4EDLA

Crystal structure of beta-parvin ch2 domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
129
structure length
129
Chain Sequence
RFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-parvin
publication title Structural basis for paxillin binding and focal adhesion targeting of beta-parvin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 43
structure length 129
sequence length 129
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 4edlA00
1WJOA 2R8UA 1WIXA 2R0OA 2RR8A 2JV9A 5A4BA 5A38A 1P5SA 2WA7A 4TXKA 3HORA 2VZIB 4Q58A 1WKUA 1WYQA 4Q57B 3JALM 3FERA 5BVRA 1WYPA 1WYOA 1VKAA 1MB8A 2WFNA 5J8EA 1PXYA 4TXIA 3KMWB 2VZCA 2D86A 1AA2A 1V5KA 3KY9A 1WYRA 2YRNA 3CO1A 1TJTA 2VZDA 1AOAA 5L0OA 3HOCA 2E9KA 2QJXA 2D88A 2VZGB 2D87A 1SH5A 5A36A 1P2XA 4B7LA 1QAGA 2D85A 2WA5A 3REPB 4EDMA 2EE7A 2EYNA 2QJZA 3I6XA 3JARM 1H67A 1RT8A 1PA7A 1BKRA 1WYLA 2DK9A 4Q59A 3KMUB 3HOPA 1UJOA 1WYMA 1DXXA 5A37A 2L3GA 1WYNA 1UEGA 3F7PA 4EDNA 2K2RA 4EDLA 2K3SA 2EYIA 2WA6A 3JAKM 1SH6A 2D89A 1BHDA
chains in the Genus database with same CATH superfamily
1WJOA 2R8UA 1WIXA 2R0OA 2RR8A 2JV9A 5A4BA 5A38A 1EUVA 1P5SA 2EQOA 2WA7A 2IGPA 4TXKA 3HORA 2VZIB 4Q58A 1WKUA 2VE7C 1WYQA 4Q57B 3JALM 3FERA 5BVRA 1WYPA 1WYOA 1VKAA 1MB8A 2WFNA 5FMTA 5J8EA 1PXYA 2HKPA 4TXIA 3KMWB 2VZCA 2D86A 1AA2A 1V5KA 3KY9A 1WYRA 2YRNA 2VE7A 3CO1A 1TJTA 2VZDA 1AOAA 5L0OA 3HOCA 2E9KA 2QJXA 2D88A 2VZGB 2D87A 1SH5A 5A36A 1P2XA 2WE6A 4B7LA 1QAGA 2D85A 2WA5A 3REPB 3VP7A 4EDMA 2EE7A 2EYNA 2QJZA 3I6XA 3JARM 1H67A 1RT8A 1PA7A 1BKRA 1WYLA 2DK9A 4Q59A 3KMUB 2HL8A 3HOPA 1UJOA 4DDPA 4LVRA 1WYMA 4LVPA 2WDTA 1DXXA 5A37A 2HL9A 2L3GA 1WYNA 1UEGA 3F7PA 4EDNA 5FMUA 2K2RA 4EDLA 2K3SA 2EYIA 2WA6A 3JAKM 3EAYA 1SH6A 2D89A 1BHDA
chains in the Genus database with same CATH topology
1WJOA 2R8UA 1WIXA 2R0OA 2RR8A 2JV9A 5A4BA 5A38A 1P5SA 2WA7A 4TXKA 3HORA 2VZIB 4Q58A 1WKUA 1WYQA 4Q57B 3JALM 3FERA 5BVRA 1WYPA 1WYOA 1VKAA 1MB8A 2WFNA 5J8EA 1PXYA 4TXIA 3KMWB 2VZCA 2D86A 1AA2A 1V5KA 3KY9A 1WYRA 2YRNA 3CO1A 1TJTA 2VZDA 1AOAA 5L0OA 3HOCA 2E9KA 2QJXA 2D88A 2VZGB 2D87A 1SH5A 5A36A 1P2XA 4B7LA 1QAGA 2D85A 2WA5A 3REPB 4EDMA 2EE7A 2EYNA 2QJZA 3I6XA 3JARM 1H67A 1RT8A 1PA7A 1BKRA 1WYLA 2DK9A 4Q59A 3KMUB 3HOPA 1UJOA 1WYMA 1DXXA 5A37A 2L3GA 1WYNA 1UEGA 3F7PA 4EDNA 2K2RA 4EDLA 2K3SA 2EYIA 2WA6A 3JAKM 1SH6A 2D89A 1BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJO A;  2R8U A;  1WIX A;  2R0O A;  2RR8 A;  2JV9 A;  5A4B A;  5A38 A;  1P5S A;  2WA7 A;  4TXK A;  3HOR A;  2VZI B;  4Q58 A;  1WKU A;  1WYQ A;  4Q57 B;  3JAL M;  3FER A;  5BVR A;  1WYP A;  