2VE7C

Crystal structure of a bonsai version of the human ndc80 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
238
structure length
219
Chain Sequence
LSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSGVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLEIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHQPIHLDSTQLSRKFISDYLWSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN SPC25
publication title Implications for Kinetochore-Microtubule Attachment from the Structure of an Engineered Ndc80 Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 219
sequence length 238
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03800 Nuf2 Nuf2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.60 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2ve7C01
3.30.160.570 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ve7C02
2VE7C
chains in the Genus database with same CATH superfamily
2KOUA 3EPKA 1HR0E 4DR1E 1EKZA 4LF8E 2EPLX 2F4VE 3F6GA 1SR9A 3LMLA 2EOIA 5KL6A 2EPCA 3I6XA 2EN1A 2B7TA 3L00A 2IGPA 5F3WA 1JK1A 5LMNE 2FV4B 4B3TE 1MB8A 5A6AA 4LFBE 4GKJE 1SFEA 2ADRA 4RHBB 3DJWA 3C4BA 1V5KA 3P1XA 5LLQA 4OX9E 2JV9A 2WFNA 4JYAE 1DI2A 1UN6B 5BVRA 3JAKM 2DB2A 1X49A 3VYYA 4KHPE 1P5SA 2WDTA 1YZ9A 3ADLA 2EMIA 1X48A 2EQOA 2L6MA 4I8OA 2JYAA 2EN7A 2ODRC 2JVAA 4X65E 4Q58A 2YTJA 1N3GA 2LVHA 4N4RB 2VQFE 1NCSA 2D85A 3JARM 2EP3A 4ZYEA 2EM3A 4P78A 1TF6A 2EJ4A 2MDRA 1HNZE 2L3GA 2I13A 2GPIA 2YRMA 3JU0A 2VZIB 4OOGC 2RS6A 2WA6A 2WZOA 2YSOA 1WIXA 3KMWB 2EMCA 2EN2A 3OMLA 2EORA 4O43A 1GZ6A 4LF5E 5AASA 4DV4E 2NUGA 1PJSA 2MC6A 3FIGA 5FLXC 3RMPA 4JI5E 2YTQA 2YRKA 1IBLE 4JI6E 1IQSA 1XNQE 2LJHA 2HJJA 2ENHA 2YTGA 1DGCA 2E72A 4AQYE 4LTYA 1TF3A 3BBGA 2EZ6A 2J7JA 2LO3A 4IJDA 5TSEA 5KL5A 3HORA 2EM6A 1A1HA 2EOXA 1AH5A 2FTXB 4ZYGA 4WSPA 5AC5A 4LF6E 4M9VC 1XNRE 4YY3E 1PDAA 1VKAA 1FJGE 2EE8A 4DR2E 2Q8UA 2EMLA 2UUBE 4JI0E 1T4NA 1TJTA 2VRDA 1RQ0A 2A25A 3LLHA 1YSAC 2MDGA 2R0OA 1X6FA 2LCEA 1IBKE 3IWDA 3THOB 3FERA 1WXRA 5KL3A 1BB8A 4O24A 1ZU1A 3J7AG 2F8BA 5BR8E 4BBYA 4WXDA 3ADGA 4R2CA 2UUCE 4M0VA 