2HL9A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfonic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
217
Chain Sequence
SLVPELNEKDDDQVQKALASRENTQLMNRIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 217
sequence length 220
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl9A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl9A02
3EAYA 2HL8A 2HL9A 1EUVA 2HKPA
chains in the Genus database with same CATH superfamily
2D85A 1PVSA 2NVMA 3VN5A 4Q57B 3OCIA 1FN7A 1W80A 2HZSA 3JARM 2EQOA 1HU0A 1JFIC 3NA5A 1P5DX 4IL8A 2JPIA 1WYQA 1M3HA 2ZFDB 2DKAA 2FKMX 1M3QA 1MPGA 1QN7A 4B7LA 5BMNA 3OSEA 1MP9A 2WA5A 2RR8A 3F10A 2NOBA 1YTFA 1SH6A 1WYOA 5F9CA 4I8OA 3OH6A 3HS8A 3EIKA 4Q11A 2NOZA 4EJYA 4EAKA 1E42A 3D7QA 3C04A 2PWWA 3RPJA 2QRDA 2NOEA 4HJHA 2NOFA 1VOLB 3F7PA 2YRNA 3OSMA 5IYCP 3HOPA 2K3SA 1QN4A 1WYMA 5A4BA 1QNBA 1P5SA 3I3WA 2FUVA 3ASMA 2F7LA 2R0OA 1J3MA 2K2RA 4D7RA 1PCZA 1KYUA 2NWVA 2WFNA 3KMUB 2DKCA 1UJOA 1RT8A 1TBAB 1PZDA 5IYBP 1PCJX 3CWAA 3JALM 3REPB 1TBPA 1QNAA 1KYFA 2MZ8A 5L0OA 2Z0FA 4D7QA 2QJXA 3DPUA 4EDMA 2IV8A 2D86A 1M5Q1 2OOXA 3HOCA 2QR1A 4TPSA 2NOIA 2QLVA 4DULA 4EALA 2I5WA 2G30A 4ROCB 5BVRA 2Y8QA 1WYPA 1LXTA 2D87A 4EDLA 1SH5A 1MB8A 1LWWA 1C9BB 1PCMX 1UEGA 4WX8A 1KFQA 2EHBD 4Q59A 1QN9A 3CW7A 1WYRA 4MRQA 1YQMA 2JHJA 2O3OA 2D0CA 2Y8LA 3BKQX 1PA7A 4TXKA 1YQKA 3OH9A 3N89A 4EJZA 2HZMA 2NLVA 3KMWB 1D3UA 4Q58A 1WKUA 2WA6A 2XHIA 1N39A 2QJZA 1KY7A 2EE7A 1VTLE 1TJTA 3CWTA 4EAGA 3OLPA 1KY6A 3CO1A 1NGMA 3D4VA 4WZSD 3PDKA 5BMPA 4B0AA 1DXXA 2VZIB 2HL8A 4DDPA 1AOAA 2JV9A 1VKAA 1CDWA 1VKLA 2V9JA 1UT7A 3HORA 2IV9A 2VJ0A 1VTOA 2D0BA 3TDHA 1LWYA 4CFFA 1TGHA 2H5AX 2VZGB 3H1ZA 3I0WA 5FMUA 2FKFA 2D89A 4TXIA 1B9KA 5J8EA 5JMVD 3ENCA 5A38A 1UL7A 5EPCA 3CWUA 1K35A 2WE6A 3HS9A 1VOKA 2OOYA 1RM1A 4LVRA 3DPTA 3OC3C 3SNSA 2R5XA 3EAYA 5A37A 3KTUA 2VZCA 4PY5A 5AN4A 3OGDA 2LAEA 3T4NA 2HL9A 1H67A 5FMTA 1LWVA 1QTPA 2QREA 4EDNA 5IYDP 2YH5A 1QN8A 2NOLA 1V5SA 1P2XA 3JAKM 2IGPA 4ROEB 2FGTA 2D88A 1QTSA 1N3AA 2WA7A 1YTBA 2YA3A 3F0ZA 1QNCA 1EBMA 2WDTA 2MJ7A 1QN6A 5JN5A 1P5GX 2NOHA 3CVSA 2QRCA 2VZDA 2H4LX 1BHDA 2EYIA 4EAIA 5HSHA 