1WYO A;  1VKA A;  1MB8 A;  2WFN A;  5J8E A;  1PXY A;  4TXI A;  3KMW B;  2VZC A;  2D86 A;  1AA2 A;  1V5K A;  3KY9 A;  1WYR A;  2YRN A;  3CO1 A;  1TJT A;  2VZD A;  1AOA A;  5L0O A;  3HOC A;  2E9K A;  2QJX A;  2D88 A;  2VZG B;  2D87 A;  1SH5 A;  5A36 A;  1P2X A;  4B7L A;  1QAG A;  2D85 A;  2WA5 A;  3REP B;  4EDM A;  2EE7 A;  2EYN A;  2QJZ A;  3I6X A;  3JAR M;  1H67 A;  1RT8 A;  1PA7 A;  1BKR A;  1WYL A;  2DK9 A;  4Q59 A;  3KMU B;  3HOP A;  1UJO A;  1WYM A;  1DXX A;  5A37 A;  2L3G A;  1WYN A;  1UEG A;  3F7P A;  4EDN A;  2K2R A;  4EDL A;  2K3S A;  2EYI A;  2WA6 A;  3JAK M;  1SH6 A;  2D89 A;  1BHD A; 
#chains in the Genus database with same CATH topology
 1WJO A;  2R8U A;  1WIX A;  2R0O A;  2RR8 A;  2JV9 A;  5A4B A;  5A38 A;  1EUV A;  1P5S A;  2EQO A;  2WA7 A;  2IGP A;  4TXK A;  3HOR A;  2VZI B;  4Q58 A;  1WKU A;  2VE7 C;  1WYQ A;  4Q57 B;  3JAL M;  3FER A;  5BVR A;  1WYP A;  1WYO A;  1VKA A;  1MB8 A;  2WFN A;  5FMT A;  5J8E A;  1PXY A;  2HKP A;  4TXI A;  3KMW B;  2VZC A;  2D86 A;  1AA2 A;  1V5K A;  3KY9 A;  1WYR A;  2YRN A;  2VE7 A;  3CO1 A;  1TJT A;  2VZD A;  1AOA A;  5L0O A;  3HOC A;  2E9K A;  2QJX A;  2D88 A;  2VZG B;  2D87 A;  1SH5 A;  5A36 A;  1P2X A;  2WE6 A;  4B7L A;  1QAG A;  2D85 A;  2WA5 A;  3REP B;  3VP7 A;  4EDM A;  2EE7 A;  2EYN A;  2QJZ A;  3I6X A;  3JAR M;  1H67 A;  1RT8 A;  1PA7 A;  1BKR A;  1WYL A;  2DK9 A;  4Q59 A;  3KMU B;  2HL8 A;  3HOP A;  1UJO A;  4DDP A;  4LVR A;  1WYM A;  4LVP A;  2WDT A;  1DXX A;  5A37 A;  2HL9 A;  2L3G A;  1WYN A;  1UEG A;  3F7P A;  4EDN A;  5FMU A;  2K2R A;  4EDL A;  2K3S A;  2EYI A;  2WA6 A;  3JAK M;  3EAY A;  1SH6 A;  2D89 A;  1BHD A; 
#chains in the Genus database with same CATH homology
 1WJO A;  2R8U A;  1WIX A;  2R0O A;  2RR8 A;  2JV9 A;  5A4B A;  5A38 A;  1P5S A;  2WA7 A;  4TXK A;  3HOR A;  2VZI B;  4Q58 A;  1WKU A;  1WYQ A;  4Q57 B;  3JAL M;  3FER A;  5BVR A;  1WYP A;  1WYO A;  1VKA A;  1MB8 A;  2WFN A;  5J8E A;  1PXY A;  4TXI A;  3KMW B;  2VZC A;  2D86 A;  1AA2 A;  1V5K A;  3KY9 A;  1WYR A;  2YRN A;  3CO1 A;  1TJT A;  2VZD A;  1AOA A;  5L0O A;  3HOC A;  2E9K A;  2QJX A;  2D88 A;  2VZG B;  2D87 A;  1SH5 A;  5A36 A;  1P2X A;  4B7L A;  1QAG A;  2D85 A;  2WA5 A;  3REP B;  4EDM A;  2EE7 A;  2EYN A;  2QJZ A;  3I6X A;  3JAR M;  1H67 A;  1RT8 A;  1PA7 A;  1BKR A;  1WYL A;  2DK9 A;  4Q59 A;  3KMU B;  3HOP A;  1UJO A;  1WYM A;  1DXX A;  5A37 A;  2L3G A;  1WYN A;  1UEG A;  3F7P A;  4EDN A;  2K2R A;  4EDL A;  2K3S A;  2EYI A;  2WA6 A;  3JAK M;  1SH6 A;  2D89 A;  1BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...