2CT1A 1H67A 3EPJA 2B9DA 1BBGA 5KL7A 4JV5E 2L92A 1GTKA 4HEIA 2LRSA 4JI3E 2UXCE 5LMUE 4WYQB 2DLKA 1PJTA 1WYNA 5CFFE 3EQ1A 5T6JA 1A1FA 1BBOA 2V87A 2D9HA 2EM8A 2L2MA 4DR3E 3MSWA 5IT9C 1WYQA 1HNWE 2MKNA 4DDPA 2V83A 3AV0A 2KONA 1X6EA 4LF7E 3HOPA 2B3TB 2CTDA 5A6JA 1FKAE 2GLIA 2YTPA 4GEQB 2EN3A 3UK3C 2E1MA 3J7Yp 4RH8A 3VYXA 2WA7A 2YTNA 2ELZA 3K6QA 2EPAA 1A1IA 3DF6A 3JALM 4NXNE 3BF2A 3J80C 2V8QB 4F2JC 2EM4A 4B3RE 4X62E 2WCC3 3KZYA 1QAGA 3IWCA 4X66E 4X9JA 2ELYA 2YTOA 4Q59A 1EH8A 4LVPA 4F9BB 2YU5A 1WHNA 1B69A 2VQEE 1P47A 2DK9A 3CO1A 2JY9A 2M1SA 1EUVA 4WPYA 4DV7E 2I9IA 3VK6A 2CPNA 1L4SA 3M99B 1RT8A 1IQOA 1KJKA 2D89A 3ECRA 1QNTA 1STUA 4Q35B 2K7IA 4M30A 4MLVA 1RC7A 4F6NA 2RSMA 4TXIA 2EYIA 2D88A 5A69A 4DV0E 4TXKA 2BBGA 3MHSC 2RSIA 4EDNA 5A36A 2YU8A 5LL6R 1ZAAC 1I94E 4MLQA 5J8EA 4DV5E 2L2KB 4X64E 1T4LB 1J5EE 2RS7A 4DKKA 2L3CA 1PJQA 4BS9A 2EOJA 1T38A 3IWBA 1X6HA 3KMUB 2EE7A 3OTOE 2EMFA 5DNYA 4WXCA 4HTGA 4JI1E 2L33A 4NXME 2EM0A 3KY9A 2LUQA 1WYRA 2EM2A 2DGCA 3EPHA 4IS1C 1YUJA 2DSYA 3HQ1A 4DUYE 1ZBTA 2FGGA 2GHFA 2YWQA 2K4VA 1X3CA 1N34E 2EL4A 2EMKA 1SH6A 2K2RA 4FK5C 1IMUA 4WFTA 2EOEA 4R2DA 1WHQA 4DMIA 2NUEA 4JI4E 5AE1A 2NABA 5ADZA 1DQ3A 4DR7E 4X8WA 1YFHA 2EOFA 2YRHA 2YT4A 4R2PA 2VZDA 2RQLA 3KZZA 1AA2A 2EN6A 1SH5A 4L8NA 1XMOE 4R8OA 2N3HA 2HHHE 4TUGA 1YYOA 3MHHC 2D87A 4ZYDA 2EPOA 1AOAA 4DR4E 3BGHA 3C6KA 3KWRA 4DV2E 4LFCE 2EM9A 3QG5C 2WA5A 4Q57B 1A1JA 2EQ1A 2DRPA 2LBSB 2DMIA 1GQEA 3VP7A 1UILA 2EM5A 2EOSA 4TUIA 2EPZA 1DXXA 2WBTA 2EMGA 3HXLA 2M7QA 2ODRD 3F7PA 2YZTA 4JI8E 2ENAA 2R1FA 5AE3A 2JWOA 4KZSA 5IV8B 2E5LE 2YTFA 4F54A 1WRJA 2EOHA 3ZOQB 5AC4A 4NHRA 1N36E 4O5GA 2YTEA 1XMQE 2V88A 2MC5A 2VE7A 4JI7E 2YRNA 4ZYHA 1AAYA 2NUFA 2V85A 5IXMB 1WJOA 2JP9A 2EOYA 1UEGA 2RTXA 2BB8A 2G7HA 2EPKX 2EN8A 4WX9A 1MEYC 1WKUA 3THNA 1G2DC 3T1HE 2EMZA 5A37A 2JXPA 4YHHE 4R2RA 3C6MA 2B7VA 2EMXA 2EQ0A 2EN4A 2YTIA 2YPNA 2JPAA 2YTDA 2WE6A 2JOXA 5KL2A 2M9AA 2V86A 2N3GA 2UXDE 1BKRA 4F9AB 2LV2A 2VZCA 4J8ZA 1N33E 2ENCA 2EQ3A 1O0WA 2KHXA 1QU6A 2DLQA 4EDLA 2L2NA 3F6HA 5A38A 4LU9A 2EMYA 1UJOA 2UU9E 2V89A 3EAYA 1WYLA 1WYPA 3HPSA 1YYKA 