2VE7C

Crystal structure of a bonsai version of the human ndc80 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
238
structure length
219
Chain Sequence
LSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSGVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLEIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHQPIHLDSTQLSRKFISDYLWSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN SPC25
publication title Implications for Kinetochore-Microtubule Attachment from the Structure of an Engineered Ndc80 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 219
sequence length 238
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03800 Nuf2 Nuf2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.60 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2ve7C01
3.30.160.570 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ve7C02
2VE7C
chains in the Genus database with same CATH superfamily
1FJGE 4X8WA 3K6QA 1DXXA 4FK5C 2DK9A 2WA5A 4X65E 3BIDA 1A1KA 1WHNA 4NZVA 2RR8A 5A6JA 1RT8A 4GKJE 2K3SA 2JP9A 1T4OA 3IWBA 2RSMA 2FGGA 2RTXA 4Q28A 1AH5A 3JAMC 2B7VA 5A6BD 1PJQA 2EQOA 1F2IG 1GZ6A 2DLKA 2E1MA 3EAYA 3JARM 2VE7A 4TUGA 1X49A 1EH8A 1WYPA 1TN9A 4M9VC 2A25A 4J8ZA 2WBUA 4KHPE 1PJSA 2LRSA 2WBTA 4WFTA 5LL6R 4BHBA 3ZOQB 5FMUA 1GQEA 2K7IA 2EMFA 2V86A 2EOSA 2EMKA 3MSWA 4M2ZA 4R2DA 2EOYA 2GPIA 1QNTA 2YRNA 2LBSB 2L33A 4O24A 3ECRA 1I94E 3EPJA 1X47A 3HPZA 2M1SA 3IWDA 4F54A 2L92A 4O43A 2L8TA 3H09A 2WFNA 3REPB 4O4KA 1N32E 2R8UA 2EPMX 4DV2E 2EPRA 1LLMC 2RS7A 3VP7A 2M9AA 2EOJA 5FLXC 3JALM 4IS1C 1A1IA 2EN6A 3KWRA 4RHBB 2JOBA 2YSOA 3FERA 2WZOA 5KL3A 1MEYC 2CPNA 2EOZA 4WSPA 5KL6A 2D89A 2EN3A 3OTOE 1A1FA 3JTZA 3J7Yp 2EM6A 4JV5E 1BKRA 2JOXA 2EL6A 4WPYA 1ZBTA 5IWAE 3HOCA 1N36E 1PXYA 2UUBE 3KMUB 2CTDA 2F8BA 2EN8A 5A6AA 1HR0E 2B7TA 4BMJA 1X6EA 4KWYA 2KONA 1T4LB 3RMPA 3AV0A 4Q59A 4KZSA 5AASA 2EPUA 1BB8A 2YU5A 3OMLA 2NUFA 3VHTB 2DMIA 4HEIA 3BBGA 2GHFA 1PKPA 1YUJA 1RC7A 2EM0A 2JWOA 4JI5E 4LTYA 2WDTA 2MDRA 2RSIA 1IQOA 1EH6A 2EMZA 2G7HA 4N4RB 2EZ6A 3LMLA 2WCC3 2EN4A 4ZYHA 2ENAA 3C6MA 4DDPA 