2HL8A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfinic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
218
Chain Sequence
GSLVPELNEKDDDQVQKALASRETQLMNRNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 218
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl8A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl8A02
1EUVA 3EAYA 2HL8A 2HKPA 2HL9A
chains in the Genus database with same CATH superfamily
5JN5A 2NWVA 2HL9A 1NGMA 3VP7A 2NOEA 5IYDP 1TJTA 5HSHA 3N89A 1KYFA 2IV9A 1P5DX 2NVMA 2YH5A 2FKMX 4Q11A 4EAJA 1WQAA 1M3QA 2VJ0A 5FMTA 2D0AA 3ULXA 5BMPA 4CFFA 3T4NA 3OSMA 1MPGA 2WA7A 2EYIA 1Q9UA 1YTBA 4EALA 1TUOA 1KFQA 1WYOA 1VTLE 1KO9A 2R5XA 1C47A 1RM1A 1K2YX 1WYLA 1WYQA 3F7PA 2L3GA 5A36A 2FGTA 3OLPA 1E42A 3JALM 4EAIA 4EAKA 3RPJA 3TE5A 3OGDA 2JHNA 1QN8A 1KFIA 1KYUA 1N3AA 3UW2A 2VZIB 2IV8A 3PDKA 1WYNA 3KMWB 3REPB 2EE7A 3JAKM 4EJZA 4LVRA 3DPTA 1YQRA 2Y8QA 2MJ7A 2WE6A 2D89A 2IGPA 2EYNA 2QR1A 4WXAA 1M5Q1 1B9KA 2VZGB 3OSTA 1HU0A 2D87A 2NOZA 5EPCA 2Z0FA 1DXXA 1QAGA 3CWSA 2V92A 1NVPA 2EHBD 4Q58A 3OSEA 1AISA 1YQMA 2WDTA 2FKFA 2YRNA 2G30A 2QRCA 1BKRA 2HKPA 2QJZA 3CO1A 3RSMA 4TPSA 4DULA 2YA3A 2V8QA 3KTUA 2D88A 1QTSA 1P2XA 1QN5A 1H67A 3OCIA 1M3HA 3DPUA 3KRMA 5AN4A 3H1ZA 2JV9A 1WYRA 4B7LA 1QNAA 4ROEB 2XHIA 1MB8A 2WFNA 1LWWA 2QREA 2VZCA 1FN7A 1QNBA 2F7LA 2VE7C 4MRQA 3PMGA 4EJYA 5IYBP 1VOLB 1XSZA 1UL7A 2Z8UA 4ROCB 1RT8A 3HORA 1UT7A 1C9BB 1KYDA 3CVTA 2HL8A 2ZFDB 3HS8A 3I0XA 3JARM 1PZDA 2I5WA 3I6XA 1DIZA 5A4BA 1KY6A 3C04A 1QN3A 3IH7A 1YQLA 5L0OA 1WJWA 1EUVA 3EAYA 1WKUA 2D86A 3SNSA 2NOFA 4B0AA 2NOHA 2JPIA 1VKLA 1J3MA 2DKAA 4TXKA 1QNEA 2OOYA 4EAGA 1LWVA 4WZSD 4EDMA 1QN6A 3F0ZA 2NOBA 3CW7A 4D7QA 5BMNA 4EDNA 5KL0A 2NOIA 2D85A 1JDYA 2MZ8A 2V9JA 3HS9A 2DK9A 4DDPA 1YTFA 2WA5A 2DKCA 2NLVA 3I0WA 1P5SA 2Y8LA 1P5GX 1T6AA 1PCJX 1WJOA 4QG5A 3CWUA 4RODB 3OH9A 2K2RA 4WX8A 1C4GA 2LAEA 3D4VA 1VKAA 1TBPA 1PVSA 3CWAA 2H5AX 3KMUB 3OC3C 5JMVD 1LXTA 5IYCP 1W80A 4LVPA 2E9KA 2FUVA 4Q57B 1CDWA 1EBMA 3F10A 2RR8A 5BVRA 3VN5A 3BKQX 2QJXA 1V5KA 3KY9A 1K35A 1PCMX 1TBAB 1QTPA 5A37A 4TXIA 4IL8A 5F9CA 2DKDA 2QLVA 1D3UA 1WIXA 1KY7A 