1EUVA

X-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
GSLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ULP1 PROTEASE
publication title Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 221
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 1euvA01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 1euvA02
2HL8A 2HKPA 2HL9A 1EUVA 3EAYA
chains in the Genus database with same CATH superfamily
3IH7A 2HKPA 1TBAB 2VE7C 2DKAA 3TE5A 5HSHA 1K2YX 2QJZA 1N3CA 1YQMA 2WFNA 1YTBA 3FERA 3KY9A 1PVSA 2F7LA 3I3WA 1SH6A 1C47A 4WX8A 1V5KA 1WJOA 3EIKA 3ASMA 3EAYA 2QLVA 1TJTA 2O3OA 3OSTA 3D7QA 3HS8A 3H1ZA 2NWVA 2VZGB 1QN9A 3HOPA 4Q57B 3KMWB 3VN5A 4EAKA 1LXTA 2OOYA 2VE7A 1DXXA 4EJZA 5IYBP 1QTSA 1NGMA 5FMTA 4IL8A 1MP9A 1VTOA 2EYNA 4TXIA 3KRMA 1XSZA 1QN5A 2G30A 1WYQA 2NLVA 3F0ZA 1AA2A 1PXYA 3JARM 3F7PA 1KFQA 1KY7A 3OCIA 2NOIA 4I8OA 1RT8A 1UT4A 2NOEA 2MJ7A 2DK9A 4HJHA 3F10A 1LWWA 4D7RA 2HL8A 2Y8QA 1N39A 2OOXA 5JN5A 3OSEA 1M3QA 1WYRA 1QNBA 5BVRA 5AN4A 1QTPA 4CFFA 2VJ0A 2IGPA 3HOCA 3BKQX 2JHNA 1QN8A 2FUVA 4LVRA 2XHIA 3CW7A 2H5AX 3ENCA 2DKDA 2MZ8A 2NOLA 1P5SA 2FGTA 1WQAA 1WYMA 2WA5A 2EYIA 1WYPA 1KFIA 4WZSD 4C7PA 1KO9A 1R4XA 2D88A 1QN7A 1QN4A 1CDWA 1EBMA 5L0OA 2H4LX 1M5Q1 2K3SA 3PMGA 1YQKA 1WKUA 2WE6A 3HS9A 2D0BA 1WYOA 1VOLB 3CWUA 2D89A 1UL7A 4EJYA 1UEGA 2VZCA 2EHBD 2JHJA 2QR1A 1PZDA 2LAEA 2D0AA 3OC3C 3REPB 5A36A 2FKFA 4TPSA 2V92A 1BHDA 1YQRA 1LWVA 2NOZA 1FN7A 3CWSA 3NA5A 4DDPA 3KTUA 2QREA 3N89A 2JPIA 5FMUA 1QNCA 2NOHA 2VZIB 5EPCA 3OLPA 4ROCB 2D87A 2QJXA 2HZMA 1C9BB 1VOKA 5A37A 4Q59A 3CVSA 1SH5A 2DKCA 1JDYA 2R0OA 2YH5A 1AOAA 4LVPA 1PCZA 3ULXA 2R8UA 2NVMA 1EUVA 2EQOA 2YA3A 2YRNA 2I5WA 3VP7A 1P2XA 5JMVD 1PCMX 3UW2A 1QNEA 3JALM 1JFIC 3OH6A 1KYUA 2IV9A 1VKLA 2L3GA 2JV9A 3RSMA 2PWWA 2R5XA 2K2RA 4EAGA 1TGHA 1P5GX 1W80A 2WA6A 2Z0FA 1VKAA 2RR8A 1E42A 3RPJA 1QN6A 1RM1A 5KL0A 1V5SA 3PDKA 1YTFA 1KYFA 2E9KA 3CWTA 3DPUA 2V9JA 4PY5A 1PCJX 1QNAA 1MB8A 5J8EA 3TDHA 1UT7A 1Q9UA 1D3UA 4WXAA 1YQLA 4Q11A 2VZDA 2D86A 1N3AA 1C4GA 1TBPA 1LWYA 2D0CA 3I0XA 1TUOA 3D4VA 2FKMX 1BKRA 1H67A 1K35A 2WDTA 3T4NA 3OSMA 3C04A 1VTLE 3I0WA 