4BBYA 2HJJA 1BHDA 2YTDA 2EOFA 1UILA 2DB2A 2EOHA 2YSPA 2EQ1A 2QJZA 2EN2A 5A2QC 2L3JA 2HKPA 1T4NA 4R2AA 2EOEA 2MKNA 1SFEA 4NXNE 2YWQA 3KY9A 1STUA 2RS6A 1HNWE 5A4BA 2L2KB 5BR8E 2WA7A 1FKAE 2RQLA 4JI8E 4MLQA 2LUPB 4LF5E 1UBDC 2LVHA 4LF9E 4R8OA 4LFCE 2D85A 2M7QA 1A1LA 4DKKA 5ADZA 5BVRA 1IMUA 4DUYE 1SR9A 2IGPA 1QU6A 2YTIA 2JYAA 1XNQE 3FIGA 1X6FA 2VZIB 2LE2A 1IBME 1YYKA 1YPNA 2ENCA 2IHR1 3J7AG 2YTOA 1MGTA 1UJOA 4F2JC 1IBKE 3CO1A 2WBSA 5A38A 2EOMA 3DJWA 2RPCA 2EN1A 2YTJA 4LF8E 4TXIA 2ODRD 5AE3A 3F6HA 5KL7A 5A36A 2UXDE 1GTKA 2V89A 3VYXA 4LF6E 5AC5A 2FV4B 1UHZA 2MC5A 1WKUA 2YTGA 1KYQA 2UXBE 1WIXA 1AA2A 4DV1E 4DV7E 1V5KA 2ODRC 4LVRA 5AC4A 3TQMA 4DV4E 2EJ4A 1WXRA 4JI3E 2VZCA 2EOXA 3ADJA 2EMCA 3T1HE 2YT4A 4DR1E 5A6KA 2MC6A 2YTEA 4ZYEA 4X9JA 2FTXB 1T39A 1WJOA 1WRJA 2EM4A 1HNXE 2UU9E 5F3WA 4LFAE 1P47A 2YTPA 4WYQB 4DR6E 4NHRA 2EMYA 1N3GA 2L6MA 5KL2A 2EMLA 4R2PA 3KMWB 2D86A 2EYIA 4DV3E 1XMOE 1WJPA 4M30A 4YY3E 2EMBA 1IBLE 3F7PA 3F6GA 4BCAA 2EM2A 3BF2A 3P1XA 4L8NA 4RH8A 2L2MA 3C6KA 4WX9A 2LTRA 3J80C 1AOAA 1ZR9A 2ELZA 5FMTA 1PA7A 4B3RE 3JU0A 1RMDA 1WYOA 1G2DC 4Q57B 3DF6A 2V87A 4X64E 2VE7C 2EM7A 4JI2E 2LT7A 2EYNA 2EPCA 3HXLA 4JI6E 2YZTA 4B3SE 3I6XA 2YTFA 1WYRA 2EMGA 2VF1A 1AAYA 2EOIA 5A69A 2BBGA 2JVAA 4ZYGA 3UK3C 1WYNA 3HORA 2ELYA 1WYQA 1DQ3A 2DLQA 2R1FA 2YTNA 2K2RA 3HQ1A 5TSEA 3JAKM 2K4VA 5KL4A 2EWLA 3ADIA 1YUIA 1ZU1A 5A6BA 4TUIA 2QJXA 2VRDA 1WYMA 2VQFE 2NUEA 4I8OA 2EL5A 1YYOA 2D88A 2H36X 4Q35B 3ADLA 2EPKX 3IWCA 4R2QA 2EQ0A 3C4TA 3M99B 1XMQE 2KHXA 2YRHA 4JI0E 4R2RA 4LVPA 4GKKE 1EUVA 2EN7A 1X5WA 5LMUE 2EPZA 2M4IA 5T6JA 2WE6A 1PJTA 5IV8B 3T1YE 2DRPA 2NABA 5J8EA 4BC7A 2UUCE 2VZGB 2B9DA 1UN6B 1PDAA 4WXCA 5AE2A 2EPNA 3BGHA 4EDNA 4X66E 4YHHE 1YSAC 2E72A 1J26A 2MKDA 2KOUA 2D9HA 2HL8A 2N3HA 2EMWA 2HGHA 2I9IA 4MLVA 2EPAA 2V83A 2GLIA 1B69A 1L4SA 2LJUA 4GEQB 4M0VA 2EM8A 1XNRE 2LCEA 1YFHA 4Q58A 2EOQA 2NUGA 4P7DA 4WSGA 4OOGC 4R2SA 4R2CA 2NA2A 4GZNC 2CT1A 1H67A 2EM9A 1SH6A 1MB8A 2ENHA 4BHCA 4ZYDA 2MDGA 5L0OA 2JR1A 2EM3A 2EP3A 1T38A 1YZ9A 4JYAE 2EPOA 3HPSA 3LLHA 1Z1BA 5A37A 2I13A 5DNYA 2N3GA 1QAGA 4F9CB 