2NOLA 2HZMA 3TDHA 3OH6A 4PY5A 5J8EA 1QN7A 1TGHA 3HOCA 1QNCA 2R0OA 3CVSA 2R8UA 5A38A 2WA6A 2VZDA 2JOIA 2HZSA 1JFIC 2VE7A 1SH5A 4Q59A 2D0BA 1VTOA 2O3OA 5FMUA 2OOXA 2PWWA 4EDLA 1QN9A 1R4XA 1WYMA 4I8OA 1N3CA 1SH6A 1WYPA 2JHJA 3D7QA 3EIKA 1LWYA 4D7RA 3ASMA 4HJHA 1PXYA 2K3SA 1PCZA 1VOKA 1PA7A 4C7PA 3I3WA 1YQKA 1UT4A 4BJUA 3FERA 3HOPA 1MP9A 2QRDA 1UEGA 1N39A 3NA5A 1NH2A 3CWTA 2EQOA 3ENCA 1BHDA 1AOAA 1UJOA 1QN4A 2D0CA 1V5SA 3ENOC 2H4LX 1AA2A
chains in the Genus database with same CATH topology
2WDTA 2IGPA 2VE7C 2WE6A 4LVRA 4LVPA 1EUVA 2HL8A 3EAYA 5FMTA 2VE7A 4DDPA 2EQOA 2HKPA 2HL9A 3VP7A 5FMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUV A;  3EAY A;  2HL8 A;  2HKP A;  2HL9 A; 
#chains in the Genus database with same CATH topology
 5JN5 A;  2NWV A;  2HL9 A;  1NGM A;  3VP7 A;  2NOE A;  5IYD P;  1TJT A;  5HSH A;  3N89 A;  1KYF A;  2IV9 A;  1P5D X;  2NVM A;  2YH5 A;  2FKM X;  4Q11 A;  4EAJ A;  1WQA A;  1M3Q A;  2VJ0 A;  5FMT A;  2D0A A;  3ULX A;  5BMP A;  4CFF A;  3T4N A;  3OSM A;  1MPG A;  2WA7 A;  2EYI A;  1Q9U A;  1YTB A;  4EAL A;  1TUO A;  1KFQ A;  1WYO A;  1VTL E;  1KO9 A;  2R5X A;  1C47 A;  1RM1 A;  1K2Y X;  1WYL A;  1WYQ A;  3F7P A;  2L3G A;  5A36 A;  2FGT A;  3OLP A;  1E42 A;  3JAL M;  4EAI A;  4EAK A;  3RPJ A;  3TE5 A;  3OGD A;  2JHN A;  1QN8 A;  1KFI A;  1KYU A;  1N3A A;  3UW2 A;  2VZI B;  2IV8 A;  3PDK A;  1WYN A;  3KMW B;  3REP B;  2EE7 A;  3JAK M;  4EJZ A;  4LVR A;  3DPT A;  1YQR A;  2Y8Q A;  2MJ7 A;  2WE6 A;  2D89 A;  2IGP A;  2EYN A;  2QR1 A;  4WXA A;  1M5Q 1;  1B9K A;  2VZG B;  3OST A;  1HU0 A;  2D87 A;  2NOZ A;  5EPC A;  2Z0F A;  1DXX A;  1QAG A;  3CWS A;  2V92 A;  1NVP A;  2EHB D;  4Q58 A;  3OSE A;  1AIS A;  1YQM A;  2WDT A;  2FKF A;  2YRN A;  2G30 A;  2QRC A;  1BKR A;  2HKP A;  2QJZ A;  3CO1 A;  3RSM A;  4TPS A;  4DUL A;  2YA3 A;  2V8Q A;  3KTU A;  2D88 A;  1QTS A;  1P2X A;  1QN5 A;  1H67 A;  3OCI A;  1M3H A;  3DPU A;  3KRM A;  5AN4 A;  3H1Z A;  2JV9 A;  1WYR A;  4B7L A;  1QNA A;  4ROE B;  2XHI A;  1MB8 A;  2WFN A;  1LWW A;  2QRE A;  2VZC A;  1FN7 A;  1QNB A;  2F7L A;  2VE7 C;  4MRQ A;  3PMG A;  4EJY A;  5IYB P;  1VOL B;  1XSZ A;  1UL7 A;  2Z8U A;  4ROC B;  1RT8 A;  3HOR A;  1UT7 A;  1C9B B;  1KYD A;  3CVT A;  2HL8 A;  2ZFD B;  3HS8 A;  3I0X A;  3JAR M;  1PZD A;  2I5W A;  3I6X A;  1DIZ A;  5A4B A;  1KY6 A;  3C04 A;  1QN3 A;  3IH7 A;  1YQL A;  5L0O A;  1WJW A;  1EUV A;  3EAY A;  1WKU A;  2D86 A;  3SNS A;  2NOF A;  4B0A A;  2NOH A;  2JPI A;  1VKL A;  1J3M A;  2DKA A;  4TXK A;  1QNE A;  2OOY A;  4EAG A;  1LWV A;  4WZS D;  4EDM A;  1QN6 A;  3F0Z A;  2NOB A;  3CW7 A;  4D7Q A;  5BMN A;  4EDN A;  5KL0 A;  2NOI A;  2D85 A;  1JDY A;  2MZ8 A;  2V9J A;  3HS9 A;  2DK9 A;  4DDP A;  1YTF A;  2WA5 A;  2DKC A;  2NLV A;  3I0W A;  1P5S A;  2Y8L A;  1P5G X;  1T6A A;  1PCJ X;  1WJO A;  4QG5 A;  3CWU A;  4ROD B;  3OH9 A;  2K2R A;  4WX8 A;  1C4G A;  2LAE A;  3D4V A;  1VKA A;  1TBP A;  1PVS A;  3CWA A;  2H5A X;  3KMU B;  3OC3 C;  5JMV D;  1LXT A;  5IYC P;  1W80 A;  4LVP A;  2E9K A;  2FUV A;  4Q57 B;  1CDW A;  1EBM A;  3F10 A;  2RR8 A;  5BVR A;  3VN5 A;  3BKQ X;  2QJX A;  1V5K A;  3KY9 A;  1K35 A;  1PCM X;  1TBA B;  1QTP A;  5A37 A;  4TXI A;  4IL8 A;  5F9C A;  2DKD A;  2QLV A;  1D3U A;  1WIX A;  1KY7 A;  2NOL A;  2HZM A;  3TDH A;  3OH6 A;  4PY5 A;  5J8E A;  1QN7 A;  1TGH A;  3HOC A;  1QNC A;  2R0O A;  3CVS A;  2R8U A;  5A38 A;  2WA6 A;  2VZD A;  2JOI A;  2HZS A;  1JFI C;  2VE7 A;  1SH5 A;  4Q59 A;  2D0B A;  1VTO A;  2O3O A;  5FMU A;  2OOX A;  2PWW A;  4EDL A;  1QN9 A;  1R4X A;  1WYM A;  4I8O A;  1N3C A;  1SH6 A;  1WYP A;  2JHJ A;  3D7Q A;  3EIK A;  1LWY A;  4D7R A;  3ASM A;  4HJH A;  1PXY A;  2K3S A;  1PCZ A;  1VOK A;  1PA7 A;  4C7P A;  3I3W A;  1YQK A;  1UT4 A;  4BJU A;  3FER A;  3HOP A;  1MP9 A;  2QRD A;  1UEG A;  1N39 A;  3NA5 A;  1NH2 A;  3CWT A;  2EQO A;  3ENC A;  1BHD A;  1AOA A;  1UJO A;  1QN4 A;  2D0C A;  1V5S A;  3ENO C;  2H4L X;  1AA2 A; 
#chains in the Genus database with same CATH homology
 2WDT A;  2IGP A;  2VE7 C;  2WE6 A;  4LVR A;  4LVP A;  1EUV A;  2HL8 A;  3EAY A;  5FMT A;  2VE7 A;  4DDP A;  2EQO A;  2HKP A;  2HL9 A;  3VP7 A;  5FMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...