1EUVA

X-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
GSLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ULP1 PROTEASE
publication title Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 221
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 1euvA01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 1euvA02
2HL8A 1EUVA 2HKPA 3EAYA 2HL9A
chains in the Genus database with same CATH superfamily
1LWWA 3FERA 1VOLB 1FN7A 2JHJA 1N39A 1YQRA 3TE5A 2NOEA 1K2YX 1MPGA 2O3OA 2I5WA 4MRQA 1SH6A 4EDLA 2IV8A 4CFFA 2NOIA 3SNSA 1NH2A 3ASMA 1W80A 5BVRA 2FGTA 2OOYA 1P5DX 2FUVA 3CWUA 3OH9A 1PZDA 5AN4A 2D87A 2V92A 4B7LA 1VTLE 3I0WA 4LVRA 5L0OA 4BJUA 2H4LX 4Q11A 2XHIA 2DKAA 3OGDA 2QR1A 3D7QA 5BMNA 2EYIA 5F9CA 2NOBA 4C7PA 3EIKA 2VZIB 1PCMX 1Q9UA 1WIXA 4DULA 2YRNA 3H1ZA 4D7RA 1M3HA 1UEGA 3I0XA 1EBMA 1RM1A 1P2XA 3IH7A 1N3CA 4EJZA 3TDHA 1KYUA 2R0OA 1RT8A 5A4BA 4TXKA 1TJTA 3HS8A 2D88A 1LWVA 3F0ZA 1VOKA 2V8QA 2Y8LA 1C47A 2QRCA 2HL9A 1QNEA 1B9KA 2D0AA 2VJ0A 4PY5A 3VP7A 2NLVA 4Q59A 1H67A 1NGMA 1QTPA 3OSMA 3N89A 3KTUA 3CO1A 2EYNA 5IYDP 1WYOA 3UW2A 3HS9A 2YA3A 2QLVA 1WYRA 1WYMA 3F7PA 3KMUB 3HOPA 1V5KA 2VZCA 5A36A 2WDTA 4EAIA 1QN6A 1EUVA 2LAEA 2V9JA 2OOXA 1V5SA 1MB8A 5JMVD 2WA6A 2Z8UA 1LXTA 4EAJA 3RSMA 2H5AX 3PMGA 3BKQX 2NOHA 3CVSA 1KO9A 3REPB 3DPUA 2FKMX 2D85A 1XSZA 2D0BA 4TPSA 2VE7C 1VKAA 3D4VA 2QREA 3HORA 1YTFA 1QAGA 2NOZA 1KFIA 1YQKA 1VKLA 3OH6A 4LVPA 2K3SA 3EAYA 3C04A 5BMPA 3JALM 3JARM 1P5SA 1PXYA 3RPJA 1NVPA 1CDWA 3F10A 5HSHA 2Y8QA 2NOFA 3I6XA 2EQOA 2D0CA 3ENCA 2VE7A 2DK9A 2L3GA 3I3WA 4WX8A 1C9BB 1TUOA 4Q58A 4EAGA 2WA7A 3CWTA 4HJHA 3KMWB 1UJOA 1DIZA 4Q57B 1QNBA 1VTOA 3KRMA 1WKUA 5KL0A 2K2RA 1M5Q1 3T4NA 1JDYA 3HOCA 1KYFA 1QNCA 3OSEA 5FMUA 3PDKA 4D7QA 1K35A 4EJYA 2DKDA 1YQLA 1QNAA 1PCJX 3KY9A 1UL7A 2PWWA 5A37A 1E42A 2R5XA 1PVSA 2Z0FA 1KYDA 2FKFA 3NA5A 2MJ7A 5JN5A 1KY7A 4WZSD 1P5GX 2JOIA 2RR8A 2JPIA 1M3QA 2HZSA 2VZDA 3CWAA 2VZGB 1HU0A 2MZ8A 1AOAA 4ROCB 4DDPA 3JAKM 1N3AA 4EDNA 2D89A 5IYCP 1QN3A 2QJZA 2G30A 5A38A 2EE7A 2HL8A 2NOLA 3ENOC 2JV9A 1WQAA 4EDMA 1WYNA 4EALA 2WE6A 4IL8A 2HKPA 2IV9A 4ROEB 3OSTA 4TXIA 