2HL8A

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfinic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
218
Chain Sequence
GSLVPELNEKDDDQVQKALASRETQLMNRNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 218
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hl8A01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hl8A02
3EAYA 2HL8A 2HL9A 2HKPA 1EUVA
chains in the Genus database with same CATH superfamily
2WA5A 3ENOC 2LAEA 3CWAA 3JALM 1SH5A 2NLVA 1TJTA 3RSMA 2NOIA 1AISA 4EJYA 5A37A 3HOPA 1K35A 1YQRA 1DXXA 2D86A 3DPUA 1SH6A 1WYNA 5AN4A 1QNBA 3EIKA 1KYDA 5KL0A 5BVRA 2YH5A 2V92A 1PCMX 1WYQA 2VE7A 1YQMA 4B0AA 2H4LX 5IYCP 3DPTA 3PMGA 3KMUB 5FMTA 3UW2A 1KY7A 2Y8QA 1JFIC 1WKUA 1FN7A 1QN4A 4Q58A 2EYNA 2HZSA 2E9KA 3F7PA 3I3WA 1J3MA 2VZDA 1KY6A 4C7PA 3KRMA 4Q11A 1NVPA 1DIZA 3OLPA 1VKAA 2K3SA 3ASMA 2PWWA 3ULXA 4LVRA 2VE7C 2F7LA 1JDYA 5EPCA 5A36A 2NOHA 4LVPA 1AOAA 2JHJA 2QRDA 3EAYA 4EAKA 2VZIB 1KFIA 2D0BA 1EBMA 4DDPA 2WA6A 2YA3A 4WZSD 3REPB 4D7RA 2VZCA 1WIXA 2VZGB 2IV9A 1AA2A 1QN9A 5BMPA 4I8OA 2V8QA 4BJUA 3OH9A 3OH6A 2MJ7A 2R5XA 2QR1A 1M5Q1 2FGTA 4EDMA 1KFQA 3TDHA 1WQAA 1VOLB 2EHBD 2IV8A 3F10A 3KMWB 3VP7A 1VTLE 2O3OA 3F0ZA 1BKRA 2JOIA 1VKLA 2D85A 5IYBP 1QN6A 2QJZA 1TBAB 2EE7A 4EAJA 1PCZA 2MZ8A 3SNSA 5A38A 1CDWA 2WDTA 1C47A 5IYDP 2JV9A 1K2YX 3IH7A 4DULA 3T4NA 1VOKA 5A4BA 1YQLA 3JARM 4RODB 2WFNA 2JHNA 1V5SA 1RM1A 4EAGA 2XHIA 1XSZA 4EDLA 4CFFA 2NVMA 1TBPA 4EAIA 4TXKA 1N3AA 2QJXA 2Z0FA 2DKCA 1UEGA 3OCIA 2G30A 1PCJX 3OC3C 3D7QA 1M3QA 1N39A 1P5DX 1M3HA 4TXIA 1QAGA 2FUVA 1UT4A 4ROEB 3KTUA 1QN8A 1KO9A 5BMNA 2I5WA 4PY5A 4HJHA 2D0AA 1WYOA 2WE6A 2QREA 2FKMX 2D89A 3I6XA 1PZDA 2FKFA 3OSTA 3BKQX 1TGHA 1UJOA 2NOEA 4Q57B 2D88A 2DK9A 4IL8A 3HOCA 1B9KA 3CO1A 2RR8A 2D87A 1RT8A 3VN5A 3H1ZA 1KYUA 2H5AX 2NOLA 2R0OA 1TUOA 2HZMA 4EDNA 1HU0A 1W80A 5J8EA 1Q9UA 2QLVA 1QNAA 1LXTA 3NA5A 1UL7A 1NGMA 3JAKM 2R8UA 2ZFDB 1EUVA 3CVTA 1YTFA 3TE5A 4TPSA 1WYLA 2NOBA 4B7LA 4WXAA 3I0WA 2Y8LA 1WYRA 1P5SA 2OOXA 3ENCA 5L0OA 2NOFA 1C4GA 4QG5A 2DKDA 4MRQA 2WA7A 2HL9A 1LWWA 1PVSA 1KYFA 4D7QA 2HKPA 1QNCA 3CWUA 1QTSA 1C9BB 2QRCA 2EQOA 