2HL9A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfonic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
217
Chain Sequence
SLVPELNEKDDDQVQKALASRENTQLMNRIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 217
sequence length 220
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl9A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl9A02
1EUVA 2HL9A 3EAYA 2HL8A 2HKPA
chains in the Genus database with same CATH superfamily
4QG5A 1UT7A 2I5WA 1QN3A 4EALA 2WFNA 1MPGA 2F7LA 1W80A 1PVSA 2H4LX 1VOLB 1KYDA 3JARM 1WIXA 3REPB 5AN4A 1D3UA 1QN9A 1N3AA 2FKMX 4EAJA 4EDLA 2EYIA 2DKDA 1C9BB 3I6XA 3ENCA 2JPIA 4EAGA 3CWUA 1K2YX 1SH5A 1PCMX 2WA5A 3KMWB 4D7RA 1VKLA 3SNSA 2XHIA 3HORA 1KY7A 4HJHA 1LWVA 3D7QA 2VZCA 2JHNA 1QN5A 1MB8A 1WYLA 3PMGA 4TPSA 1KO9A 1WYOA 1YQMA 4EJZA 2NOHA 5BVRA 1TJTA 1N39A 1LWYA 1WJWA 2QRDA 1NGMA 2QR1A 2VZDA 2WA6A 1UL7A 1EBMA 1QNBA 2OOYA 1AOAA 1Q9UA 2PWWA 1E42A 2QJZA 1P5GX 1NVPA 1LWWA 1KYUA 3OC3C 2NOFA 2VZGB 5A36A 2QLVA 1VOKA 2D88A 2DKAA 2V92A 1QN7A 2RR8A 2WDTA 1BKRA 4EDMA 1YTBA 2ZFDB 1V5SA 3CWAA 3H1ZA 1EUVA 3CVSA 2VZIB 2HZMA 2G30A 3JAKM 4RODB 3KRMA 4EAKA 1V5KA 1J3MA 1PCJX 3I3WA 4MRQA 1YQKA 4Q57B 3NA5A 1PZDA 1P2XA 1RT8A 3CWTA 1P5SA 3F10A 5J8EA 1TBAB 4EDNA 3OH9A 1PCZA 3KTUA 5IYDP 1WKUA 1QNCA 5BMPA 4CFFA 2JHJA 2V9JA 1TUOA 2D0AA 2D0CA 1WYMA 1QNAA 2EQOA 3I0XA 1UT4A 2HL9A 3CWSA 2YRNA 4IL8A 4LVRA 2NWVA 2Z0FA 2D89A 4LVPA 4ROCB 1H67A 3KY9A 1R4XA 2DK9A 5A38A 1B9KA 3I0WA 4TXIA 4ROEB 2NOZA 2DKCA 3C04A 4DULA 1RM1A 2NOIA 4C7PA 2FUVA 2YH5A 4Q59A 2Y8LA 1QAGA 2WE6A 2QRCA 4Q58A 1PXYA 1KY6A 3ULXA 2Z8UA 2IV9A 3EIKA 2FKFA 3D4VA 4EJYA 2IGPA 2HZSA 2L3GA 1P5DX 1QNEA 1XSZA 3VP7A 2VE7C 3ENOC 2JOIA 3ASMA 3OGDA 2OOXA 4Q11A 2R0OA 2E9KA 2R8UA 4TXKA 2O3OA 1QTPA 5F9CA 1WYRA 1TGHA 3F7PA 1HU0A 3VN5A 5KL0A 2QREA 1FN7A 1UJOA 5A37A 2H5AX 3PDKA 5HSHA 1BHDA 2NVMA 2R5XA 1WYPA 1N3CA 2QJXA 1PA7A 2WA7A 2NOLA 1KYFA 2NOBA 3OCIA 3RPJA 4I8OA 3BKQX 1WYNA 1NH2A 2EYNA 1YQRA 1WJOA 2YA3A 3TE5A 4B7LA 3HOCA 2EE7A 3KMUB 2FGTA 2D85A 1KFIA 1DIZA 2K3SA 1QN8A 2HKPA 2LAEA 3EAYA 1YTFA 1C4GA 4B0AA 1M3QA 1CDWA 2MZ8A 1VTOA 4DDPA 3FERA 1LXTA 5BMNA 