  2YRN A;  3ENO C;  1YQL A;  4EAI A;  3OC3 C;  5AN4 A;  2LAE A;  2L3G A;  2D87 A;  1NH2 A;  3KTU A;  2NOB A;  3KMW B;  1YQM A;  3OLP A;  2WFN A;  3H1Z A;  3OCI A;  2VZI B;  5FMU A;  4D7R A;  5IYC P;  2D0A A;  2H5A X;  4WX8 A;  5IYD P;  2K2R A;  1T6A A;  4TXI A;  2IV9 A;  2VZC A;  2DKA A;  1BKR A;  1SH6 A;  3I3W A;  2Y8L A;  1UL7 A;  1QNC A;  2FKF A;  2NOI A;  1MP9 A;  5BVR A;  4ROC B;  2NOF A;  1QN8 A;  1JFI C;  1UEG A;  3PMG A;  2PWW A;  4EAJ A;  3IH7 A;  5A37 A;  2I5W A;  3BKQ X;  3ENC A;  1WJW A;  1UT4 A;  2QJX A;  1K35 A;  1QN7 A;  3SNS A;  5F9C A;  1PCJ X;  2H4L X;  4HJH A;  1EUV A;  1N3A A;  5BMN A;  1VTL E;  2HL9 A;  2QJZ A;  1PVS A;  1WJO A;  1JDY A;  1M3H A;  2WA7 A;  1PXY A;  2D88 A;  3OSE A;  4B0A A;  4EDL A;  2JOI A;  1TGH A;  1V5K A;  2D85 A;  1MB8 A;  1M5Q 1;  1KY7 A;  2QR1 A;  2EHB D;  2JHJ A;  2VZD A;  1C9B B;  2HKP A;  3KRM A;  3ULX A;  2Z8U A;  1KFI A;  3TDH A;  3F10 A;  1P5D X;  1KO9 A;  1NGM A;  3OGD A;  3CWS A;  2WDT A;  2Z0F A;  1WIX A;  4TXK A;  4TPS A;  2WA5 A;  3RSM A;  1K2Y X;  2QLV A;  1XSZ A;  2G30 A;  2Y8Q A;  3OH6 A; 
#chains in the Genus database with same CATH homology
 2EQO A;  2HKP A;  4LVP A;  4LVR A;  2HL9 A;  2IGP A;  3VP7 A;  2HL8 A;  2VE7 C;  2VE7 A;  2WDT A;  1EUV A;  3EAY A;  5FMU A;  4DDP A;  2WE6 A;  5FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...