3ADIA 4P7DA 4BC7A 1F2IG 1ZR9A 2EOQA 4LF9E 4L5NC 2EPRA 2LUPB 4BCAA 5L0OA 2MKDA 3J81C 4B3ME 2K3SA 2R8UA 2M4IA 5IWAE 2HGHA 5A6BA 2EPMX 1WJPA 3VHTB 2EPNA 4K0KE 1NEIA 2H36X 2CSHA 1G2FC 1UBDC 4B7LA 1IBME 2HKPA 3HTXA 3AUZA 2WBUA 2L8TA 2JR1A 2EPXA 2N8XA 4F9CB 2VZGB 4LFAE 2R76A 2EPUA 2EMWA 2LMZA 1T4OA 3HPZA 2EL6A 1X47A 5A4BA 2LTSA 4KWYA 5A6KA 2EYNA 4DV3E 4BHBA 2QJXA 4BHCA 4GKKE 3BIDA 2JOBA 1P2XA 1PA7A 2E9KA 2WBSA 3T1YE 2QJZA 5AE2A 2DMYA 4F6MA 1YYWA 2LE2A 1ZBQA 4EDMA 3JTZA 2RPCA 1YUIA 2EMBA 2EOOA 2EM7A 2ZM6E 1HNXE 2L3JA 2PRTA 1T39A 2RR8A 5FMUA 3JAMC 4DV6E 2HC5A 4R03A 1TN9A 2LJUA 2LT7A 3H09A 1J26A 2EMHA 1WYMA 1Z1BA 5A6BD 5FMTA 4DUZE 4JI2E 4O4KA 2LTRA 4R2EA 2DIXA 4DR5E 4DV1E 4M2ZA 3REPB 4LVRA 5KL4A 1A1KA 2VE7C 2D86A 2UUAE 2UXBE 2HL9A 1MGTA 2EWLA 1A1LA 2YSPA 4DR6E 1RMDA 3EPLA 2IHR1 4NZVA 4LF4E 1EH7A 4B3SE 3C4TA 4R2QA 4Q28A 5A2QC 3ADJA 4R2SA 2EOMA 2EPPA 2VF1A 1LLMC 1WYOA 1JK2A 2EMAA 2EL5A 4WSGA 1BHDA 2HL8A 1YPNA 3TQMA 3HOCA 1PKPA 1KYQA 1N32E 2EOZA 1UHZA 4BC9A 4GZNC 1A1GA 1EH6A 1X5WA 1PXYA 4BMJA 2NA2A 4R2AA
chains in the Genus database with same CATH topology
2KOUA 1HR0E 4DR1E 1EKZA 4LF8E 2F4VE 3F6GA 1SR9A 3LMLA 2B7TA 2IGPA 5F3WA 5LMNE 2FV4B 4B3TE 4LFBE 4GKJE 3DJWA 3C4BA 3P1XA 4OX9E 4JYAE 1DI2A 2DB2A 1X49A 3VYYA 4KHPE 2WDTA 1YZ9A 3ADLA 1X48A 2EQOA 2L6MA 4I8OA 2ODRC 2JVAA 4X65E 2VQFE 4P78A 2MDRA 1HNZE 3JU0A 4OOGC 2RS6A 2WZOA 3OMLA 1GZ6A 4LF5E 5AASA 4DV4E 2NUGA 2MC6A 3FIGA 5FLXC 3RMPA 4JI5E 1XNQE 1IBLE 4JI6E 2LJHA 4AQYE 4LTYA 2EZ6A 2FTXB 4WSPA 4LF6E 1XNRE 4YY3E 1FJGE 4DR2E 2UUBE 4JI0E 1T4NA 1RQ0A 3LLHA 1IBKE 3IWDA 1WXRA 3J7AG 2F8BA 5BR8E 4BBYA 3ADGA 2UUCE 4M0VA 2B9DA 4JV5E 2L92A 2LRSA 4JI3E 2UXCE 5LMUE 4WYQB 5CFFE 5T6JA 2V87A 4DR3E 2L2MA 3MSWA 5IT9C 1HNWE 4DDPA 2V83A 3AV0A 2KONA 4LF7E 2B3TB 1FKAE 4GEQB 2E1MA 3J7Yp 3VYXA 3K6QA 3DF6A 4NXNE 3J80C 2V8QB 4B3RE 4X62E 3IWCA 4X66E 4LVPA 4F9BB 1WHNA 2VQEE 2M1SA 2JY9A 1EUVA 4WPYA 4DV7E 3VK6A 2CPNA 1STUA 4M30A 1RC7A 2RSMA 4DV0E 5LL6R 1I94E 4DV5E 2L2KB 4X64E 1T4LB 1J5EE 2RS7A 4DKKA 2L3CA 4BS9A 3IWBA 3OTOE 5DNYA 4JI1E 2L33A 4NXME 2LUQA 2DSYA 3HQ1A 