1EUVA

X-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
221
Chain Sequence
GSLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ULP1 PROTEASE
publication title Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 221
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 1euvA01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 1euvA02
2HL8A 2HL9A 2HKPA 3EAYA 1EUVA
chains in the Genus database with same CATH superfamily
1LXTA 2IGPA 3F0ZA 2R0OA 3HORA 3BKQX 4EAKA 2PWWA 2Y8QA 5IYDP 5L0OA 1C9BB 3I0WA 2JV9A 2EE7A 2OOYA 4LVPA 1XSZA 1TBAB 2HKPA 1UT4A 2V9JA 1SH5A 2JHNA 2D0CA 3OGDA 1RM1A 2OOXA 1WYRA 1K2YX 2QRCA 1E42A 3C04A 1TBPA 4EAIA 4EAGA 1WJOA 2EYIA 1M5Q1 1VOLB 1C47A 1V5KA 2H5AX 3HS8A 1WYMA 1MB8A 3D4VA 1Q9UA 1M3QA 1PXYA 1VTLE 5IYCP 4RODB 2O3OA 1VKLA 3JAKM 1WYNA 1YQLA 3CWTA 2QREA 4Q58A 3EAYA 3CWUA 5JN5A 1QAGA 3T4NA 5BVRA 2D0BA 2F7LA 3OCIA 3KRMA 2NWVA 3ULXA 2D85A 1KFIA 1WYPA 1QTSA 3OC3C 3VN5A 4EDNA 1QN7A 1C4GA 4D7QA 1QNAA 4LVRA 1P5GX 4WX8A 1QNEA 5IYBP 2FKMX 3JALM 4D7RA 2VZGB 4EAJA 1QN4A 1J3MA 4TXKA 3OH9A 1EUVA 5F9CA 3ENOC 4BJUA 2NOEA 2FKFA 4WZSD 2XHIA 2EYNA 1PCZA 1QNBA 3I6XA 1YTFA 2NOBA 1PZDA 2WA5A 2VZIB 1AOAA 2V92A 2NOZA 4TXIA 3H1ZA 1QTPA 2JHJA 2WE6A 2DK9A 1TGHA 2H4LX 4ROCB 3FERA 1VKAA 4IL8A 5KL0A 5BMNA 3HOPA 2EQOA 2HL8A 1PCJX 2QJXA 1AISA 2Z0FA 1HU0A 2EHBD 3HOCA 2IV8A 3PMGA 2QRDA 1V5SA 1PCMX 3OH6A 1BKRA 4I8OA 4B0AA 3PDKA 1UEGA 1WYQA 5FMTA 2NVMA 3ENCA 1LWWA 4EDLA 1YTBA 1M3HA 1UJOA 2K3SA 1BHDA 3TDHA 1QNCA 1T6AA 1QN9A 3REPB 2QJZA 1QN8A 1QN3A 3IH7A 1WIXA 4HJHA 1MP9A 1AA2A 1PA7A 1VTOA 1SH6A 1WJWA 1P5DX 3EIKA 2G30A 1JFIC 4Q11A 1YQRA 1TUOA 1JDYA 1D3UA 2E9KA 2HL9A 5AN4A 3F7PA 1K35A 2NLVA 1KY7A 3CWSA 2D89A 2LAEA 2DKDA 3CVSA 3OLPA 3KY9A 1DIZA 1PVSA 1WQAA 1CDWA 2MJ7A 2V8QA 4DDPA 5EPCA 1DXXA 3ASMA 3N89A 2R8UA 2FGTA 3OSTA 1KYFA 1H67A 3TE5A 1EBMA 3F10A 3CW7A 1WYLA 2DKAA 3KTUA 3D7QA 4C7PA 3OSMA 2VE7C 4EJZA 2DKCA 4CFFA 4PY5A 1N3CA 1N3AA 4QG5A 5HSHA 2FUVA 2VZCA 3RPJA 2IV9A 3NA5A 2D86A 2Z8UA 1WKUA 2ZFDB 2JPIA 1LWVA 2HZMA 2Y8LA 2NOIA 2MZ8A 1NGMA 3UW2A 4B7LA 2WA6A 5JMVD 2VE7A 1W80A 3HS9A 2I5WA 2D87A 5BMPA 1VOKA 2YH5A 2D0AA 4Q57B 2NOHA 1NH2A 1N39A 1LWYA 2WFNA 1P2XA 1UL7A 4WXAA 2VJ0A 1B9KA 1MPGA 1TJTA 2K2RA 1KO9A 1UT7A 3DPUA 3JARM 2R5XA 3KMUB 1KYDA 3DPTA 4EDMA 2NOLA 1QN5A 3RSMA 3CWAA 4Q59A 5FMUA 4TPSA 1YQKA 2L3GA 5A38A 2WA7A 3KMWB 2QR1A 1KY6A 2VZDA 1QN6A 1R4XA 3CVTA 1P5SA 1RT8A 3SNSA 4ROEB 1KYUA 1NVPA 4EALA 1KFQA 4EJYA 4MRQA 2RR8A 2YRNA 2QLVA 3I0XA 5J8EA 3CO1A 2D88A 2WDTA 3OSEA 2HZSA 5A37A 3I3WA 1WYOA 4DULA 1YQMA 2YA3A 2NOFA 1FN7A 5A4BA 5A36A 2JOIA 3VP7A
chains in the Genus database with same CATH topology
5FMUA 4LVPA 2EQOA 4DDPA 2WE6A 2HL8A 2HL9A 2VE7A 2HKPA 2IGPA 2VE7C 2WDTA 1EUVA 3EAYA 4LVRA 3VP7A 5FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL8 A;  2HL9 A;  2HKP A;  3EAY A;  1EUV A; 
#chains in the Genus database with same CATH topology
 1LXT A;  2IGP A;  3F0Z A;  2R0O A;  3HOR A;  3BKQ X;  4EAK A;  2PWW A;  2Y8Q A;  5IYD P;  5L0O A;  1C9B B;  3I0W A;  2JV9 A;  2EE7 A;  2OOY A;  4LVP A;  1XSZ A;  1TBA B;  2HKP A;  1UT4 A;  2V9J A;  1SH5 A;  2JHN A;  2D0C A;  3OGD A;  1RM1 A;  2OOX A;  1WYR A;  1K2Y X;  2QRC A;  1E42 A;  3C04 A;  1TBP A;  4EAI A;  4EAG A;  1WJO A;  2EYI A;  1M5Q 1;  1VOL B;  1C47 A;  1V5K A;  2H5A X;  3HS8 A;  1WYM A;  1MB8 A;  3D4V A;  1Q9U A;  1M3Q A;  1PXY A;  1VTL E;  5IYC P;  4ROD B;  2O3O A;  1VKL A;  3JAK M;  1WYN A;  1YQL A;  3CWT A;  2QRE A;  4Q58 A;  3EAY A;  3CWU A;  5JN5 A;  1QAG A;  3T4N A;  5BVR A;  2D0B A;  2F7L A;  3OCI A;  3KRM A;  2NWV A;  3ULX A;  2D85 A;  1KFI A;  1WYP A;  1QTS A;  3OC3 C;  3VN5 A;  4EDN A;  1QN7 A;  1C4G A;  4D7Q A;  1QNA A;  4LVR A;  1P5G X;  4WX8 A;  1QNE A;  5IYB P;  2FKM X;  3JAL M;  4D7R A;  2VZG B;  4EAJ A;  1QN4 A;  1J3M A;  4TXK A;  3OH9 A;  1EUV A;  5F9C A;  3ENO C;  4BJU A;  2NOE A;  2FKF A;  4WZS D;  2XHI A;  2EYN A;  1PCZ A;  1QNB A;  3I6X A;  1YTF A;  2NOB A;  1PZD A;  2WA5 A;  2VZI B;  1AOA A;  2V92 A;  2NOZ A;  4TXI A;  3H1Z A;  1QTP A;  2JHJ A;  2WE6 A;  2DK9 A;  1TGH A;  2H4L X;  4ROC B;  3FER A;  1VKA A;  4IL8 A;  5KL0 A;  5BMN A;  3HOP A;  2EQO A;  2HL8 A;  1PCJ X;  2QJX A;  1AIS A;  2Z0F A;  1HU0 A;  2EHB D;  3HOC A;  2IV8 A;  