2VE7C

Crystal structure of a bonsai version of the human ndc80 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
238
structure length
219
Chain Sequence
b'LSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSGVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLEIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHQPIHLDSTQLSRKFISDYLWSLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN SPC25
publication title Implications for Kinetochore-Microtubule Attachment from the Structure of an Engineered Ndc80 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 219
sequence length 238
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03800 Nuf2 Nuf2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.60 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2ve7C01
3.30.160.570 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ve7C02
2VE7C
chains in the Genus database with same CATH superfamily
3HXLA 3OTOE 5AC5A 3ZOQB 3J80C 2M7QA 2FGGA 2YTJA 3K6QA 2UUBE 1FJGE 3KMUB 2EMFA 1GTKA 4O5GA 5A36A 2N3GA 1WYQA 2YU8A 3FERA 5FLXC 3HQ1A 4GKKE 5J8EA 3F7PA 1YZ9A 2KHXA 2EMXA 1EUVA 3CO1A 5ADZA 2LBSB 2UXCE 2JV9A 2EN2A 2EQ3A 2MC6A 1X47A 3JU0A 5FMTA 2YTOA 2E9KA 1PKPA 2EMWA 4B7LA 3J7Yp 1XMOE 1YUIA 4JI4E 2ELZA 2EM3A 2G7HA 4O4KA 3C4TA 3HOPA 4WYQB 2WBSA 5KL2A 2LRSA 1TN9A 4DR4E 2K3SA 3THOB 2I9IA 1YYOA 4BHBA 2EORA 2JR1A 4LVRA 5KL6A 2UXBE 1JK1A 3ADLA 5A2QC 2Q8UA 1YYWA 3QG5C 2VQEE 2DMIA 2HKPA 2JOBA 3ADJA 2EE8A 1WIXA 3VYYA 1SFEA 3VP7A 1HR0E 2LE2A 1UN6B 1AA2A 1TJTA 1T4NA 1N36E 1DI2A 4DR3E 2EN6A 2RTXA 1H67A 1RMDA 2EOMA 2H36X 2HGHA 4M30A 1WJPA 2R1FA 2EMIA 4R2CA 2D85A 4YHHE 2RPCA 4TUGA 1G2FC 3JALM 2EN1A 4TUIA 4Q57B 5T6JA 4DR6E 3EPLA 1P47A 2NUFA 4Q58A 2HL8A 3ADGA 4BMJA 4DV2E 2RSIA 3F6GA 2YTIA 3OMLA 3DF6A 5AC4A 1PJSA 4X8WA 1PJTA 2ODRC 2L6MA 2VQFE 3EQ1A 4DKKA 2GLIA 1A1KA 1YFHA 2DLKA 2EQ0A 3AUZA 2M9AA 4NXNE 2V8QB 4DUYE 1IQSA 2KOUA 4YY3E 4TXIA 4X62E 1WYNA 4X9JA 5A6BD 1X48A 2WZOA 4JI2E 2UXDE 2EMZA 4JYAE 4B3ME 1WYLA 1YUJA 2EPAA 4O43A 4R03A 1WXRA 2ELYA 3ECRA 4R2PA 1AH5A 4ZYGA 2NUEA 2EPLX 2YRNA 2IHR1 2MKDA 3KY9A 2EOFA 3AV0A 4NXME 2WA5A 2EL4A 2I13A 4OX9E 2ENCA 2B9DA 2UUCE 5FMUA 4WXCA 2V85A 4DV7E 1IBLE 2EL5A 3MSWA 2EQOA 1A1FA 1X3CA 