4DUYE 1ZBTA 2FGGA 2K4VA 1N34E 4WFTA 1WHQA 4DMIA 2NUEA 4JI4E 5AE1A 5ADZA 1DQ3A 4DR7E 4X8WA 2YT4A 1XMOE 4L8NA 4R8OA 2N3HA 2HHHE 4TUGA 1YYOA 4DR4E 3KWRA 4DV2E 4LFCE 2LBSB 1GQEA 3VP7A 1UILA 4TUIA 3HXLA 2M7QA 2ODRD 2YZTA 4JI8E 5AE3A 2JWOA 4KZSA 2E5LE 4F54A 3ZOQB 1N36E 1XMQE 2V88A 2MC5A 2VE7A 4JI7E 2NUFA 2V85A 2RTXA 2G7HA 3T1HE 4YHHE 2B7VA 2WE6A 2JOXA 2V86A 2N3GA 2UXDE 4F9AB 4J8ZA 1N33E 1O0WA 1QU6A 2KHXA 2L2NA 3F6HA 4LU9A 2UU9E 2V89A 3EAYA 1YYKA 3HPSA 3ADIA 4P7DA 4BC7A 4LF9E 4L5NC 2LUPB 4BCAA 3J81C 4B3ME 2M4IA 5IWAE 4K0KE 2H36X 1IBME 2HKPA 3HTXA 3AUZA 2L8TA 2JR1A 4LFAE 4F9CB 2LMZA 1T4OA 3HPZA 1X47A 2LTSA 4DV3E 4GKKE 2JOBA 3T1YE 5AE2A 2DMYA 1YYWA 2LE2A 1ZBQA 3JTZA 2ZM6E 1HNXE 2L3JA 5FMUA 3JAMC 4DV6E 4R03A 3H09A 1J26A 5FMTA 4DUZE 4JI2E 2LTRA 2DIXA 4DR5E 4DV1E 4M2ZA 4LVRA 2VE7C 2UUAE 2UXBE 2HL9A 2EWLA 4DR6E 2IHR1 4LF4E 4B3SE 3C4TA 4Q28A 5A2QC 3ADJA 2VF1A 2HL8A 1PKPA 1N32E 1UHZA 4BC9A 4BMJA 2NA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE7 C; 
#chains in the Genus database with same CATH topology
 2KOU A;  3EPK A;  1HR0 E;  4DR1 E;  1EKZ A;  4LF8 E;  2EPL X;  2F4V E;  3F6G A;  1SR9 A;  3LML A;  2EOI A;  5KL6 A;  2EPC A;  3I6X A;  2EN1 A;  2B7T A;  3L00 A;  2IGP A;  5F3W A;  1JK1 A;  5LMN E;  2FV4 B;  4B3T E;  1MB8 A;  5A6A A;  4LFB E;  4GKJ E;  1SFE A;  2ADR A;  4RHB B;  3DJW A;  3C4B A;  1V5K A;  3P1X A;  5LLQ A;  4OX9 E;  2JV9 A;  2WFN A;  4JYA E;  1DI2 A;  1UN6 B;  5BVR A;  3JAK M;  2DB2 A;  1X49 A;  3VYY A;  4KHP E;  1P5S A;  2WDT A;  1YZ9 A;  3ADL A;  2EMI A;  1X48 A;  2EQO A;  2L6M A;  4I8O A;  2JYA A;  2EN7 A;  2ODR C;  2JVA A;  4X65 E;  4Q58 A;  2YTJ A;  1N3G A;  2LVH A;  4N4R B;  2VQF E;  1NCS A;  2D85 A;  3JAR M;  2EP3 A;  4ZYE A;  2EM3 A;  4P78 A;  1TF6 A;  2EJ4 A;  2MDR A;  1HNZ E;  2L3G A;  2I13 A;  2GPI A;  2YRM A;  3JU0 A;  2VZI B;  4OOG C;  2RS6 A;  2WA6 A;  2WZO A;  2YSO A;  1WIX A;  3KMW B;  2EMC A;  2EN2 A;  3OML A;  2EOR A;  4O43 A;  1GZ6 A;  4LF5 E;  5AAS A;  4DV4 E;  2NUG A;  1PJS A;  2MC6 A;  3FIG A;  5FLX C;  3RMP A;  4JI5 E;  2YTQ A;  2YRK A;  1IBL