1DGCA 1J5EE 4B7LA 2EPLX 2WA6A 4F6NA 1TF3A 1HNZE 3EQ1A 1NEIA 4K0KE 1P5SA 1JK2A 4LFBE 4F9BB 1VKAA 2EORA 2EMHA 1SH5A 2YPNA 1X3CA 4LF4E 2V85A 4JI1E 2LO3A 2D87A 2HL9A 2EM5A 2LTSA 3HTXA 2YRKA 4BS9A 2N8XA 3EPKA 2V8QB 3MHHC 1NCSA 2UUAE 2LJHA 2F4VE 2LUQA 1JK1A 2L3CA 2JV9A 5LLQA 4DR7E 5CFFE 2EMXA 4R2EA 2ADRA 2EPXA 2L2NA 1N33E 2LMZA 1TF6A 1BBGA 2V88A 3KZZA 2JPAA 1A1GA 2E5LE 1BBOA 4DMIA 4DV0E 3QG5C 2ZM6E 3EPHA 2EPPA 2YTQA 2YU8A 4DR2E 1G2FC 1EH7A 3THNA 1IQSA 5AE1A 4EDMA 2Q8UA 4TXKA 3MHSC 2EOOA 4B3ME 4DUZE 1A1HA 3ADGA 1ZAAC 2R0OA 2PRTA 1WHQA 4R03A 2EE8A 2HC5A 3J81C 1WYLA 3KZYA 1KJKA 1P2XA 4IJDA 1N34E 1X6HA 2VZDA 1X48A 4WXDA 3VK6A 2EQ3A 2VQEE 4JI4E 2DIXA 2EE7A 4F9AB 2R76A 4OX9E 3HOPA 2L3GA 1UEGA 4O5GA 2DGCA 4L5NC 3THOB 1YYWA 2DMYA 2BB8A 2CSHA 3C4BA 1EKZA 2E9KA 5IT9C 4B3TE 2J7JA 2EMIA 4P78A 5IXMB 1TJTA 4LU9A 2UXCE 4EDLA 4DR4E 4DV6E 2LV2A 4NXME 4LF7E 4JI7E 2EL4A 1RQ0A 1A1JA 2EMAA 1DI2A 4DV5E 2YRMA 2B3TB 2DSYA 5KL5A 5LMNE 4F6MA 2HHHE 3EPLA 3L00A 2JY9A 4BC9A 4DR5E 3VYYA 4AQYE 1O0WA 2JXPA 4HTGA 4DR3E 3AUZA 1ZBQA 4X62E
chains in the Genus database with same CATH topology
1FJGE 4X8WA 3K6QA 4X65E 1WHNA 4GKJE 1T4OA 3IWBA 2RSMA 2FGGA 2RTXA 4Q28A 3JAMC 2B7VA 2EQOA 1GZ6A 2E1MA 3EAYA 2VE7A 4TUGA 1X49A 4J8ZA 4KHPE 2LRSA 4WFTA 5LL6R 3ZOQB 5FMUA 1GQEA 2V86A 3MSWA 4M2ZA 2LBSB 2L33A 1I94E 1X47A 3HPZA 2M1SA 3IWDA 4F54A 2L92A 2L8TA 3H09A 1N32E 4DV2E 2RS7A 3VP7A 5FLXC 3KWRA 2JOBA 2WZOA 2CPNA 4WSPA 3OTOE 3JTZA 3J7Yp 4JV5E 2JOXA 4WPYA 1ZBTA 5IWAE 1N36E 2UUBE 2F8BA 1HR0E 2B7TA 4BMJA 2KONA 1T4LB 3RMPA 3AV0A 4KZSA 5AASA 3OMLA 2NUFA 1PKPA 1RC7A 2JWOA 4JI5E 4LTYA 2WDTA 2MDRA 2G7HA 2EZ6A 3LMLA 4DDPA 4BBYA 1UILA 2DB2A 5A2QC 2L3JA 2HKPA 1T4NA 4NXNE 1STUA 2RS6A 1HNWE 2L2KB 5BR8E 1FKAE 4JI8E 2LUPB 4LF5E 4LF9E 4R8OA 4LFCE 2M7QA 4DKKA 5ADZA 4DUYE 1SR9A 2IGPA 1QU6A 1XNQE 3FIGA 2LE2A 1IBME 1YYKA 2IHR1 3J7AG 1IBKE 3DJWA 4LF8E 2ODRD 5AE3A 3F6HA 2UXDE 2V89A 3VYXA 4LF6E 2FV4B 1UHZA 2MC5A 2UXBE 4DV1E 4DV7E 2ODRC 4LVRA 4DV4E 1WXRA 4JI3E 3ADJA 3T1HE 2YT4A 4DR1E 2MC6A 2FTXB 2UU9E 1HNXE 5F3WA 4LFAE 4WYQB 4DR6E 4DV3E 2L6MA 1XMOE 4M30A 