3PMG A;  2QRD A;  1V5S A;  1PCM X;  3OH6 A;  1BKR A;  4I8O A;  4B0A A;  3PDK A;  1UEG A;  1WYQ A;  5FMT A;  2NVM A;  3ENC A;  1LWW A;  4EDL A;  1YTB A;  1M3H A;  1UJO A;  2K3S A;  1BHD A;  3TDH A;  1QNC A;  1T6A A;  1QN9 A;  3REP B;  2QJZ A;  1QN8 A;  1QN3 A;  3IH7 A;  1WIX A;  4HJH A;  1MP9 A;  1AA2 A;  1PA7 A;  1VTO A;  1SH6 A;  1WJW A;  1P5D X;  3EIK A;  2G30 A;  1JFI C;  4Q11 A;  1YQR A;  1TUO A;  1JDY A;  1D3U A;  2E9K A;  2HL9 A;  5AN4 A;  3F7P A;  1K35 A;  2NLV A;  1KY7 A;  3CWS A;  2D89 A;  2LAE A;  2DKD A;  3CVS A;  3OLP A;  3KY9 A;  1DIZ A;  1PVS A;  1WQA A;  1CDW A;  2MJ7 A;  2V8Q A;  4DDP A;  5EPC A;  1DXX A;  3ASM A;  3N89 A;  2R8U A;  2FGT A;  3OST A;  1KYF A;  1H67 A;  3TE5 A;  1EBM A;  3F10 A;  3CW7 A;  1WYL A;  2DKA A;  3KTU A;  3D7Q A;  4C7P A;  3OSM A;  2VE7 C;  4EJZ A;  2DKC A;  4CFF A;  4PY5 A;  1N3C A;  1N3A A;  4QG5 A;  5HSH A;  2FUV A;  2VZC A;  3RPJ A;  2IV9 A;  3NA5 A;  2D86 A;  2Z8U A;  1WKU A;  2ZFD B;  2JPI A;  1LWV A;  2HZM A;  2Y8L A;  2NOI A;  2MZ8 A;  1NGM A;  3UW2 A;  4B7L A;  2WA6 A;  5JMV D;  2VE7 A;  1W80 A;  3HS9 A;  2I5W A;  2D87 A;  5BMP A;  1VOK A;  2YH5 A;  2D0A A;  4Q57 B;  2NOH A;  1NH2 A;  1N39 A;  1LWY A;  2WFN A;  1P2X A;  1UL7 A;  4WXA A;  2VJ0 A;  1B9K A;  1MPG A;  1TJT A;  2K2R A;  1KO9 A;  1UT7 A;  3DPU A;  3JAR M;  2R5X A;  3KMU B;  1KYD A;  3DPT A;  4EDM A;  2NOL A;  1QN5 A;  3RSM A;  3CWA A;  4Q59 A;  5FMU A;  4TPS A;  1YQK A;  2L3G A;  5A38 A;  2WA7 A;  3KMW B;  2QR1 A;  1KY6 A;  2VZD A;  1QN6 A;  1R4X A;  3CVT A;  1P5S A;  1RT8 A;  3SNS A;  4ROE B;  1KYU A;  1NVP A;  4EAL A;  1KFQ A;  4EJY A;  4MRQ A;  2RR8 A;  2YRN A;  2QLV A;  3I0X A;  5J8E A;  3CO1 A;  2D88 A;  2WDT A;  3OSE A;  2HZS A;  5A37 A;  3I3W A;  1WYO A;  4DUL A;  1YQM A;  2YA3 A;  2NOF A;  1FN7 A;  5A4B A;  5A36 A;  2JOI A;  3VP7 A; 
#chains in the Genus database with same CATH homology
 5FMU A;  4LVP A;  2EQO A;  4DDP A;  2WE6 A;  2HL8 A;  2HL9 A;  2VE7 A;  2HKP A;  2IGP A;  2VE7 C;  2WDT A;  1EUV A;  3EAY A;  4LVR A;  3VP7 A;  5FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...