E;  4JI6 E;  1IQS A;  1XNQ E;  2LJH A;  2HJJ A;  2ENH A;  2YTG A;  1DGC A;  2E72 A;  4AQY E;  4LTY A;  1TF3 A;  3BBG A;  2EZ6 A;  2J7J A;  2LO3 A;  4IJD A;  5TSE A;  5KL5 A;  3HOR A;  2EM6 A;  1A1H A;  2EOX A;  1AH5 A;  2FTX B;  4ZYG A;  4WSP A;  5AC5 A;  4LF6 E;  4M9V C;  1XNR E;  4YY3 E;  1PDA A;  1VKA A;  1FJG E;  2EE8 A;  4DR2 E;  2Q8U A;  2EML A;  2UUB E;  4JI0 E;  1T4N A;  1TJT A;  2VRD A;  1RQ0 A;  2A25 A;  3LLH A;  1YSA C;  2MDG A;  2R0O A;  1X6F A;  2LCE A;  1IBK E;  3IWD A;  3THO B;  3FER A;  1WXR A;  5KL3 A;  1BB8 A;  4O24 A;  1ZU1 A;  3J7A G;  2F8B A;  5BR8 E;  4BBY A;  4WXD A;  3ADG A;  4R2C A;  2UUC E;  4M0V A;  2CT1 A;  1H67 A;  3EPJ A;  2B9D A;  1BBG A;  5KL7 A;  4JV5 E;  2L92 A;  1GTK A;  4HEI A;  2LRS A;  4JI3 E;  2UXC E;  5LMU E;  4WYQ B;  2DLK A;  1PJT A;  1WYN A;  5CFF E;  3EQ1 A;  5T6J A;  1A1F A;  1BBO A;  2V87 A;  2D9H A;  2EM8 A;  2L2M A;  4DR3 E;  3MSW A;  5IT9 C;  1WYQ A;  1HNW E;  2MKN A;  4DDP A;  2V83 A;  3AV0 A;  2KON A;  1X6E A;  4LF7 E;  3HOP A;  2B3T B;  2CTD A;  5A6J A;  1FKA E;  2GLI A;  2YTP A;  4GEQ B;  2EN3 A;  3UK3 C;  2E1M A;  3J7Y p;  4RH8 A;  3VYX A;  2WA7 A;  2YTN A;  2ELZ A;  3K6Q A;  2EPA A;  1A1I A;  3DF6 A;  3JAL M;  4NXN E;  3BF2 A;  3J80 C;  2V8Q B;  4F2J C;  2EM4 A;  4B3R E;  4X62 E;  2WCC 3;  3KZY A;  1QAG A;  3IWC A;  4X66 E;  4X9J A;  2ELY A;  2YTO A;  4Q59 A;  1EH8 A;  4LVP A;  4F9B B;  2YU5 A;  1WHN A;  1B69 A;  2VQE E;  1P47 A;  2DK9 A;  3CO1 A;  2JY9 A;  2M1S A;  1EUV A;  4WPY A;  4DV7 E;  2I9I A;  3VK6 A;  2CPN A;  1L4S A;  3M99 B;  1RT8 A;  1IQO A;  1KJK A;  2D89 A;  3ECR A;  1QNT A;  1STU A;  4Q35 B;  2K7I A;  4M30 A;  4MLV A;  1RC7 A;  4F6N A;  2RSM A;  4TXI A;  2EYI A;  2D88 A;  5A69 A;  4DV0 E;  4TXK A;  2BBG A;  3MHS C;  2RSI A;  4EDN A;  5A36 A;  2YU8 A;  5LL6 R;  1ZAA C;  1I94 E;  4MLQ A;  5J8E A;  4DV5 E;  2L2K B;  4X64 E;  1T4L B;  1J5E E;  2RS7 A;  4DKK A;  2L3C A;  1PJQ A;  4BS9 A;  2EOJ A;  1T38 A;  3IWB A;  1X6H A;  3KMU B;  2EE7 A;  3OTO E;  2EMF A;  5DNY A;  4WXC A;  4HTG A;  4JI1 E;  2L33 A;  4NXM