4YY3E 1IBLE 3F6GA 4BCAA 3P1XA 4L8NA 2L2MA 2LTRA 3J80C 5FMTA 4B3RE 3JU0A 3DF6A 2V87A 4X64E 2VE7C 4JI2E 3HXLA 4JI6E 2YZTA 4B3SE 2VF1A 2JVAA 1DQ3A 3HQ1A 2K4VA 2EWLA 3ADIA 4TUIA 2VQFE 2NUEA 4I8OA 1YYOA 2H36X 3ADLA 3IWCA 3C4TA 1XMQE 2KHXA 4JI0E 4LVPA 4GKKE 1EUVA 5LMUE 3T1YE 2M4IA 5T6JA 2WE6A 4BC7A 2UUCE 2B9DA 5AE2A 4X66E 4YHHE 1J26A 2KOUA 2HL8A 2N3HA 2V83A 4GEQB 4M0VA 1XNRE 2NUGA 4P7DA 4OOGC 2NA2A 2JR1A 1YZ9A 4JYAE 3HPSA 3LLHA 5DNYA 2N3GA 4F9CB 1J5EE 1HNZE 4K0KE 4LFBE 4F9BB 4LF4E 2V85A 4JI1E 2HL9A 2LTSA 3HTXA 4BS9A 2V8QB 2UUAE 2LJHA 2F4VE 2LUQA 2L3CA 4DR7E 5CFFE 2L2NA 1N33E 2LMZA 2V88A 2E5LE 4DMIA 4DV0E 2ZM6E 4DR2E 5AE1A 4B3ME 4DUZE 3ADGA 1WHQA 4R03A 3J81C 1N34E 1X48A 2VQEE 3VK6A 4JI4E 2DIXA 4F9AB 4OX9E 4L5NC 1YYWA 2DMYA 3C4BA 1EKZA 5IT9C 4B3TE 4P78A 4LU9A 2UXCE 4DR4E 4DV6E 4NXME 4LF7E 4JI7E 1RQ0A 1DI2A 4DV5E 2B3TB 2DSYA 2HHHE 5LMNE 2JY9A 4BC9A 4DR5E 3VYYA 4AQYE 1O0WA 4DR3E 3AUZA 1ZBQA 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE7 C; 
#chains in the Genus database with same CATH topology
 1FJG E;  4X8W A;  3K6Q A;  1DXX A;  4FK5 C;  2DK9 A;  2WA5 A;  4X65 E;  3BID A;  1A1K A;  1WHN A;  4NZV A;  2RR8 A;  5A6J A;  1RT8 A;  4GKJ E;  2K3S A;  2JP9 A;  1T4O A;  3IWB A;  2RSM A;  2FGG A;  2RTX A;  4Q28 A;  1AH5 A;  3JAM C;  2B7V A;  5A6B D;  1PJQ A;  2EQO A;  1F2I G;  1GZ6 A;  2DLK A;  2E1M A;  3EAY A;  3JAR M;  2VE7 A;  4TUG A;  1X49 A;  1EH8 A;  1WYP A;  1TN9 A;  4M9V C;  2A25 A;  4J8Z A;  2WBU A;  4KHP E;  1PJS A;  2LRS A;  2WBT A;  4WFT A;  5LL6 R;  4BHB A;  3ZOQ B;  5FMU A;  1GQE A;  2K7I A;  2EMF A;  2V86 A;  2EOS A;  2EMK A;  3MSW A;  4M2Z A;  4R2D A;  2EOY A;  2GPI A;  1QNT A;  2YRN A;  2LBS B;  2L33 A;  4O24 A;  3ECR A;  1I94 E;  3EPJ A;  1X47 A;  3HPZ A;  2M1S A;  3IWD A;  4F54 A;  2L92 A;  4O43 A;  2L8T A;  3H09 A;  2WFN A;  3REP B;  4O4K A;  1N32 E;  2R8U A;  2EPM X;  4DV2 E;  2EPR A;  1LLM C;  2RS7 A;  3VP7 A;  2M9A A;  2EOJ A;  5FLX C;  3JAL M;  4IS1 C;  1A1I A;  2EN6 A;  3KWR A;  4RHB B;  2JOB A;  2YSO A;  3FER A;  2WZO A;  5KL3 A;  1MEY C;  2CPN A;  2EOZ A;  4WSP A;  5KL6 A;  2D89 A;  2EN3 A;  3OTO E;  1A1F A;  3JTZ A;  3J7Y p;  2EM6 A;  4JV5 E;  1BKR A;  2JOX A;  2EL6 A;  4WPY A;  1ZBT A;  5IWA E;  3HOC A;  1N36 E;  1PXY A;  2UUB E;  3KMU B;  2CTD A;  2F8B A;  2EN8 A;  5A6A A;  1HR0 E;  2B7T A;  4BMJ A;  1X6E A;  4KWY A;  2KON A;  1T4L B;  3RMP A;  3AV0 A;  4Q59 A;  4KZS A;  5AAS A;  2EPU A;  1BB8 A;  2YU5 A;  3OML A;  2NUF A;  3VHT B;  2DMI A;  4HEI A;  3BBG A;  2GHF A;  1PKP A;  1YUJ A;  1RC7 A;  2EM0 A;  2JWO A;  4JI5 E;  4LTY A;  2WDT A;  2MDR A;  2RSI A;  1IQO A;  1EH6 A;  2EMZ A;  2G7H A;  4N4R B;  2EZ6 A;  3LML A;  2WCC 3;  2EN4 A;  4ZYH A;  2ENA A;  3C6M A;  4DDP A;  4BBY A;  2HJJ A;  1BHD A;  2YTD A;  2EOF A;  1UIL A;  2DB2 A;  2EOH A;  2YSP A;  2EQ1 A;  2QJZ A;  2EN2 A;  5A2Q C;  2L3J A;  2HKP A;  1T4N A;  4R2A A;  2EOE A;  2MKN A;  1SFE A;  4NXN E;  2YWQ A;  3KY9 A;  1STU A;  2RS6 A;  1HNW E;  5A4B A;  2L2K B;  5BR8 E;  2WA7 A;  1FKA E;  2RQL A;  4JI8 E;  4MLQ A;  2LUP B;  4LF5 E;  1UBD C;  2LVH A;  4LF9 E;  4R8O A;  4LFC E;  2D85 A;  2M7Q A;  1A1L A;  4DKK A;  5ADZ A;  5BVR A;  1IMU A;  4DUY E;  1SR9 A;  2IGP A;  1QU6 A;  2YTI A;  2JYA A;  1XNQ E;  3FIG A;  1X6F A;  2VZI B;  2LE2 A;  1IBM E;  1YYK A;  1YPN A;  2ENC A;  2IHR 1;  3J7A G;  2YTO A;  1MGT A;  1UJO A;  4F2J C;  1IBK E;  3CO1 A;  2WBS A;  5A38 A;  2EOM A;  3DJW A;  2RPC A;  2EN1 A;  2YTJ A;  4LF8 E;  4TXI A;  2ODR D;  5AE3 A;  3F6H A;  5KL7 A;  5A36 A;  2UXD E;  1GTK A;  2V89 A;  3VYX A;  4LF6 E;  5AC5 A;  2FV4 B;  1UHZ A;  2MC5 A;  1WKU A;  2YTG A;  1KYQ A;  2UXB E;  1WIX A;  1AA2 A;  4DV1 E;  4DV7 E;  1V5K A;  2ODR C;  4LVR A;  5AC4 A;  3TQM A;  4DV4 E;  2EJ4 A;  1WXR A;  4JI3 E;  2VZC A;  2EOX A;  3ADJ A;  2EMC A;  3T1H E;  2YT4 A;  4DR1 E;  5A6K A;  2MC6 A;  2YTE A;  4ZYE A;  4X9J A;  2FTX B;  1T39 A;  1WJO A;  1WRJ A;  2EM4 A;  1HNX E;  2UU9 E;  5F3W A;  4LFA E;  1P47 A;  2YTP A;  4WYQ B;  4DR6 E;  4NHR A;  2EMY A;  1N3G A;  2L6M A;  5KL2 A;  2EML A;  4R2P A;  3KMW B;  2D86 A;  2EYI A;  4DV3 E;  1XMO E;  1WJP A;  4M30 A;  4YY3 E;  2EMB A;  1IBL