2HL8A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfinic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
218
Chain Sequence
GSLVPELNEKDDDQVQKALASRETQLMNRNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 71
structure length 218
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl8A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl8A02
3EAYA 2HKPA 2HL9A 2HL8A 1EUVA
chains in the Genus database with same CATH superfamily
1YTBA 1RM1A 2EYIA 5FMUA 2R5XA 2V9JA 2QRCA 4WX8A 1QNBA 3CVTA 1LWWA 1H67A 2NOFA 1C9BB 4CFFA 4PY5A 3ENOC 1UEGA 1MP9A 1FN7A 3KRMA 3H1ZA 1QN4A 3CWUA 1MPGA 2NOIA 2NOHA 2QR1A 1J3MA 2D0BA 5JN5A 2F7LA 1Q9UA 1RT8A 1EBMA 1P5SA 4EAKA 2EE7A 3JARM 3HORA 4EAJA 3KY9A 2FKFA 1JFIC 4Q11A 2K2RA 2VE7A 3PMGA 2VZCA 5EPCA 2JHJA 2WA6A 2QRDA 2HZSA 2WDTA 1PCMX 2Z0FA 2IGPA 2NOEA 4RODB 2QLVA 3I6XA 4DDPA 3N89A 1YTFA 4EDMA 1KY7A 2DKDA 4Q59A 1VKAA 3SNSA 1VTLE 4C7PA 1AOAA 1WYOA 3EAYA 1QN3A 1LWVA 3JAKM 1P2XA 3ASMA 1T6AA 4WZSD 4B7LA 2YH5A 1UL7A 1WIXA 5BMNA 1AISA 1QNCA 3CVSA 4TPSA 2QJZA 2OOXA 4MRQA 2QREA 2JOIA 4EJYA 1AA2A 5HSHA 3HS9A 1PA7A 1CDWA 1VTOA 2V92A 2YA3A 1W80A 1M3HA 1KFQA 3REPB 2I5WA 1M5Q1 1QN7A 1UT7A 2D87A 2D0AA 2NOLA 2D89A 4LVRA 5BMPA 2VZGB 2H5AX 3IH7A 1NVPA 1WYNA 1PXYA 3OH6A 1BKRA 1VKLA 2JPIA 1B9KA 3I3WA 1UT4A 1KYDA 2D0CA 2LAEA 3D4VA 1XSZA 2FKMX 2Z8UA 2WFNA 1LXTA 1WKUA 1WJWA 1NGMA 2G30A 5L0OA 1V5SA 2D88A 1TBAB 1V5KA 3VN5A 1P5DX 4ROCB 1HU0A 1QAGA 2O3OA 1UJOA 1E42A 4EDNA 1C4GA 3FERA 2HZMA 4Q57B 1R4XA 3TDHA 1KY6A 5A4BA 2VZIB 3RPJA 1YQLA 1N3AA 1TUOA 1WYLA 2Y8LA 3F7PA 3C04A 2NOZA 1WYRA 3CWAA 1WQAA 5A38A 2E9KA 3NA5A 2IV9A 2DKCA 2EYNA 2VE7C 4HJHA 4EAGA 2VZDA 2EHBD 3DPTA 4EAIA 1QN5A 1TBPA 3OCIA 2HKPA 2WA7A 1N39A 1QTSA 1QN6A 3CW7A 1N3CA 3PDKA 3OSMA 3TE5A 5A36A 5IYDP 3I0WA 2XHIA 4Q58A 1WYPA 3RSMA 3JALM 1PZDA 1BHDA 5FMTA 1K35A 1DXXA 2WA5A 3OLPA 5IYBP 1WYMA 2Y8QA 3OSTA 1M3QA 2NLVA 1KO9A 4ROEB 1P5GX 3I0XA 1PCJX 4EALA 3EIKA 2HL9A 3BKQX 1YQMA 3HOPA 4TXKA 3OC3C 2NWVA 2DK9A 2IV8A 3VP7A 2RR8A 3F10A 1KYFA 3OSEA 1QNEA 3HS8A 1DIZA 2NOBA 2H4LX 5IYCP 4D7QA 2L3GA 4B0AA 4EDLA 2DKAA 1QN8A 2OOYA 1SH6A 2WE6A 5KL0A 1TGHA 