1EUVA 2HKPA 3KRMA 1KO9A 1QAGA 1XSZA 1C47A 2E9KA 3PMGA 1QNEA 3CWSA 4RODB 1WYNA 5A36A 4WXAA 3I0XA 1DIZA 1WJWA 1NH2A 2DK9A 1YQRA 3RSMA 1QN5A 3KY9A 2V92A 3CVTA 1JDYA 2Z8UA 4LVPA 1KYDA 1KFIA 1V5KA 3ENOC 4C7PA 3OSTA 2D0AA 1T6AA 3TE5A 2L3GA 1Q9UA 1WQAA 4QG5A 1WIXA 3FERA 2EYNA 3ULXA 1QN3A 1NVPA 4EAJA 3I6XA 2R8UA 1BKRA 3UW2A 5KL0A 2VE7C 1PXYA 4BJUA 1WYLA 2VE7A 1K2YX 1YQLA 1WJOA 1R4XA 1AA2A 2JHNA 3IH7A 1TUOA 3VP7A 1N3CA 1UT4A 2JOIA 2DKDA 2V8QA 1C4GA 1AISA
chains in the Genus database with same CATH topology
3EAYA 2IGPA 4LVPA 2EQOA 2HL8A 2HL9A 2VE7C 5FMUA 2WDTA 5FMTA 3VP7A 4LVRA 1EUVA 2HKPA 4DDPA 2WE6A 2VE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAY A;  2HL8 A;  2HL9 A;  1EUV A;  2HKP A; 
#chains in the Genus database with same CATH topology
 2D85 A;  1PVS A;  2NVM A;  3VN5 A;  4Q57 B;  3OCI A;  1FN7 A;  1W80 A;  2HZS A;  3JAR M;  2EQO A;  1HU0 A;  1JFI C;  3NA5 A;  1P5D X;  4IL8 A;  2JPI A;  1WYQ A;  1M3H A;  2ZFD B;  2DKA A;  2FKM X;  1M3Q A;  1MPG A;  1QN7 A;  4B7L A;  5BMN A;  3OSE A;  1MP9 A;  2WA5 A;  2RR8 A;  3F10 A;  2NOB A;  1YTF A;  1SH6 A;  1WYO A;  5F9C A;  4I8O A;  3OH6 A;  3HS8 A;  3EIK A;  4Q11 A;  2NOZ A;  4EJY A;  4EAK A;  1E42 A;  3D7Q A;  3C04 A;  2PWW A;  3RPJ A;  2QRD A;  2NOE A;  4HJH A;  2NOF A;  1VOL B;  3F7P A;  2YRN A;  3OSM A;  5IYC P;  3HOP A;  2K3S A;  1QN4 A;  1WYM A;  5A4B A;  1QNB A;  1P5S A;  3I3W A;  2FUV A;  3ASM A;  2F7L A;  2R0O A;  1J3M A;  2K2R A;  4D7R A;  1PCZ A;  1KYU A;  2NWV A;  2WFN A;  3KMU B;  2DKC A;  1UJO A;  1RT8 A;  1TBA B;  1PZD A;  5IYB P;  1PCJ X;  3CWA A;  3JAL M;  3REP B;  1TBP A;  1QNA A;  1KYF A;  2MZ8 A;  5L0O A;  2Z0F A;  4D7Q A;  2QJX A;  3DPU A;  4EDM A;  2IV8 A;  2D86 A;  1M5Q 1;  2OOX A;  3HOC A;  2QR1 A;  4TPS A;  2NOI A;  2QLV A;  4DUL A;  4EAL A;  2I5W A;  2G30 A;  4ROC B;  5BVR A;  2Y8Q A;  1WYP A;  1LXT A;  2D87 A;  4EDL A;  1SH5 A;  1MB8 A;  1LWW A;  1C9B B;  1PCM X;  1UEG A;  4WX8 A;  1KFQ A;  2EHB D;  4Q59 A;  1QN9 A;  3CW7 A;  1WYR A;  4MRQ A;  1YQM A;  2JHJ A;  2O3O A;  2D0C A;  2Y8L A;  3BKQ X;  1PA7 A;  4TXK A;  1YQK A;  3OH9 A;  