E;  3F7P A;  3F6G A;  4BCA A;  2EM2 A;  3BF2 A;  3P1X A;  4L8N A;  4RH8 A;  2L2M A;  3C6K A;  4WX9 A;  2LTR A;  3J80 C;  1AOA A;  1ZR9 A;  2ELZ A;  5FMT A;  1PA7 A;  4B3R E;  3JU0 A;  1RMD A;  1WYO A;  1G2D C;  4Q57 B;  3DF6 A;  2V87 A;  4X64 E;  2VE7 C;  2EM7 A;  4JI2 E;  2LT7 A;  2EYN A;  2EPC A;  3HXL A;  4JI6 E;  2YZT A;  4B3S E;  3I6X A;  2YTF A;  1WYR A;  2EMG A;  2VF1 A;  1AAY A;  2EOI A;  5A69 A;  2BBG A;  2JVA A;  4ZYG A;  3UK3 C;  1WYN A;  3HOR A;  2ELY A;  1WYQ A;  1DQ3 A;  2DLQ A;  2R1F A;  2YTN A;  2K2R A;  3HQ1 A;  5TSE A;  3JAK M;  2K4V A;  5KL4 A;  2EWL A;  3ADI A;  1YUI A;  1ZU1 A;  5A6B A;  4TUI A;  2QJX A;  2VRD A;  1WYM A;  2VQF E;  2NUE A;  4I8O A;  2EL5 A;  1YYO A;  2D88 A;  2H36 X;  4Q35 B;  3ADL A;  2EPK X;  3IWC A;  4R2Q A;  2EQ0 A;  3C4T A;  3M99 B;  1XMQ E;  2KHX A;  2YRH A;  4JI0 E;  4R2R A;  4LVP A;  4GKK E;  1EUV A;  2EN7 A;  1X5W A;  5LMU E;  2EPZ A;  2M4I A;  5T6J A;  2WE6 A;  1PJT A;  5IV8 B;  3T1Y E;  2DRP A;  2NAB A;  5J8E A;  4BC7 A;  2UUC E;  2VZG B;  2B9D A;  1UN6 B;  1PDA A;  4WXC A;  5AE2 A;  2EPN A;  3BGH A;  4EDN A;  4X66 E;  4YHH E;  1YSA C;  2E72 A;  1J26 A;  2MKD A;  2KOU A;  2D9H A;  2HL8 A;  2N3H A;  2EMW A;  2HGH A;  2I9I A;  4MLV A;  2EPA A;  2V83 A;  2GLI A;  1B69 A;  1L4S A;  2LJU A;  4GEQ B;  4M0V A;  2EM8 A;  1XNR E;  2LCE A;  1YFH A;  4Q58 A;  2EOQ A;  2NUG A;  4P7D A;  4WSG A;  4OOG C;  4R2S A;  4R2C A;  2NA2 A;  4GZN C;  2CT1 A;  1H67 A;  2EM9 A;  1SH6 A;  1MB8 A;  2ENH A;  4BHC A;  4ZYD A;  2MDG A;  5L0O A;  2JR1 A;  2EM3 A;  2EP3 A;  1T38 A;  1YZ9 A;  4JYA E;  2EPO A;  3HPS A;  3LLH A;  1Z1B A;  5A37 A;  2I13 A;  5DNY A;  2N3G A;  1QAG A;  4F9C B;  1DGC A;  1J5E E;  4B7L A;  2EPL X;  2WA6 A;  4F6N A;  1TF3 A;  1HNZ E;  3EQ1 A;  1NEI A;  4K0K E;  1P5S A;  1JK2 A;  4LFB E;  4F9B B;  1VKA A;  2EOR A;  2EMH A;  1SH5 A;  2YPN A;  1X3C A;  4LF4 E;  2V85 A;  4JI1 E;  2LO3 A;  2D87 A;  2HL9 A;  2EM5 A;  2LTS A;  3HTX A;  2YRK A;  4BS9 A;  2N8X A;  3EPK A;  2V8Q B;  3MHH C;  1NCS A;  2UUA E;  2LJH A;  2F4V E;  2LUQ A;  1JK1 