4BJUA 3HS8A 1QTSA 3OH6A 2MJ7A 3DPUA 4PY5A 3OSMA 3JALM 3OLPA 3RSMA 3DPTA 3OSEA 1KFQA 1C47A 3OSTA 2VJ0A 5IYBP 1JDYA 1MP9A 3F0ZA 1QN4A 2Y8QA 1WYQA 4WXAA 4WZSD 1SH6A 5L0OA 1YQLA 2D0BA 1VTLE 4EAIA 2D86A 4D7QA 1QN6A 2V8QA 1T6AA 1M5Q1 5JMVD 3HOPA 2EHBD 1DXXA 3UW2A 1VKAA 5JN5A 2K2RA 1TBPA 1AISA 2D87A 5EPCA 1AA2A 5FMTA 3CO1A 2NLVA 4WX8A 3IH7A 3CVTA 1UEGA 5FMUA 3T4NA 2VE7A 3HS9A 1K35A 2JV9A 2IV8A 3CW7A 5A4BA 3N89A 3TDHA 5IYCP 2NOEA 2HL8A 1M3HA 1JFIC 1WQAA
chains in the Genus database with same CATH topology
5FMUA 2EQOA 1EUVA 2HL9A 4DDPA 3EAYA 2VE7A 2IGPA 2HL8A 2WE6A 5FMTA 2WDTA 4LVRA 4LVPA 3VP7A 2VE7C 2HKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUV A;  2HL9 A;  3EAY A;  2HL8 A;  2HKP A; 
#chains in the Genus database with same CATH topology
 4QG5 A;  1UT7 A;  2I5W A;  1QN3 A;  4EAL A;  2WFN A;  1MPG A;  2F7L A;  1W80 A;  1PVS A;  2H4L X;  1VOL B;  1KYD A;  3JAR M;  1WIX A;  3REP B;  5AN4 A;  1D3U A;  1QN9 A;  1N3A A;  2FKM X;  4EAJ A;  4EDL A;  2EYI A;  2DKD A;  1C9B B;  3I6X A;  3ENC A;  2JPI A;  4EAG A;  3CWU A;  1K2Y X;  1SH5 A;  1PCM X;  2WA5 A;  3KMW B;  4D7R A;  1VKL A;  3SNS A;  2XHI A;  3HOR A;  1KY7 A;  4HJH A;  1LWV A;  3D7Q A;  2VZC A;  2JHN A;  1QN5 A;  1MB8 A;  1WYL A;  3PMG A;  4TPS A;  1KO9 A;  1WYO A;  1YQM A;  4EJZ A;  2NOH A;  5BVR A;  1TJT A;  1N39 A;  1LWY A;  1WJW A;  2QRD A;  1NGM A;  2QR1 A;  2VZD A;  2WA6 A;  1UL7 A;  1EBM A;  1QNB A;  2OOY A;  1AOA A;  1Q9U A;  2PWW A;  1E42 A;  2QJZ A;  1P5G X;  1NVP A;  1LWW A;  1KYU A;  3OC3 C;  2NOF A;  2VZG B;  5A36 A;  2QLV A;  1VOK A;  2D88 A;  2DKA A;  2V92 A;  1QN7 A;  2RR8 A;  2WDT A;  1BKR A;  4EDM A;  1YTB A;  2ZFD B;  1V5S A;  3CWA A;  3H1Z A;  1EUV A;  3CVS A;  2VZI B;  2HZM A;  2G30 A;  3JAK M;  4ROD B;  3KRM A;  4EAK A;  1V5K A;  1J3M A;  1PCJ X;  3I3W A;  4MRQ A;  1YQK A;  4Q57 B;  3NA5 A;  1PZD A;  1P2X A;  1RT8 A;  3CWT A;  1P5S A;  3F10 A;  5J8E A;  1TBA B;  4EDN A;  3OH9 A;  1PCZ A;  3KTU A;  5IYD P;  1WKU A;  1QNC A;  5BMP A;  4CFF A;  2JHJ A;  2V9J A;  1TUO A;  2D0A A;  2D0C A;  1WYM A;  1QNA A;  2EQO A;  3I0X A;  1UT4 A;  