2ADRA 2YTNA 2A25A 3BF2A 4GZNC 1BBGA 4BCAA 1FKAE 1T4LB 2DGCA 1YPNA 1WHQA 1UEGA 3J7AG 2LUQA 2GPIA 4R2RA 1UJOA 4BHCA 2EOQA 4N4RB 4JI1E 4WSGA 1EH8A 1EH6A 4DV1E 4F9BB 1WYRA 1UHZA 2EM9A 1DGCA 2V87A 2YU5A 4BS9A 2L3CA 2R0OA 4DR2E 2JVAA 4LU9A 4LFCE 2YTGA 3HPZA 2N3HA 2JOXA 1BHDA 3M99B 5LMUE 1A1LA 4MLQA 2F8BA 2RSMA 4EDNA 2FTXB 4JV5E 4KWYA 1PDAA 1X49A 4DUZE 3IWDA 2DRPA 1KYQA 2VZIB 2FV4B 1Z1BA 4KHPE 2JPAA 2LUPB 2EPRA 2V83A 2EM6A 2B7VA 3VYXA 1TF6A 2YRHA 3UK3C 5A4BA 3EPHA 4M2ZA 2ODRD 4P7DA 5IV8B 2YSPA 5KL7A 4R2SA 5IWAE 2L2KB 2GHFA 3JTZA 1WYPA 2YPNA 1XNQE 3VHTB 4Q35B 1MEYC 1X6EA 4JI6E 2E72A 2K4VA 2V89A 1STUA 5BR8E 2BBGA 4ZYHA 3EPJA 5AE2A 4F9AB 4B3SE 2D88A 2LTRA 1WJOA 4WXDA 4IS1C 1JK2A 4IJDA 2LJHA 2YT4A 2DIXA 2J7JA 1HNZE 4AQYE 1ZR9A 3LMLA 1NEIA 2EQ1A 4X65E 2EN7A 3BIDA 1J26A 4NHRA 2WA7A 3JARM 2DMYA 2HL9A 3HTXA 4HTGA 4DV6E 3LLHA 2EOOA 4HEIA 1RT8A 1A1GA 3EPKA 2D86A 2EOSA 1PA7A 4DV0E 2EMGA 2D89A 1MGTA 2DK9A 2RR8A 1P2XA 1BKRA 4M9VC 2VZDA 3ADIA 4LFAE 4F6NA 2EPMX 4DR7E 4WPYA 3I6XA 1T38A 5A6AA 2EYIA 2D87A 5LMNE 2EOXA 2JYAA 1I94E 2EOIA 2LT7A 1ZU1A 3KZZA 2NABA 1RC7A 2QJXA 4R2QA 1ZBTA 5DNYA 4LF6E 1O0WA 2EN3A 4EDMA 3IWBA 1YYKA 4JI7E 1X6FA 2E1MA 2JWOA 3MHHC 1GQEA 3KMWB 1F2IG 1XNRE 1PXYA 2EPCA 5A6JA 4DMIA 1J5EE 2EMYA 2JP9A 1WKUA 3DJWA 4MLVA 2EOZA 2N8XA 1RQ0A 2CSHA 2L92A 1LLMC 4JI8E 1PJQA 4TXKA 1IBME 3REPB 4DV5E 2K2RA 2EE7A 2EL6A 2EM7A 2WDTA 4DDPA 2ZM6E 2LJUA 2WBUA 2EMAA 1B69A 2YSOA 2VZGB 2K7IA 1VKAA 2EN8A 1A1JA 1SR9A 4Q59A 4BC7A 2ENHA 2MKNA 1DXXA 1MB8A 4RH8A 2EMCA 2EM4A 2YTEA 2BB8A 2QJZA 2UU9E 2L3GA 2YTFA 2F4VE 3BGHA 2L3JA 2DLQA 4F9CB 2EPNA 5AE1A 4X64E 3T1HE 2EMHA 1WYMA 2JXPA 2EM0A 2RS6A 5IXMB 2E5LE 4R8OA 2B7TA 1N32E 3KZYA 3C6MA 1DQ3A 3MHSC 2EPOA 2LV2A 2WA6A 4LF8E 3L00A 2EP3A 5L0OA 1T4OA 1V5KA 1KJKA 2LMZA 1BBOA 2HJJA 3RMPA 4DV4E 4Q28A 1SH6A 2V86A 4R2DA 1YSAC 3HPSA 5AASA 2KONA 4L8NA 4DV3E 1GZ6A 1AAYA 4K0KE 1QNTA 3TQMA 2EM2A 4J8ZA 1N33E 3J81C 4B3TE 3C4BA 2NA2A 2IGPA 4DR5E 2VE7A 2VRDA 4WX9A 1BB8A 1EH7A 5AE3A 2R76A 2M1SA 4F2JC 2B3TB 1HNXE 3H09A 4O24A 1T39A 2CPNA 2EPXA 3KWRA 5KL3A 3BBGA 1WHNA 2L2MA 2EOEA 1N34E 4LF7E 4F6MA 1IMUA 2EN4A 4DR1E 1UILA 2VF1A 4BBYA 1N3GA 2EPUA 2PRTA 4JI0E 3JAMC 2M4IA 2YZTA 5BVRA 2EMLA 1XMQE 4RHBB 1AOAA 1TF3A 2YRMA 4LF5E 4LTYA 4JI3E 5A6KA 2L33A 5F3WA 2MDGA 3F6HA 1UBDC 4WSPA 3JAKM 4ZYEA 2RQLA 2YTQA 4LF4E 4B3RE 3HORA 4KZSA 2DSYA 4X66E 5KL5A 4BC9A 2HC5A 2LTSA 1NCSA 2ENAA 2MDRA 2VE7C 1X6HA 2JY9A 2LO3A 4JI5E 1ZAAC 2EWLA 3C6KA 5A69A 5IT9C 2HHHE 4EDLA 2LVHA 2EZ6A 5KL4A 2EPZA 2EYNA 3EAYA 1WRJA 2L2NA 4M0VA 4WFTA 2WBTA 2EMKA 5A38A 1P5SA 1X5WA 4ZYDA 1A1IA 2UUAE 5LLQA 2WCC3 5CFFE 4LVPA 2V88A 1A1HA 4LF9E 5A37A 3IWCA 4L5NC 2EJ4A 3T1YE 1ZBQA 2DB2A 4OOGC 1EKZA 2VZCA 2NUGA 2MC5A 2CTDA 4R2EA 1L4SA 2EOHA 5A6BA 5LL6R 2EMBA 3HOCA 2EPPA 4R2AA 2D9HA 3VK6A 2EM8A 2YTPA 2EPKX 2YTDA 1IQOA 2LCEA 4I8OA 2R8UA 4LFBE 2EM5A 4NZVA 2L8TA 3P1XA 1QU6A 4P78A 4F54A 2WFNA 1QAGA 2CT1A 3FIGA 2EOJA 2YWQA 4FK5C 4GEQB 1HNWE 4GKJE 1IBKE 1G2DC 2RS7A 1WYOA 5TSEA 2YRKA 3THNA 1SH5A 2WE6A 2EOYA
chains in the Genus database with same CATH topology
3HXLA 3OTOE 3ZOQB 3J80C 2M7QA 2FGGA 3K6QA 2UUBE 1FJGE 2N3GA 5FLXC 3HQ1A 4GKKE 1YZ9A 2KHXA 5ADZA 1EUVA 2LBSB 2UXCE 2MC6A 1X47A 3JU0A 5FMTA 1PKPA 3J7Yp 1XMOE 4JI4E 2G7HA 3C4TA 4WYQB 2LRSA 4DR4E 1YYOA 2JR1A 4LVRA 2UXBE 3ADLA 5A2QC 1YYWA 2VQEE 2HKPA 2JOBA 3ADJA 3VYYA 3VP7A 1HR0E 2LE2A 1T4NA 1N36E 1DI2A 4DR3E 2RTXA 2H36X 4M30A 4YHHE 4TUGA 4TUIA 5T6JA 4DR6E 2NUFA 2HL8A 3ADGA 4BMJA 4DV2E 3F6GA 3OMLA 3DF6A 4X8WA 2ODRC 2L6MA 2VQFE 4DKKA 3AUZA 4NXNE 2V8QB 4DUYE 2KOUA 4YY3E 4X62E 1X48A 2WZOA 4JI2E 2UXDE 4JYAE 4B3ME 4R03A 1WXRA 2NUEA 2IHR1 3AV0A 4NXME 4OX9E 2B9DA 2UUCE 5FMUA 2V85A 4DV7E 1IBLE 3MSWA 2EQOA 4BCAA 1FKAE 1T4LB 1WHQA 3J7AG 2LUQA 4JI1E 4DV1E 4F9BB 1UHZA 2V87A 4BS9A 2L3CA 4DR2E 2JVAA 4LU9A 4LFCE 3HPZA 2N3HA 2JOXA 5LMUE 2F8BA 2RSMA 2FTXB 4JV5E 1X49A 4DUZE 3IWDA 2FV4B 4KHPE 2LUPB 2V83A 2B7VA 3VYXA 4M2ZA 2ODRD 4P7DA 5IWAE 2L2KB 3JTZA 1XNQE 4JI6E 2K4VA 2V89A 1STUA 5BR8E 5AE2A 4F9AB 4B3SE 2LTRA 2LJHA 2YT4A 2DIXA 1HNZE 4AQYE 3LMLA 4X65E 1J26A 2DMYA 2HL9A 3HTXA 4DV6E 3LLHA 4DV0E 3ADIA 4LFAE 4DR7E 4WPYA 5LMNE 1I94E 1RC7A 1ZBTA 5DNYA 4LF6E 1O0WA 3IWBA 1YYKA 4JI7E 2E1MA 2JWOA 1GQEA 1XNRE 4DMIA 1J5EE 3DJWA 1RQ0A 2L92A 4JI8E 1IBME 4DV5E 2WDTA 4DDPA 2ZM6E 1SR9A 4BC7A 2UU9E 2F4VE 2L3JA 4F9CB 5AE1A 4X64E 3T1HE 2RS6A 2E5LE 4R8OA 2B7TA 1N32E 1DQ3A 4LF8E 1T4OA 2LMZA 3RMPA 4DV4E 4Q28A 2V86A 3HPSA 5AASA 2KONA 4L8NA 4DV3E 1GZ6A 4K0KE 4J8ZA 1N33E 3J81C 