E;  2EM0 A;  3KY9 A;  2LUQ A;  1WYR A;  2EM2 A;  2DGC A;  3EPH A;  4IS1 C;  1YUJ A;  2DSY A;  3HQ1 A;  4DUY E;  1ZBT A;  2FGG A;  2GHF A;  2YWQ A;  2K4V A;  1X3C A;  1N34 E;  2EL4 A;  2EMK A;  1SH6 A;  2K2R A;  4FK5 C;  1IMU A;  4WFT A;  2EOE A;  4R2D A;  1WHQ A;  4DMI A;  2NUE A;  4JI4 E;  5AE1 A;  2NAB A;  5ADZ A;  1DQ3 A;  4DR7 E;  4X8W A;  1YFH A;  2EOF A;  2YRH A;  2YT4 A;  4R2P A;  2VZD A;  2RQL A;  3KZZ A;  1AA2 A;  2EN6 A;  1SH5 A;  4L8N A;  1XMO E;  4R8O A;  2N3H A;  2HHH E;  4TUG A;  1YYO A;  3MHH C;  2D87 A;  4ZYD A;  2EPO A;  1AOA A;  4DR4 E;  3BGH A;  3C6K A;  3KWR A;  4DV2 E;  4LFC E;  2EM9 A;  3QG5 C;  2WA5 A;  4Q57 B;  1A1J A;  2EQ1 A;  2DRP A;  2LBS B;  2DMI A;  1GQE A;  3VP7 A;  1UIL A;  2EM5 A;  2EOS A;  4TUI A;  2EPZ A;  1DXX A;  2WBT A;  2EMG A;  3HXL A;  2M7Q A;  2ODR D;  3F7P A;  2YZT A;  4JI8 E;  2ENA A;  2R1F A;  5AE3 A;  2JWO A;  4KZS A;  5IV8 B;  2E5L E;  2YTF A;  4F54 A;  1WRJ A;  2EOH A;  3ZOQ B;  5AC4 A;  4NHR A;  1N36 E;  4O5G A;  2YTE A;  1XMQ E;  2V88 A;  2MC5 A;  2VE7 A;  4JI7 E;  2YRN A;  4ZYH A;  1AAY A;  2NUF A;  2V85 A;  5IXM B;  1WJO A;  2JP9 A;  2EOY A;  1UEG A;  2RTX A;  2BB8 A;  2G7H A;  2EPK X;  2EN8 A;  4WX9 A;  1MEY C;  1WKU A;  3THN A;  1G2D C;  3T1H E;  2EMZ A;  5A37 A;  2JXP A;  4YHH E;  4R2R A;  3C6M A;  2B7V A;  2EMX A;  2EQ0 A;  2EN4 A;  2YTI A;  2YPN A;  2JPA A;  2YTD A;  2WE6 A;  2JOX A;  5KL2 A;  2M9A A;  2V86 A;  2N3G A;  2UXD E;  1BKR A;  4F9A B;  2LV2 A;  2VZC A;  4J8Z A;  1N33 E;  2ENC A;  2EQ3 A;  1O0W A;  2KHX A;  1QU6 A;  2DLQ A;  4EDL A;  2L2N A;  3F6H A;  5A38 A;  4LU9 A;  2EMY A;  1UJO A;  2UU9 E;  2V89 A;  3EAY A;  1WYL A;  1WYP A;  3HPS A;  1YYK A;  3ADI A;  4P7D A;  4BC7 A;  1F2I G;  1ZR9 A;  2EOQ A;  4LF9 E;  4L5N C;  2EPR A;  2LUP B;  4BCA A;  5L0O A;  2MKD A;  3J81 C;  4B3M E;  2K3S A;  2R8U A;  2M4I A;  5IWA E;  2HGH A;  5A6B A;  2EPM X;  1WJP A;  3VHT B;  2EPN A;  4K0K E;  1NEI A;  2H36 X;  2CSH A;  1G2F C;  1UBD C;  4B7L A;  1IBM E;  2HKP A;  3HTX A;  3AUZ A;  2WBU A;  2L8T A;  2JR1 A;  2EPX A;  2N8X