2HL9 A;  3CWS A;  2YRN A;  4IL8 A;  4LVR A;  2NWV A;  2Z0F A;  2D89 A;  4LVP A;  4ROC B;  1H67 A;  3KY9 A;  1R4X A;  2DK9 A;  5A38 A;  1B9K A;  3I0W A;  4TXI A;  4ROE B;  2NOZ A;  2DKC A;  3C04 A;  4DUL A;  1RM1 A;  2NOI A;  4C7P A;  2FUV A;  2YH5 A;  4Q59 A;  2Y8L A;  1QAG A;  2WE6 A;  2QRC A;  4Q58 A;  1PXY A;  1KY6 A;  3ULX A;  2Z8U A;  2IV9 A;  3EIK A;  2FKF A;  3D4V A;  4EJY A;  2IGP A;  2HZS A;  2L3G A;  1P5D X;  1QNE A;  1XSZ A;  3VP7 A;  2VE7 C;  3ENO C;  2JOI A;  3ASM A;  3OGD A;  2OOX A;  4Q11 A;  2R0O A;  2E9K A;  2R8U A;  4TXK A;  2O3O A;  1QTP A;  5F9C A;  1WYR A;  1TGH A;  3F7P A;  1HU0 A;  3VN5 A;  5KL0 A;  2QRE A;  1FN7 A;  1UJO A;  5A37 A;  2H5A X;  3PDK A;  5HSH A;  1BHD A;  2NVM A;  2R5X A;  1WYP A;  1N3C A;  2QJX A;  1PA7 A;  2WA7 A;  2NOL A;  1KYF A;  2NOB A;  3OCI A;  3RPJ A;  4I8O A;  3BKQ X;  1WYN A;  1NH2 A;  2EYN A;  1YQR A;  1WJO A;  2YA3 A;  3TE5 A;  4B7L A;  3HOC A;  2EE7 A;  3KMU B;  2FGT A;  2D85 A;  1KFI A;  1DIZ A;  2K3S A;  1QN8 A;  2HKP A;  2LAE A;  3EAY A;  1YTF A;  1C4G A;  4B0A A;  1M3Q A;  1CDW A;  2MZ8 A;  1VTO A;  4DDP A;  3FER A;  1LXT A;  5BMN A;  4BJU A;  3HS8 A;  1QTS A;  3OH6 A;  2MJ7 A;  3DPU A;  4PY5 A;  3OSM A;  3JAL M;  3OLP A;  3RSM A;  3DPT A;  3OSE A;  1KFQ A;  1C47 A;  3OST A;  2VJ0 A;  5IYB P;  1JDY A;  1MP9 A;  3F0Z A;  1QN4 A;  2Y8Q A;  1WYQ A;  4WXA A;  4WZS D;  1SH6 A;  5L0O A;  1YQL A;  2D0B A;  1VTL E;  4EAI A;  2D86 A;  4D7Q A;  1QN6 A;  2V8Q A;  1T6A A;  1M5Q 1;  5JMV D;  3HOP A;  2EHB D;  1DXX A;  3UW2 A;  1VKA A;  5JN5 A;  2K2R A;  1TBP A;  1AIS A;  2D87 A;  5EPC A;  1AA2 A;  5FMT A;  3CO1 A;  2NLV A;  4WX8 A;  3IH7 A;  3CVT A;  1UEG A;  5FMU A;  3T4N A;  2VE7 A;  3HS9 A;  1K35 A;  2JV9 A;  2IV8 A;  3CW7 A;  5A4B A;  3N89 A;  3TDH A;  5IYC P;  2NOE A;  2HL8 A;  1M3H A;  1JFI C;  1WQA A; 
#chains in the Genus database with same CATH homology
 5FMU A;  2EQO A;  1EUV A;  2HL9 A;  4DDP A;  3EAY A;  2VE7 A;  2IGP A;  2HL8 A;  2WE6 A;  5FMT A;  2WDT A;  4LVR A;  4LVP A;  3VP7 A;  2VE7 C;  2HKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...