2JHNA 3CWSA 2IGPA 1WYPA 1QTSA 1QN9A 2E9KA 1QN4A 1D3UA 5J8EA 3CW7A 2NVMA 1DXXA 1SH5A 1AA2A 5FMTA 2F7LA 3DPTA 1WJWA 2EHBD 1C4GA 1AISA 2WA5A 2NWVA 5IYBP 2QRDA 4RODB 2YH5A 1TGHA 1R4XA 1J3MA 2QJXA 4WXAA 5EPCA 3CVTA 2D86A 1YQMA 2R8UA 1KFQA 1PA7A 4EAKA 1BHDA 1UT4A 2WFNA 2HZMA 3OLPA 1TBAB 1LWYA 1WYQA 1KY6A 1BKRA 2DKCA 4QG5A 1UT7A 1TBPA 1MP9A 1T6AA 1QN8A 3VN5A 1JFIC 4I8OA 1QN7A 1YTBA 4B0AA 1PCZA 3OC3C 1QN5A 1WJOA 1WYLA 2ZFDB 3ULXA 3OCIA
chains in the Genus database with same CATH topology
2HL8A 1EUVA 2IGPA 2HKPA 2VE7A 4LVRA 4DDPA 3EAYA 2EQOA 5FMUA 2VE7C 2WE6A 4LVPA 3VP7A 5FMTA 2HL9A 2WDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL8 A;  1EUV A;  2HKP A;  3EAY A;  2HL9 A; 
#chains in the Genus database with same CATH topology
 1LWW A;  3FER A;  1VOL B;  1FN7 A;  2JHJ A;  1N39 A;  1YQR A;  3TE5 A;  2NOE A;  1K2Y X;  1MPG A;  2O3O A;  2I5W A;  4MRQ A;  1SH6 A;  4EDL A;  2IV8 A;  4CFF A;  2NOI A;  3SNS A;  1NH2 A;  3ASM A;  1W80 A;  5BVR A;  2FGT A;  2OOY A;  1P5D X;  2FUV A;  3CWU A;  3OH9 A;  1PZD A;  5AN4 A;  2D87 A;  2V92 A;  4B7L A;  1VTL E;  3I0W A;  4LVR A;  5L0O A;  4BJU A;  2H4L X;  4Q11 A;  2XHI A;  2DKA A;  3OGD A;  2QR1 A;  3D7Q A;  5BMN A;  2EYI A;  5F9C A;  2NOB A;  4C7P A;  3EIK A;  2VZI B;  1PCM X;  1Q9U A;  1WIX A;  4DUL A;  2YRN A;  3H1Z A;  4D7R A;  1M3H A;  1UEG A;  3I0X A;  1EBM A;  1RM1 A;  1P2X A;  3IH7 A;  1N3C A;  4EJZ A;  3TDH A;  1KYU A;  2R0O A;  1RT8 A;  5A4B A;  4TXK A;  1TJT A;  3HS8 A;  2D88 A;  1LWV A;  3F0Z A;  1VOK A;  2V8Q A;  2Y8L A;  1C47 A;  2QRC A;  2HL9 A;  1QNE A;  1B9K A;  2D0A A;  2VJ0 A;  4PY5 A;  3VP7 A;  2NLV A;  4Q59 A;  1H67 A;  1NGM A;  1QTP A;  3OSM A;  3N89 A;  3KTU A;  3CO1 A;  2EYN A;  5IYD P;  1WYO A;  3UW2 A;  3HS9 A;  2YA3 A;  2QLV A;  1WYR A;  1WYM A;  3F7P A;  3KMU B;  3HOP A;  1V5K A;  2VZC A;  5A36 A;  2WDT A;  4EAI A;  1QN6 A;  1EUV A;  2LAE A;  2V9J A;  2OOX A;  1V5S A;  1MB8 A;  5JMV D;  2WA6 A;  2Z8U A;  1LXT A;  4EAJ A;  3RSM A;  2H5A X;  3PMG A;  3BKQ X;  2NOH A;  3CVS A;  1KO9 A;  3REP B;  3DPU A;  2FKM X;  2D85 A;  1XSZ A;  2D0B A;  