1WYLA 3CVTA 4TXKA 1QAGA 1KY6A 4B0AA 2QRCA 1WYNA 1PA7A 1NH2A 1WIXA 1AISA 3DPTA 1DIZA 2V8QA 4ROEB 3I6XA 4D7QA 1UJOA 3OGDA 3CWAA 4RODB 3JAKM 1QN3A 2HZSA 2NOBA 4EDNA 4EDMA 1NVPA 4BJUA 4EALA 2JOIA 4B7LA 2D85A 1WJWA 5A38A 2WA7A 3ENOC 1T6AA 5IYCP 3CO1A 4MRQA 3OH9A 5F9CA 2ZFDB 1P5DX 1B9KA 4QG5A 4EAJA 4EAIA 4EDLA 3HORA 2NOFA 4DULA 1KYDA 1HU0A 1J3MA 1M3HA 2QRDA 5A4BA 5BMPA 2HL9A 2EE7A 3SNSA 2Y8LA 4Q58A 2Z8UA 3KMUB 5IYDP 5BMNA 1MPGA 2IV8A
chains in the Genus database with same CATH topology
2HL8A 2HKPA 2WE6A 4LVPA 5FMTA 5FMUA 2IGPA 4DDPA 4LVRA 3VP7A 2WDTA 2VE7C 2HL9A 2VE7A 1EUVA 2EQOA 3EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL8 A;  2HKP A;  2HL9 A;  1EUV A;  3EAY A; 
#chains in the Genus database with same CATH topology
 3IH7 A;  2HKP A;  1TBA B;  2VE7 C;  2DKA A;  3TE5 A;  5HSH A;  1K2Y X;  2QJZ A;  1N3C A;  1YQM A;  2WFN A;  1YTB A;  3FER A;  3KY9 A;  1PVS A;  2F7L A;  3I3W A;  1SH6 A;  1C47 A;  4WX8 A;  1V5K A;  1WJO A;  3EIK A;  3ASM A;  3EAY A;  2QLV A;  1TJT A;  2O3O A;  3OST A;  3D7Q A;  3HS8 A;  3H1Z A;  2NWV A;  2VZG B;  1QN9 A;  3HOP A;  4Q57 B;  3KMW B;  3VN5 A;  4EAK A;  1LXT A;  2OOY A;  2VE7 A;  1DXX A;  4EJZ A;  5IYB P;  1QTS A;  1NGM A;  5FMT A;  4IL8 A;  1MP9 A;  1VTO A;  2EYN A;  4TXI A;  3KRM A;  1XSZ A;  1QN5 A;  2G30 A;  1WYQ A;  2NLV A;  3F0Z A;  1AA2 A;  1PXY A;  3JAR M;  3F7P A;  1KFQ A;  1KY7 A;  3OCI A;  2NOI A;  4I8O A;  1RT8 A;  1UT4 A;  2NOE A;  2MJ7 A;  2DK9 A;  4HJH A;  3F10 A;  1LWW A;  4D7R A;  2HL8 A;  2Y8Q A;  1N39 A;  2OOX A;  5JN5 A;  3OSE A;  1M3Q A;  1WYR A;  1QNB A;  5BVR A;  5AN4 A;  1QTP A;  4CFF A;  2VJ0 A;  2IGP A;  3HOC A;  3BKQ X;  2JHN A;  1QN8 A;  2FUV A;  4LVR A;  2XHI A;  3CW7 A;  2H5A X;  3ENC A;  2DKD A;  2MZ8 A;  2NOL A;  1P5S A;  2FGT A;  1WQA A;  1WYM A;  2WA5 A;  2EYI A;  1WYP A;  1KFI A;  4WZS D;  4C7P A;  1KO9 A;  1R4X A;  2D88 A;  1QN7 A;  1QN4 A;  1CDW A;  1EBM A;  5L0O A;  2H4L X;  1M5Q 1;  2K3S A;  3PMG A;  1YQK A;  1WKU A;  2WE6 A;  3HS9 A;  2D0B A;  1WYO A;  1VOL B;  3CWU A;  2D89 A;  1UL7 A;  4EJY A;  1UEG A;  2VZC A;  2EHB D;  