2K2RA

The nmr structure of alpha-parvin ch2/paxillin ld1 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
RHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-parvin
publication title The Structure of {alpha}-Parvin CH2-Paxillin LD1 Complex Reveals a Novel Modular Recognition for Focal Adhesion Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 35
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 2k2rA00
1AOAA 3KY9A 4EDNA 3HOCA 1WYLA 4TXKA 1UJOA 1H67A 5J8EA 2WA7A 2EE7A 4EDMA 4B7LA 3HORA 3FERA 1WYMA 2VZIB 1P5SA 2QJZA 1PA7A 1SH5A 1WKUA 3JAKM 2D87A 1WYPA 1DXXA 2K3SA 5BVRA 1TJTA 2VZGB 1BKRA 5A4BA 2RR8A 1WIXA 2R0OA 2D85A 3JARM 2D86A 1WYRA 3KMWB 4Q58A 2EYNA 1QAGA 1V5KA 1P2XA 2E9KA 1VKAA 1SH6A 5A36A 2EYIA 1AA2A 2DK9A 2D88A 1PXYA 2R8UA 1RT8A 2YRNA 2JV9A 4TXIA 2D89A 2WA5A 3JALM 2WFNA 3REPB 2WA6A 5A38A 3HOPA 1MB8A 2L3GA 1WYQA 3CO1A 4Q59A 1BHDA 3I6XA 1WYOA 2VZCA 5L0OA 1WYNA 1UEGA 2K2RA 3F7PA 5A37A 1WJOA 2QJXA 4EDLA 4Q57B 3KMUB 2VZDA
chains in the Genus database with same CATH superfamily
3VP7A 1AOAA 3KY9A 4EDNA 3HOCA 1WYLA 4TXKA 1UJOA 1H67A 5J8EA 4LVPA 2WA7A 2IGPA 2EE7A 4EDMA 4B7LA 3HORA 3FERA 1WYMA 4DDPA 2VZIB 1P5SA 2QJZA 2VE7C 1PA7A 1SH5A 1WKUA 3JAKM 2D87A 1WYPA 1DXXA 2K3SA 5FMTA 5BVRA 1TJTA 2VZGB 3EAYA 1BKRA 5A4BA 2HKPA 2VE7A 2RR8A 1WIXA 2R0OA 2D85A 2D86A 3JARM 2WDTA 1WYRA 3KMWB 4Q58A 2WE6A 2EYNA 1QAGA 1V5KA 1P2XA 2E9KA 1VKAA 1SH6A 5A36A 2EYIA 1AA2A 2DK9A 2D88A 1EUVA 1PXYA 2R8UA 1RT8A 2YRNA 2JV9A 4TXIA 2D89A 2WA5A 3JALM 2WFNA 2HL9A 3REPB 2WA6A 5FMUA 5A38A 2EQOA 3HOPA 1MB8A 2L3GA 2HL8A 1WYQA 3CO1A 4Q59A 1BHDA 4LVRA 3I6XA 1WYOA 2VZCA 5L0OA 1WYNA 1UEGA 2K2RA 3F7PA 5A37A 1WJOA 2QJXA 4EDLA 4Q57B 3KMUB 2VZDA
chains in the Genus database with same CATH topology
1AOAA 3KY9A 4EDNA 3HOCA 1WYLA 4TXKA 1UJOA 1H67A 5J8EA 2WA7A 2EE7A 4EDMA 4B7LA 3HORA 3FERA 1WYMA 2VZIB 1P5SA 2QJZA 1PA7A 1SH5A 1WKUA 3JAKM 2D87A 1WYPA 1DXXA 2K3SA 5BVRA 1TJTA 2VZGB 1BKRA 5A4BA 2RR8A 1WIXA 2R0OA 2D85A 3JARM 2D86A 1WYRA 3KMWB 4Q58A 2EYNA 1QAGA 1V5KA 1P2XA 2E9KA 1VKAA 1SH6A 5A36A 2EYIA 1AA2A 2DK9A 2D88A 1PXYA 2R8UA 1RT8A 2YRNA 2JV9A 4TXIA 2D89A 2WA5A 3JALM 2WFNA 3REPB 2WA6A 5A38A 3HOPA 1MB8A 2L3GA 1WYQA 3CO1A 4Q59A 1BHDA 3I6XA 1WYOA 2VZCA 5L0OA 1WYNA 1UEGA 2K2RA 3F7PA 5A37A 1WJOA 2QJXA 4EDLA 4Q57B 3KMUB 2VZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOA A;  3KY9 A;  4EDN A;  3HOC A;  1WYL A;  4TXK A;  1UJO A;  1H67 A;  5J8E A;  2WA7 A;  2EE7 A;  4EDM A;  4B7L A;  3HOR A;  3FER A;  1WYM A;  2VZI B;  1P5S A;  2QJZ A;  1PA7 A;  1SH5 A;  1WKU A;  3JAK M;  2D87 