1EUVA 4DULA 1LWYA 1D3UA 3ENCA 2R0OA 2V8QA 3UW2A 3KMWB 3HOCA 1PCZA 4I8OA 2HL8A 5BVRA 2EQOA 3OH9A 1QTPA 2R8UA 1VOKA 5J8EA 3KMUB 2VJ0A 2MZ8A 4LVPA 1KFIA 2YRNA 1K2YX 3CWTA 4WXAA 3KTUA 2MJ7A 1NH2A 3CO1A 3OGDA 2D86A 4EJZA 1YQKA 2FGTA 1QNAA 3CWSA 5A37A 4D7RA 5F9CA 1JDYA 2NVMA 1WYQA 3T4NA 1TJTA 3F0ZA 1KYUA 1YQRA 1QN9A 1C47A 3D7QA 5JMVD 4TXIA 2K3SA 2PWWA 2D85A 2JV9A 3ULXA 1MB8A 2FUVA 4IL8A 4BJUA 1SH5A 4QG5A 1PVSA 2JHNA 3DPUA 5AN4A 2ZFDB 1VOLB 1WJOA 2QJXA
chains in the Genus database with same CATH topology
4DDPA 3EAYA 5FMTA 2HKPA 5FMUA 2HL9A 2HL8A 2VE7A 2WDTA 4LVRA 2EQOA 2IGPA 2WE6A 4LVPA 2VE7C 1EUVA 3VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAY A;  2HKP A;  2HL9 A;  2HL8 A;  1EUV A; 
#chains in the Genus database with same CATH topology
 1YTB A;  1RM1 A;  2EYI A;  5FMU A;  2R5X A;  2V9J A;  2QRC A;  4WX8 A;  1QNB A;  3CVT A;  1LWW A;  1H67 A;  2NOF A;  1C9B B;  4CFF A;  4PY5 A;  3ENO C;  1UEG A;  1MP9 A;  1FN7 A;  3KRM A;  3H1Z A;  1QN4 A;  3CWU A;  1MPG A;  2NOI A;  2NOH A;  2QR1 A;  1J3M A;  2D0B A;  5JN5 A;  2F7L A;  1Q9U A;  1RT8 A;  1EBM A;  1P5S A;  4EAK A;  2EE7 A;  3JAR M;  3HOR A;  4EAJ A;  3KY9 A;  2FKF A;  1JFI C;  4Q11 A;  2K2R A;  2VE7 A;  3PMG A;  2VZC A;  5EPC A;  2JHJ A;  2WA6 A;  2QRD A;  2HZS A;  2WDT A;  1PCM X;  2Z0F A;  2IGP A;  2NOE A;  4ROD B;  2QLV A;  3I6X A;  4DDP A;  3N89 A;  1YTF A;  4EDM A;  1KY7 A;  2DKD A;  4Q59 A;  1VKA A;  3SNS A;  1VTL E;  4C7P A;  1AOA A;  1WYO A;  3EAY A;  1QN3 A;  1LWV A;  3JAK M;  1P2X A;  3ASM A;  1T6A A;  4WZS D;  4B7L A;  2YH5 A;  1UL7 A;  1WIX A;  5BMN A;  1AIS A;  1QNC A;  3CVS A;  4TPS A;  2QJZ A;  2OOX A;  4MRQ A;  2QRE A;  2JOI A;  4EJY A;  1AA2 A;  5HSH A;  3HS9 A;  1PA7 A;  1CDW A;  1VTO A;  2V92 A;  2YA3 A;  1W80 A;  1M3H A;  1KFQ A;  3REP B;  2I5W A;  1M5Q 1;  1QN7 A;  1UT7 A;  2D87 A;  2D0A A;  2NOL A;  2D89 A;  4LVR A;  5BMP A;  2VZG B;  2H5A X;  3IH7 A;  1NVP A;  1WYN A;  1PXY A;  3OH6 A;  1BKR A;  1VKL A;  2JPI A;  1B9K A;  3I3W A;  1UT4 A;  1KYD A;  2D0C A;  2LAE A;  3D4V A;  1XSZ A;  2FKM X;  2Z8U A;  2WFN A;  1LXT A;  1WKU A;  