3N89 A;  4EJZ A;  2HZM A;  2NLV A;  3KMW B;  1D3U A;  4Q58 A;  1WKU A;  2WA6 A;  2XHI A;  1N39 A;  2QJZ A;  1KY7 A;  2EE7 A;  1VTL E;  1TJT A;  3CWT A;  4EAG A;  3OLP A;  1KY6 A;  3CO1 A;  1NGM A;  3D4V A;  4WZS D;  3PDK A;  5BMP A;  4B0A A;  1DXX A;  2VZI B;  2HL8 A;  4DDP A;  1AOA A;  2JV9 A;  1VKA A;  1CDW A;  1VKL A;  2V9J A;  1UT7 A;  3HOR A;  2IV9 A;  2VJ0 A;  1VTO A;  2D0B A;  3TDH A;  1LWY A;  4CFF A;  1TGH A;  2H5A X;  2VZG B;  3H1Z A;  3I0W A;  5FMU A;  2FKF A;  2D89 A;  4TXI A;  1B9K A;  5J8E A;  5JMV D;  3ENC A;  5A38 A;  1UL7 A;  5EPC A;  3CWU A;  1K35 A;  2WE6 A;  3HS9 A;  1VOK A;  2OOY A;  1RM1 A;  4LVR A;  3DPT A;  3OC3 C;  3SNS A;  2R5X A;  3EAY A;  5A37 A;  3KTU A;  2VZC A;  4PY5 A;  5AN4 A;  3OGD A;  2LAE A;  3T4N A;  2HL9 A;  1H67 A;  5FMT A;  1LWV A;  1QTP A;  2QRE A;  4EDN A;  5IYD P;  2YH5 A;  1QN8 A;  2NOL A;  1V5S A;  1P2X A;  3JAK M;  2IGP A;  4ROE B;  2FGT A;  2D88 A;  1QTS A;  1N3A A;  2WA7 A;  1YTB A;  2YA3 A;  3F0Z A;  1QNC A;  1EBM A;  2WDT A;  2MJ7 A;  1QN6 A;  5JN5 A;  1P5G X;  2NOH A;  3CVS A;  2QRC A;  2VZD A;  2H4L X;  1BHD A;  2EYI A;  4EAI A;  5HSH A;  1EUV A;  2HKP A;  3KRM A;  1KO9 A;  1QAG A;  1XSZ A;  1C47 A;  2E9K A;  3PMG A;  1QNE A;  3CWS A;  4ROD B;  1WYN A;  5A36 A;  4WXA A;  3I0X A;  1DIZ A;  1WJW A;  1NH2 A;  2DK9 A;  1YQR A;  3RSM A;  1QN5 A;  3KY9 A;  2V92 A;  3CVT A;  1JDY A;  2Z8U A;  4LVP A;  1KYD A;  1KFI A;  1V5K A;  3ENO C;  4C7P A;  3OST A;  2D0A A;  1T6A A;  3TE5 A;  2L3G A;  1Q9U A;  1WQA A;  4QG5 A;  1WIX A;  3FER A;  2EYN A;  3ULX A;  1QN3 A;  1NVP A;  4EAJ A;  3I6X A;  2R8U A;  1BKR A;  3UW2 A;  5KL0 A;  2VE7 C;  1PXY A;  4BJU A;  1WYL A;  2VE7 A;  1K2Y X;  1YQL A;  1WJO A;  1R4X A;  1AA2 A;  2JHN A;  3IH7 A;  1TUO A;  3VP7 A;  1N3C A;  1UT4 A;  2JOI A;  2DKD A;  2V8Q A;  1C4G A;  1AIS A; 
#chains in the Genus database with same CATH homology
 3EAY A;  2IGP A;  4LVP A;  2EQO A;  2HL8 A;  2HL9 A;  2VE7 C;  5FMU A;  2WDT A;  5FMT A;  3VP7 A;  4LVR A;  1EUV A;  2HKP A;  4DDP A;  2WE6 A;  2VE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...