A;  2L3C A;  2JV9 A;  5LLQ A;  4DR7 E;  5CFF E;  2EMX A;  4R2E A;  2ADR A;  2EPX A;  2L2N A;  1N33 E;  2LMZ A;  1TF6 A;  1BBG A;  2V88 A;  3KZZ A;  2JPA A;  1A1G A;  2E5L E;  1BBO A;  4DMI A;  4DV0 E;  3QG5 C;  2ZM6 E;  3EPH A;  2EPP A;  2YTQ A;  2YU8 A;  4DR2 E;  1G2F C;  1EH7 A;  3THN A;  1IQS A;  5AE1 A;  4EDM A;  2Q8U A;  4TXK A;  3MHS C;  2EOO A;  4B3M E;  4DUZ E;  1A1H A;  3ADG A;  1ZAA C;  2R0O A;  2PRT A;  1WHQ A;  4R03 A;  2EE8 A;  2HC5 A;  3J81 C;  1WYL A;  3KZY A;  1KJK A;  1P2X A;  4IJD A;  1N34 E;  1X6H A;  2VZD A;  1X48 A;  4WXD A;  3VK6 A;  2EQ3 A;  2VQE E;  4JI4 E;  2DIX A;  2EE7 A;  4F9A B;  2R76 A;  4OX9 E;  3HOP A;  2L3G A;  1UEG A;  4O5G A;  2DGC A;  4L5N C;  3THO B;  1YYW A;  2DMY A;  2BB8 A;  2CSH A;  3C4B A;  1EKZ A;  2E9K A;  5IT9 C;  4B3T E;  2J7J A;  2EMI A;  4P78 A;  5IXM B;  1TJT A;  4LU9 A;  2UXC E;  4EDL A;  4DR4 E;  4DV6 E;  2LV2 A;  4NXM E;  4LF7 E;  4JI7 E;  2EL4 A;  1RQ0 A;  1A1J A;  2EMA A;  1DI2 A;  4DV5 E;  2YRM A;  2B3T B;  2DSY A;  5KL5 A;  5LMN E;  4F6M A;  2HHH E;  3EPL A;  3L00 A;  2JY9 A;  4BC9 A;  4DR5 E;  3VYY A;  4AQY E;  1O0W A;  2JXP A;  4HTG A;  4DR3 E;  3AUZ A;  1ZBQ A;  4X62 E; 
#chains in the Genus database with same CATH homology
 1FJG E;  4X8W A;  3K6Q A;  4X65 E;  1WHN A;  4GKJ E;  1T4O A;  3IWB A;  2RSM A;  2FGG A;  2RTX A;  4Q28 A;  3JAM C;  2B7V A;  2EQO A;  1GZ6 A;  2E1M A;  3EAY A;  2VE7 A;  4TUG A;  1X49 A;  4J8Z A;  4KHP E;  2LRS A;  4WFT A;  5LL6 R;  3ZOQ B;  5FMU A;  1GQE A;  2V86 A;  3MSW A;  4M2Z A;  2LBS B;  2L33 A;  1I94 E;  1X47 A;  3HPZ A;  2M1S A;  3IWD A;  4F54 A;  2L92 A;  2L8T A;  3H09 A;  1N32 E;  4DV2 E;  2RS7 A;  3VP7 A;  5FLX C;  3KWR A;  2JOB A;  2WZO A;  2CPN A;  4WSP A;  3OTO E;  3JTZ A;  3J7Y p;  4JV5 E;  2JOX A;  4WPY A;  1ZBT A;  5IWA E;  1N36 E;  2UUB E;  2F8B A;  1HR0 E;  2B7T A;  4BMJ A;  2KON A;  1T4L B;  3RMP A;  3AV0 A;  4KZS A;  5AAS A;  3OML A;  2NUF A;  1PKP A;  1RC7 A;  2JWO A;  4JI5 E;  4LTY A;  2WDT A;  2MDR A;  2G7H A;  2EZ6 A;  3LML A;  4DDP A;  4BBY A;  1UIL A;  2DB2 A;  