A;  1WYP A;  1DXX A;  2K3S A;  5BVR A;  1TJT A;  2VZG B;  1BKR A;  5A4B A;  2RR8 A;  1WIX A;  2R0O A;  2D85 A;  3JAR M;  2D86 A;  1WYR A;  3KMW B;  4Q58 A;  2EYN A;  1QAG A;  1V5K A;  1P2X A;  2E9K A;  1VKA A;  1SH6 A;  5A36 A;  2EYI A;  1AA2 A;  2DK9 A;  2D88 A;  1PXY A;  2R8U A;  1RT8 A;  2YRN A;  2JV9 A;  4TXI A;  2D89 A;  2WA5 A;  3JAL M;  2WFN A;  3REP B;  2WA6 A;  5A38 A;  3HOP A;  1MB8 A;  2L3G A;  1WYQ A;  3CO1 A;  4Q59 A;  1BHD A;  3I6X A;  1WYO A;  2VZC A;  5L0O A;  1WYN A;  1UEG A;  2K2R A;  3F7P A;  5A37 A;  1WJO A;  2QJX A;  4EDL A;  4Q57 B;  3KMU B;  2VZD A; 
#chains in the Genus database with same CATH topology
 3VP7 A;  1AOA A;  3KY9 A;  4EDN A;  3HOC A;  1WYL A;  4TXK A;  1UJO A;  1H67 A;  5J8E A;  4LVP A;  2WA7 A;  2IGP A;  2EE7 A;  4EDM A;  4B7L A;  3HOR A;  3FER A;  1WYM A;  4DDP A;  2VZI B;  1P5S A;  2QJZ A;  2VE7 C;  1PA7 A;  1SH5 A;  1WKU A;  3JAK M;  2D87 A;  1WYP A;  1DXX A;  2K3S A;  5FMT A;  5BVR A;  1TJT A;  2VZG B;  3EAY A;  1BKR A;  5A4B A;  2HKP A;  2VE7 A;  2RR8 A;  1WIX A;  2R0O A;  2D85 A;  2D86 A;  3JAR M;  2WDT A;  1WYR A;  3KMW B;  4Q58 A;  2WE6 A;  2EYN A;  1QAG A;  1V5K A;  1P2X A;  2E9K A;  1VKA A;  1SH6 A;  5A36 A;  2EYI A;  1AA2 A;  2DK9 A;  2D88 A;  1EUV A;  1PXY A;  2R8U A;  1RT8 A;  2YRN A;  2JV9 A;  4TXI A;  2D89 A;  2WA5 A;  3JAL M;  2WFN A;  2HL9 A;  3REP B;  2WA6 A;  5FMU A;  5A38 A;  2EQO A;  3HOP A;  1MB8 A;  2L3G A;  2HL8 A;  1WYQ A;  3CO1 A;  4Q59 A;  1BHD A;  4LVR A;  3I6X A;  1WYO A;  2VZC A;  5L0O A;  1WYN A;  1UEG A;  2K2R A;  3F7P A;  5A37 A;  1WJO A;  2QJX A;  4EDL A;  4Q57 B;  3KMU B;  2VZD A; 
#chains in the Genus database with same CATH homology
 1AOA A;  3KY9 A;  4EDN A;  3HOC A;  1WYL A;  4TXK A;  1UJO A;  1H67 A;  5J8E A;  2WA7 A;  2EE7 A;  4EDM A;  4B7L A;  3HOR A;  3FER A;  1WYM A;  2VZI B;  1P5S A;  2QJZ A;  1PA7 A;  1SH5 A;  1WKU A;  3JAK M;  2D87 A;  1WYP A;  1DXX A;  2K3S A;  5BVR A;  1TJT A;  2VZG B;  1BKR A;  5A4B A;  2RR8 A;  1WIX A;  2R0O A;  2D85 A;  3JAR M;  2D86 A;  1WYR A;  3KMW B;  4Q58 A;  2EYN A;  1QAG A;  1V5K A;  1P2X A;  2E9K A;  1VKA A;  1SH6 A;  5A36 A;  2EYI A;  1AA2 A;  2DK9 A;  2D88 A;  1PXY A;  2R8U A;  1RT8 A;  2YRN A;  2JV9 A;  4TXI A;  2D89 A;  2WA5 A;  3JAL M;  2WFN A;  3REP B;  2WA6 A;  5A38 A;  3HOP A;  1MB8 A;  2L3G A;  1WYQ A;  3CO1 A;  4Q59 A;  1BHD A;  3I6X A;  1WYO A;  2VZC A;  5L0O A;  1WYN A;  1UEG A;  2K2R A;  3F7P A;  5A37 A;  1WJO A;  2QJX A;  4EDL A;  4Q57 B;  3KMU B;  2VZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...