A;  4F9C B;  2VZG B;  4LFA E;  2R76 A;  2EPU A;  2EMW A;  2LMZ A;  1T4O A;  3HPZ A;  2EL6 A;  1X47 A;  5A4B A;  2LTS A;  4KWY A;  5A6K A;  2EYN A;  4DV3 E;  4BHB A;  2QJX A;  4BHC A;  4GKK E;  3BID A;  2JOB A;  1P2X A;  1PA7 A;  2E9K A;  2WBS A;  3T1Y E;  2QJZ A;  5AE2 A;  2DMY A;  4F6M A;  1YYW A;  2LE2 A;  1ZBQ A;  4EDM A;  3JTZ A;  2RPC A;  1YUI A;  2EMB A;  2EOO A;  2EM7 A;  2ZM6 E;  1HNX E;  2L3J A;  2PRT A;  1T39 A;  2RR8 A;  5FMU A;  3JAM C;  4DV6 E;  2HC5 A;  4R03 A;  1TN9 A;  2LJU A;  2LT7 A;  3H09 A;  1J26 A;  2EMH A;  1WYM A;  1Z1B A;  5A6B D;  5FMT A;  4DUZ E;  4JI2 E;  4O4K A;  2LTR A;  4R2E A;  2DIX A;  4DR5 E;  4DV1 E;  4M2Z A;  3REP B;  4LVR A;  5KL4 A;  1A1K A;  2VE7 C;  2D86 A;  2UUA E;  2UXB E;  2HL9 A;  1MGT A;  2EWL A;  1A1L A;  2YSP A;  4DR6 E;  1RMD A;  3EPL A;  2IHR 1;  4NZV A;  4LF4 E;  1EH7 A;  4B3S E;  3C4T A;  4R2Q A;  4Q28 A;  5A2Q C;  3ADJ A;  4R2S A;  2EOM A;  2EPP A;  2VF1 A;  1LLM C;  1WYO A;  1JK2 A;  2EMA A;  2EL5 A;  4WSG A;  1BHD A;  2HL8 A;  1YPN A;  3TQM A;  3HOC A;  1PKP A;  1KYQ A;  1N32 E;  2EOZ A;  1UHZ A;  4BC9 A;  4GZN C;  1A1G A;  1EH6 A;  1X5W A;  1PXY A;  4BMJ A;  2NA2 A;  4R2A A; 
#chains in the Genus database with same CATH homology
 2KOU A;  1HR0 E;  4DR1 E;  1EKZ A;  4LF8 E;  2F4V E;  3F6G A;  1SR9 A;  3LML A;  2B7T A;  2IGP A;  5F3W A;  5LMN E;  2FV4 B;  4B3T E;  4LFB E;  4GKJ E;  3DJW A;  3C4B A;  3P1X A;  4OX9 E;  4JYA E;  1DI2 A;  2DB2 A;  1X49 A;  3VYY A;  4KHP E;  2WDT A;  1YZ9 A;  3ADL A;  1X48 A;  2EQO A;  2L6M A;  4I8O A;  2ODR C;  2JVA A;  4X65 E;  2VQF E;  4P78 A;  2MDR A;  1HNZ E;  3JU0 A;  4OOG C;  2RS6 A;  2WZO A;  3OML A;  1GZ6 A;  4LF5 E;  5AAS A;  4DV4 E;  2NUG A;  2MC6 A;  3FIG A;  5FLX C;  3RMP A;  4JI5 E;  1XNQ E;  1IBL E;  4JI6 E;  2LJH A;  4AQY E;  4LTY A;  2EZ6 A;  2FTX B;  4WSP A;  4LF6 E;  1XNR E;  4YY3 E;  1FJG E;  4DR2 E;  2UUB E;  4JI0 E;  1T4N A;  1RQ0 A;  3LLH A;  1IBK E;  3IWD A;  1WXR A;  3J7A G;  2F8B A;  5BR8 E;  4BBY A;  3ADG A;  2UUC E;  4M0V A;  2B9D A;  4JV5 E;  2L92 A;  2LRS A;  4JI3 