5A2Q C;  2L3J A;  2HKP A;  1T4N A;  4NXN E;  1STU A;  2RS6 A;  1HNW E;  2L2K B;  5BR8 E;  1FKA E;  4JI8 E;  2LUP B;  4LF5 E;  4LF9 E;  4R8O A;  4LFC E;  2M7Q A;  4DKK A;  5ADZ A;  4DUY E;  1SR9 A;  2IGP A;  1QU6 A;  1XNQ E;  3FIG A;  2LE2 A;  1IBM E;  1YYK A;  2IHR 1;  3J7A G;  1IBK E;  3DJW A;  4LF8 E;  2ODR D;  5AE3 A;  3F6H A;  2UXD E;  2V89 A;  3VYX A;  4LF6 E;  2FV4 B;  1UHZ A;  2MC5 A;  2UXB E;  4DV1 E;  4DV7 E;  2ODR C;  4LVR A;  4DV4 E;  1WXR A;  4JI3 E;  3ADJ A;  3T1H E;  2YT4 A;  4DR1 E;  2MC6 A;  2FTX B;  2UU9 E;  1HNX E;  5F3W A;  4LFA E;  4WYQ B;  4DR6 E;  4DV3 E;  2L6M A;  1XMO E;  4M30 A;  4YY3 E;  1IBL E;  3F6G A;  4BCA A;  3P1X A;  4L8N A;  2L2M A;  2LTR A;  3J80 C;  5FMT A;  4B3R E;  3JU0 A;  3DF6 A;  2V87 A;  4X64 E;  2VE7 C;  4JI2 E;  3HXL A;  4JI6 E;  2YZT A;  4B3S E;  2VF1 A;  2JVA A;  1DQ3 A;  3HQ1 A;  2K4V A;  2EWL A;  3ADI A;  4TUI A;  2VQF E;  2NUE A;  4I8O A;  1YYO A;  2H36 X;  3ADL A;  3IWC A;  3C4T A;  1XMQ E;  2KHX A;  4JI0 E;  4LVP A;  4GKK E;  1EUV A;  5LMU E;  3T1Y E;  2M4I A;  5T6J A;  2WE6 A;  4BC7 A;  2UUC E;  2B9D A;  5AE2 A;  4X66 E;  4YHH E;  1J26 A;  2KOU A;  2HL8 A;  2N3H A;  2V83 A;  4GEQ B;  4M0V A;  1XNR E;  2NUG A;  4P7D A;  4OOG C;  2NA2 A;  2JR1 A;  1YZ9 A;  4JYA E;  3HPS A;  3LLH A;  5DNY A;  2N3G A;  4F9C B;  1J5E E;  1HNZ E;  4K0K E;  4LFB E;  4F9B B;  4LF4 E;  2V85 A;  4JI1 E;  2HL9 A;  2LTS A;  3HTX A;  4BS9 A;  2V8Q B;  2UUA E;  2LJH A;  2F4V E;  2LUQ A;  2L3C A;  4DR7 E;  5CFF E;  2L2N A;  1N33 E;  2LMZ A;  2V88 A;  2E5L E;  4DMI A;  4DV0 E;  2ZM6 E;  4DR2 E;  5AE1 A;  4B3M E;  4DUZ E;  3ADG A;  1WHQ A;  4R03 A;  3J81 C;  1N34 E;  1X48 A;  2VQE E;  3VK6 A;  4JI4 E;  2DIX A;  4F9A B;  4OX9 E;  4L5N C;  1YYW A;  2DMY A;  3C4B A;  1EKZ A;  5IT9 C;  4B3T E;  4P78 A;  4LU9 A;  2UXC E;  4DR4 E;  4DV6 E;  4NXM E;  4LF7 E;  4JI7 E;  1RQ0 A;  1DI2 A;  4DV5 E;  2B3T B;  2DSY A;  2HHH E;  5LMN E;  2JY9 A;  4BC9 A;  4DR5 E;  3VYY A;  4AQY E;  1O0W A;  4DR3 E;  3AUZ A;  1ZBQ A;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...