4TPS A;  2VE7 C;  1VKA A;  3D4V A;  2QRE A;  3HOR A;  1YTF A;  1QAG A;  2NOZ A;  1KFI A;  1YQK A;  1VKL A;  3OH6 A;  4LVP A;  2K3S A;  3EAY A;  3C04 A;  5BMP A;  3JAL M;  3JAR M;  1P5S A;  1PXY A;  3RPJ A;  1NVP A;  1CDW A;  3F10 A;  5HSH A;  2Y8Q A;  2NOF A;  3I6X A;  2EQO A;  2D0C A;  3ENC A;  2VE7 A;  2DK9 A;  2L3G A;  3I3W A;  4WX8 A;  1C9B B;  1TUO A;  4Q58 A;  4EAG A;  2WA7 A;  3CWT A;  4HJH A;  3KMW B;  1UJO A;  1DIZ A;  4Q57 B;  1QNB A;  1VTO A;  3KRM A;  1WKU A;  5KL0 A;  2K2R A;  1M5Q 1;  3T4N A;  1JDY A;  3HOC A;  1KYF A;  1QNC A;  3OSE A;  5FMU A;  3PDK A;  4D7Q A;  1K35 A;  4EJY A;  2DKD A;  1YQL A;  1QNA A;  1PCJ X;  3KY9 A;  1UL7 A;  2PWW A;  5A37 A;  1E42 A;  2R5X A;  1PVS A;  2Z0F A;  1KYD A;  2FKF A;  3NA5 A;  2MJ7 A;  5JN5 A;  1KY7 A;  4WZS D;  1P5G X;  2JOI A;  2RR8 A;  2JPI A;  1M3Q A;  2HZS A;  2VZD A;  3CWA A;  2VZG B;  1HU0 A;  2MZ8 A;  1AOA A;  4ROC B;  4DDP A;  3JAK M;  1N3A A;  4EDN A;  2D89 A;  5IYC P;  1QN3 A;  2QJZ A;  2G30 A;  5A38 A;  2EE7 A;  2HL8 A;  2NOL A;  3ENO C;  2JV9 A;  1WQA A;  4EDM A;  1WYN A;  4EAL A;  2WE6 A;  4IL8 A;  2HKP A;  2IV9 A;  4ROE B;  3OST A;  4TXI A;  2JHN A;  3CWS A;  2IGP A;  1WYP A;  1QTS A;  1QN9 A;  2E9K A;  1QN4 A;  1D3U A;  5J8E A;  3CW7 A;  2NVM A;  1DXX A;  1SH5 A;  1AA2 A;  5FMT A;  2F7L A;  3DPT A;  1WJW A;  2EHB D;  1C4G A;  1AIS A;  2WA5 A;  2NWV A;  5IYB P;  2QRD A;  4ROD B;  2YH5 A;  1TGH A;  1R4X A;  1J3M A;  2QJX A;  4WXA A;  5EPC A;  3CVT A;  2D86 A;  1YQM A;  2R8U A;  1KFQ A;  1PA7 A;  4EAK A;  1BHD A;  1UT4 A;  2WFN A;  2HZM A;  3OLP A;  1TBA B;  1LWY A;  1WYQ A;  1KY6 A;  1BKR A;  2DKC A;  4QG5 A;  1UT7 A;  1TBP A;  1MP9 A;  1T6A A;  1QN8 A;  3VN5 A;  1JFI C;  4I8O A;  1QN7 A;  1YTB A;  4B0A A;  1PCZ A;  3OC3 C;  1QN5 A;  1WJO A;  1WYL A;  2ZFD B;  3ULX A;  3OCI A; 
#chains in the Genus database with same CATH homology
 2HL8 A;  1EUV A;  2IGP A;  2HKP A;  2VE7 A;  4LVR A;  4DDP A;  3EAY A;  2EQO A;  5FMU A;  2VE7 C;  2WE6 A;  4LVP A;  3VP7 A;  5FMT A;  2HL9 A;  2WDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...