E;  2UXC E;  5LMU E;  4WYQ B;  5CFF E;  5T6J A;  2V87 A;  4DR3 E;  2L2M A;  3MSW A;  5IT9 C;  1HNW E;  4DDP A;  2V83 A;  3AV0 A;  2KON A;  4LF7 E;  2B3T B;  1FKA E;  4GEQ B;  2E1M A;  3J7Y p;  3VYX A;  3K6Q A;  3DF6 A;  4NXN E;  3J80 C;  2V8Q B;  4B3R E;  4X62 E;  3IWC A;  4X66 E;  4LVP A;  4F9B B;  1WHN A;  2VQE E;  2M1S A;  2JY9 A;  1EUV A;  4WPY A;  4DV7 E;  3VK6 A;  2CPN A;  1STU A;  4M30 A;  1RC7 A;  2RSM A;  4DV0 E;  5LL6 R;  1I94 E;  4DV5 E;  2L2K B;  4X64 E;  1T4L B;  1J5E E;  2RS7 A;  4DKK A;  2L3C A;  4BS9 A;  3IWB A;  3OTO E;  5DNY A;  4JI1 E;  2L33 A;  4NXM E;  2LUQ A;  2DSY A;  3HQ1 A;  4DUY E;  1ZBT A;  2FGG A;  2K4V A;  1N34 E;  4WFT A;  1WHQ A;  4DMI A;  2NUE A;  4JI4 E;  5AE1 A;  5ADZ A;  1DQ3 A;  4DR7 E;  4X8W A;  2YT4 A;  1XMO E;  4L8N A;  4R8O A;  2N3H A;  2HHH E;  4TUG A;  1YYO A;  4DR4 E;  3KWR A;  4DV2 E;  4LFC E;  2LBS B;  1GQE A;  3VP7 A;  1UIL A;  4TUI A;  3HXL A;  2M7Q A;  2ODR D;  2YZT A;  4JI8 E;  5AE3 A;  2JWO A;  4KZS A;  2E5L E;  4F54 A;  3ZOQ B;  1N36 E;  1XMQ E;  2V88 A;  2MC5 A;  2VE7 A;  4JI7 E;  2NUF A;  2V85 A;  2RTX A;  2G7H A;  3T1H E;  4YHH E;  2B7V A;  2WE6 A;  2JOX A;  2V86 A;  2N3G A;  2UXD E;  4F9A B;  4J8Z A;  1N33 E;  1O0W A;  1QU6 A;  2KHX A;  2L2N A;  3F6H A;  4LU9 A;  2UU9 E;  2V89 A;  3EAY A;  1YYK A;  3HPS A;  3ADI A;  4P7D A;  4BC7 A;  4LF9 E;  4L5N C;  2LUP B;  4BCA A;  3J81 C;  4B3M E;  2M4I A;  5IWA E;  4K0K E;  2H36 X;  1IBM E;  2HKP A;  3HTX A;  3AUZ A;  2L8T A;  2JR1 A;  4LFA E;  4F9C B;  2LMZ A;  1T4O A;  3HPZ A;  1X47 A;  2LTS A;  4DV3 E;  4GKK E;  2JOB A;  3T1Y E;  5AE2 A;  2DMY A;  1YYW A;  2LE2 A;  1ZBQ A;  3JTZ A;  2ZM6 E;  1HNX E;  2L3J A;  5FMU A;  3JAM C;  4DV6 E;  4R03 A;  3H09 A;  1J26 A;  5FMT A;  4DUZ E;  4JI2 E;  2LTR A;  2DIX A;  4DR5 E;  4DV1 E;  4M2Z A;  4LVR A;  2VE7 C;  2UUA E;  2UXB E;  2HL9 A;  2EWL A;  4DR6 E;  2IHR 1;  4LF4 E;  4B3S E;  3C4T A;  4Q28 A;  5A2Q C;  3ADJ A;  2VF1 A;  2HL8 A;  1PKP A;  1N32 E;  1UHZ A;  4BC9 A;  4BMJ A;  2NA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...