2JHJ A;  2QR1 A;  1PZD A;  2LAE A;  2D0A A;  3OC3 C;  3REP B;  5A36 A;  2FKF A;  4TPS A;  2V92 A;  1BHD A;  1YQR A;  1LWV A;  2NOZ A;  1FN7 A;  3CWS A;  3NA5 A;  4DDP A;  3KTU A;  2QRE A;  3N89 A;  2JPI A;  5FMU A;  1QNC A;  2NOH A;  2VZI B;  5EPC A;  3OLP A;  4ROC B;  2D87 A;  2QJX A;  2HZM A;  1C9B B;  1VOK A;  5A37 A;  4Q59 A;  3CVS A;  1SH5 A;  2DKC A;  1JDY A;  2R0O A;  2YH5 A;  1AOA A;  4LVP A;  1PCZ A;  3ULX A;  2R8U A;  2NVM A;  1EUV A;  2EQO A;  2YA3 A;  2YRN A;  2I5W A;  3VP7 A;  1P2X A;  5JMV D;  1PCM X;  3UW2 A;  1QNE A;  3JAL M;  1JFI C;  3OH6 A;  1KYU A;  2IV9 A;  1VKL A;  2L3G A;  2JV9 A;  3RSM A;  2PWW A;  2R5X A;  2K2R A;  4EAG A;  1TGH A;  1P5G X;  1W80 A;  2WA6 A;  2Z0F A;  1VKA A;  2RR8 A;  1E42 A;  3RPJ A;  1QN6 A;  1RM1 A;  5KL0 A;  1V5S A;  3PDK A;  1YTF A;  1KYF A;  2E9K A;  3CWT A;  3DPU A;  2V9J A;  4PY5 A;  1PCJ X;  1QNA A;  1MB8 A;  5J8E A;  3TDH A;  1UT7 A;  1Q9U A;  1D3U A;  4WXA A;  1YQL A;  4Q11 A;  2VZD A;  2D86 A;  1N3A A;  1C4G A;  1TBP A;  1LWY A;  2D0C A;  3I0X A;  1TUO A;  3D4V A;  2FKM X;  1BKR A;  1H67 A;  1K35 A;  2WDT A;  3T4N A;  3OSM A;  3C04 A;  1VTL E;  3I0W A;  1WYL A;  3CVT A;  4TXK A;  1QAG A;  1KY6 A;  4B0A A;  2QRC A;  1WYN A;  1PA7 A;  1NH2 A;  1WIX A;  1AIS A;  3DPT A;  1DIZ A;  2V8Q A;  4ROE B;  3I6X A;  4D7Q A;  1UJO A;  3OGD A;  3CWA A;  4ROD B;  3JAK M;  1QN3 A;  2HZS A;  2NOB A;  4EDN A;  4EDM A;  1NVP A;  4BJU A;  4EAL A;  2JOI A;  4B7L A;  2D85 A;  1WJW A;  5A38 A;  2WA7 A;  3ENO C;  1T6A A;  5IYC P;  3CO1 A;  4MRQ A;  3OH9 A;  5F9C A;  2ZFD B;  1P5D X;  1B9K A;  4QG5 A;  4EAJ A;  4EAI A;  4EDL A;  3HOR A;  2NOF A;  4DUL A;  1KYD A;  1HU0 A;  1J3M A;  1M3H A;  2QRD A;  5A4B A;  5BMP A;  2HL9 A;  2EE7 A;  3SNS A;  2Y8L A;  4Q58 A;  2Z8U A;  3KMU B;  5IYD P;  5BMN A;  1MPG A;  2IV8 A; 
#chains in the Genus database with same CATH homology
 2HL8 A;  2HKP A;  2WE6 A;  4LVP A;  5FMT A;  5FMU A;  2IGP A;  4DDP A;  4LVR A;  3VP7 A;  2WDT A;  2VE7 C;  2HL9 A;  2VE7 A;  1EUV A;  2EQO A;  3EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...