5HSHA 1D3UA 3N89A 2D0CA 1WJOA 1MP9A 1UT7A 1NH2A 2K2RA 5JN5A 1QTPA 5FMUA 2OOYA 3HS8A 5F9CA 3CW7A 1P2XA 3FERA 2HL8A 1PXYA 1E42A 2JPIA 1QNEA 2NWVA 2YRNA 1QN7A 1R4XA 1MB8A 2V9JA 4EJZA 1QN3A 3CVSA 1WYMA 3OGDA 1QN5A 3OSMA 3CWSA 1PA7A 2Z8UA 1BHDA 3C04A 1WJWA 3I0XA 2IGPA 1MPGA 1H67A 1YTBA 2NOZA 1LWVA 3OSEA 1LWYA 1YQKA 1WYPA 3PDKA 5JMVD 4WX8A 2VJ0A 1P5GX 3KY9A 1T6AA 3CWTA 2L3GA 4EALA 4Q59A 3HORA 1V5KA 1VTOA 4ROCB 1N3CA 2EYIA 3HS9A 3D4VA 2DKAA 3RPJA
chains in the Genus database with same CATH topology
2VE7A 3VP7A 2EQOA 3EAYA 4LVRA 2HL8A 2VE7C 2HL9A 2HKPA 1EUVA 2WE6A 5FMUA 2WDTA 5FMTA 2IGPA 4LVPA 4DDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAY A;  2HL8 A;  2HL9 A;  2HKP A;  1EUV A; 
#chains in the Genus database with same CATH topology
 2WA5 A;  3ENO C;  2LAE A;  3CWA A;  3JAL M;  1SH5 A;  2NLV A;  1TJT A;  3RSM A;  2NOI A;  1AIS A;  4EJY A;  5A37 A;  3HOP A;  1K35 A;  1YQR A;  1DXX A;  2D86 A;  3DPU A;  1SH6 A;  1WYN A;  5AN4 A;  1QNB A;  3EIK A;  1KYD A;  5KL0 A;  5BVR A;  2YH5 A;  2V92 A;  1PCM X;  1WYQ A;  2VE7 A;  1YQM A;  4B0A A;  2H4L X;  5IYC P;  3DPT A;  3PMG A;  3KMU B;  5FMT A;  3UW2 A;  1KY7 A;  2Y8Q A;  1JFI C;  1WKU A;  1FN7 A;  1QN4 A;  4Q58 A;  2EYN A;  2HZS A;  2E9K A;  3F7P A;  3I3W A;  1J3M A;  2VZD A;  1KY6 A;  4C7P A;  3KRM A;  4Q11 A;  1NVP A;  1DIZ A;  3OLP A;  1VKA A;  2K3S A;  3ASM A;  2PWW A;  3ULX A;  4LVR A;  2VE7 C;  2F7L A;  1JDY A;  5EPC A;  5A36 A;  2NOH A;  4LVP A;  1AOA A;  2JHJ A;  2QRD A;  3EAY A;  4EAK A;  2VZI B;  1KFI A;  2D0B A;  1EBM A;  4DDP A;  2WA6 A;  2YA3 A;  4WZS D;  3REP B;  4D7R A;  2VZC A;  1WIX A;  2VZG B;  2IV9 A;  1AA2 A;  1QN9 A;  5BMP A;  4I8O A;  2V8Q A;  4BJU A;  3OH9 A;  3OH6 A;  2MJ7 A;  2R5X A;  2QR1 A;  1M5Q 1;  2FGT A;  4EDM A;  1KFQ A;  3TDH A;  1WQA A;  1VOL B;  2EHB D;  2IV8 A;  3F10 A;  3KMW B;  3VP7 A;  1VTL E;  2O3O A;  3F0Z A;  1BKR A;  2JOI A;  1VKL A;  2D85 A;  5IYB P;  1QN6 A;  2QJZ A;  1TBA B;  2EE7 A;  4EAJ A;  1PCZ A;  2MZ8 A;  3SNS A;  5A38 A;  1CDW A;  2WDT A;  1C47 A;  5IYD P;  2JV9 A;  1K2Y X;  3IH7 A;  4DUL A;  3T4N A;  1VOK