1WJW A;  1NGM A;  2G30 A;  5L0O A;  1V5S A;  2D88 A;  1TBA B;  1V5K A;  3VN5 A;  1P5D X;  4ROC B;  1HU0 A;  1QAG A;  2O3O A;  1UJO A;  1E42 A;  4EDN A;  1C4G A;  3FER A;  2HZM A;  4Q57 B;  1R4X A;  3TDH A;  1KY6 A;  5A4B A;  2VZI B;  3RPJ A;  1YQL A;  1N3A A;  1TUO A;  1WYL A;  2Y8L A;  3F7P A;  3C04 A;  2NOZ A;  1WYR A;  3CWA A;  1WQA A;  5A38 A;  2E9K A;  3NA5 A;  2IV9 A;  2DKC A;  2EYN A;  2VE7 C;  4HJH A;  4EAG A;  2VZD A;  2EHB D;  3DPT A;  4EAI A;  1QN5 A;  1TBP A;  3OCI A;  2HKP A;  2WA7 A;  1N39 A;  1QTS A;  1QN6 A;  3CW7 A;  1N3C A;  3PDK A;  3OSM A;  3TE5 A;  5A36 A;  5IYD P;  3I0W A;  2XHI A;  4Q58 A;  1WYP A;  3RSM A;  3JAL M;  1PZD A;  1BHD A;  5FMT A;  1K35 A;  1DXX A;  2WA5 A;  3OLP A;  5IYB P;  1WYM A;  2Y8Q A;  3OST A;  1M3Q A;  2NLV A;  1KO9 A;  4ROE B;  1P5G X;  3I0X A;  1PCJ X;  4EAL A;  3EIK A;  2HL9 A;  3BKQ X;  1YQM A;  3HOP A;  4TXK A;  3OC3 C;  2NWV A;  2DK9 A;  2IV8 A;  3VP7 A;  2RR8 A;  3F10 A;  1KYF A;  3OSE A;  1QNE A;  3HS8 A;  1DIZ A;  2NOB A;  2H4L X;  5IYC P;  4D7Q A;  2L3G A;  4B0A A;  4EDL A;  2DKA A;  1QN8 A;  2OOY A;  1SH6 A;  2WE6 A;  5KL0 A;  1TGH A;  1EUV A;  4DUL A;  1LWY A;  1D3U A;  3ENC A;  2R0O A;  2V8Q A;  3UW2 A;  3KMW B;  3HOC A;  1PCZ A;  4I8O A;  2HL8 A;  5BVR A;  2EQO A;  3OH9 A;  1QTP A;  2R8U A;  1VOK A;  5J8E A;  3KMU B;  2VJ0 A;  2MZ8 A;  4LVP A;  1KFI A;  2YRN A;  1K2Y X;  3CWT A;  4WXA A;  3KTU A;  2MJ7 A;  1NH2 A;  3CO1 A;  3OGD A;  2D86 A;  4EJZ A;  1YQK A;  2FGT A;  1QNA A;  3CWS A;  5A37 A;  4D7R A;  5F9C A;  1JDY A;  2NVM A;  1WYQ A;  3T4N A;  1TJT A;  3F0Z A;  1KYU A;  1YQR A;  1QN9 A;  1C47 A;  3D7Q A;  5JMV D;  4TXI A;  2K3S A;  2PWW A;  2D85 A;  2JV9 A;  3ULX A;  1MB8 A;  2FUV A;  4IL8 A;  4BJU A;  1SH5 A;  4QG5 A;  1PVS A;  2JHN A;  3DPU A;  5AN4 A;  2ZFD B;  1VOL B;  1WJO A;  2QJX A; 
#chains in the Genus database with same CATH homology
 4DDP A;  3EAY A;  5FMT A;  2HKP A;  5FMU A;  2HL9 A;  2HL8 A;  2VE7 A;  2WDT A;  4LVR A;  2EQO A;  2IGP A;  2WE6 A;  4LVP A;  2VE7 C;  1EUV A;  3VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...