A;  5A4B A;  1YQL A;  3JAR M;  4ROD B;  2WFN A;  2JHN A;  1V5S A;  1RM1 A;  4EAG A;  2XHI A;  1XSZ A;  4EDL A;  4CFF A;  2NVM A;  1TBP A;  4EAI A;  4TXK A;  1N3A A;  2QJX A;  2Z0F A;  2DKC A;  1UEG A;  3OCI A;  2G30 A;  1PCJ X;  3OC3 C;  3D7Q A;  1M3Q A;  1N39 A;  1P5D X;  1M3H A;  4TXI A;  1QAG A;  2FUV A;  1UT4 A;  4ROE B;  3KTU A;  1QN8 A;  1KO9 A;  5BMN A;  2I5W A;  4PY5 A;  4HJH A;  2D0A A;  1WYO A;  2WE6 A;  2QRE A;  2FKM X;  2D89 A;  3I6X A;  1PZD A;  2FKF A;  3OST A;  3BKQ X;  1TGH A;  1UJO A;  2NOE A;  4Q57 B;  2D88 A;  2DK9 A;  4IL8 A;  3HOC A;  1B9K A;  3CO1 A;  2RR8 A;  2D87 A;  1RT8 A;  3VN5 A;  3H1Z A;  1KYU A;  2H5A X;  2NOL A;  2R0O A;  1TUO A;  2HZM A;  4EDN A;  1HU0 A;  1W80 A;  5J8E A;  1Q9U A;  2QLV A;  1QNA A;  1LXT A;  3NA5 A;  1UL7 A;  1NGM A;  3JAK M;  2R8U A;  2ZFD B;  1EUV A;  3CVT A;  1YTF A;  3TE5 A;  4TPS A;  1WYL A;  2NOB A;  4B7L A;  4WXA A;  3I0W A;  2Y8L A;  1WYR A;  1P5S A;  2OOX A;  3ENC A;  5L0O A;  2NOF A;  1C4G A;  4QG5 A;  2DKD A;  4MRQ A;  2WA7 A;  2HL9 A;  1LWW A;  1PVS A;  1KYF A;  4D7Q A;  2HKP A;  1QNC A;  3CWU A;  1QTS A;  1C9B B;  2QRC A;  2EQO A;  5HSH A;  1D3U A;  3N89 A;  2D0C A;  1WJO A;  1MP9 A;  1UT7 A;  1NH2 A;  2K2R A;  5JN5 A;  1QTP A;  5FMU A;  2OOY A;  3HS8 A;  5F9C A;  3CW7 A;  1P2X A;  3FER A;  2HL8 A;  1PXY A;  1E42 A;  2JPI A;  1QNE A;  2NWV A;  2YRN A;  1QN7 A;  1R4X A;  1MB8 A;  2V9J A;  4EJZ A;  1QN3 A;  3CVS A;  1WYM A;  3OGD A;  1QN5 A;  3OSM A;  3CWS A;  1PA7 A;  2Z8U A;  1BHD A;  3C04 A;  1WJW A;  3I0X A;  2IGP A;  1MPG A;  1H67 A;  1YTB A;  2NOZ A;  1LWV A;  3OSE A;  1LWY A;  1YQK A;  1WYP A;  3PDK A;  5JMV D;  4WX8 A;  2VJ0 A;  1P5G X;  3KY9 A;  1T6A A;  3CWT A;  2L3G A;  4EAL A;  4Q59 A;  3HOR A;  1V5K A;  1VTO A;  4ROC B;  1N3C A;  2EYI A;  3HS9 A;  3D4V A;  2DKA A;  3RPJ A; 
#chains in the Genus database with same CATH homology
 2VE7 A;  3VP7 A;  2EQO A;  3EAY A;  4LVR A;  2HL8 A;  2VE7 C;  2HL9 A;  2HKP A;  1EUV A;  2WE6 A;  5FMU A;  2WDT A;  5FMT A;  2IGP A;  4LVP A;  4DDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...