4B3TE 3C4BA 2NA2A 2IGPA 4DR5E 2VE7A 5AE3A 2M1SA 2B3TB 1HNXE 3H09A 2CPNA 3KWRA 1WHNA 2L2MA 1N34E 4LF7E 4DR1E 1UILA 2VF1A 4BBYA 4JI0E 3JAMC 2M4IA 2YZTA 1XMQE 4LF5E 4LTYA 4JI3E 2L33A 5F3WA 3F6HA 4WSPA 4B3RE 4LF4E 4KZSA 2DSYA 4X66E 4BC9A 2LTSA 2MDRA 2VE7C 2JY9A 4JI5E 2EWLA 5IT9C 2HHHE 2EZ6A 3EAYA 2L2NA 4M0VA 4WFTA 2UUAE 5CFFE 4LVPA 2V88A 4LF9E 3IWCA 4L5NC 3T1YE 1ZBQA 2DB2A 4OOGC 1EKZA 2NUGA 2MC5A 5LL6R 3VK6A 4I8OA 4LFBE 2L8TA 3P1XA 1QU6A 4P78A 4F54A 3FIGA 4GEQB 1HNWE 4GKJE 1IBKE 2RS7A 2WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE7 C; 
#chains in the Genus database with same CATH topology
 3HXL A;  3OTO E;  5AC5 A;  3ZOQ B;  3J80 C;  2M7Q A;  2FGG A;  2YTJ A;  3K6Q A;  2UUB E;  1FJG E;  3KMU B;  2EMF A;  1GTK A;  4O5G A;  5A36 A;  2N3G A;  1WYQ A;  2YU8 A;  3FER A;  5FLX C;  3HQ1 A;  4GKK E;  5J8E A;  3F7P A;  1YZ9 A;  2KHX A;  2EMX A;  1EUV A;  3CO1 A;  5ADZ A;  2LBS B;  2UXC E;  2JV9 A;  2EN2 A;  2EQ3 A;  2MC6 A;  1X47 A;  3JU0 A;  5FMT A;  2YTO A;  2E9K A;  1PKP A;  2EMW A;  4B7L A;  3J7Y p;  1XMO E;  1YUI A;  4JI4 E;  2ELZ A;  2EM3 A;  2G7H A;  4O4K A;  3C4T A;  3HOP A;  4WYQ B;  2WBS A;  5KL2 A;  2LRS A;  1TN9 A;  4DR4 E;  2K3S A;  3THO B;  2I9I A;  1YYO A;  4BHB A;  2EOR A;  2JR1 A;  4LVR A;  5KL6 A;  2UXB E;  1JK1 A;  3ADL A;  5A2Q C;  2Q8U A;  1YYW A;  3QG5 C;  2VQE E;  2DMI A;  2HKP A;  2JOB A;  3ADJ A;  2EE8 A;  1WIX A;  3VYY A;  1SFE A;  3VP7 A;  1HR0 E;  2LE2 A;  1UN6 B;  1AA2 A;  1TJT A;  1T4N A;  1N36 E;  1DI2 A;  4DR3 E;  2EN6 A;  2RTX A;  1H67 A;  1RMD A;  2EOM A;  2H36 X;  2HGH A;  4M30 A;  1WJP A;  2R1F A;  2EMI A;  4R2C A;  2D85 A;  4YHH E;  2RPC A;  4TUG A;  1G2F C;  3JAL M;  2EN1 A;  4TUI A;  4Q57 B;  5T6J A;  4DR6 E;  3EPL A;  1P47 A;  2NUF A;  4Q58 A;  2HL8 A;  3ADG A;  4BMJ A;  4DV2 E;  2RSI A;  3F6G A;  2YTI A;  3OML A;  3DF6 A;  5AC4 A;  1PJS A;  4X8W A;  1PJT A;  2ODR C;  2L6M A;  2VQF E;  3EQ1 A;  4DKK A;  2GLI A;  1A1K A;  1YFH A;  2DLK A;  2EQ0 A;  3AUZ A;  2M9A A;  4NXN E;  2V8Q B;  4DUY E;  1IQS A;  2KOU A;  4YY3 E;  4TXI A;  4X62 E;  1WYN A;  4X9J A;  5A6B D;  1X48 A;  2WZO A;  4JI2 E;  2UXD E;  2EMZ A;  4JYA E;  4B3M E;  1WYL A;  1YUJ A;  2EPA A;  4O43 A;  4R03 A;  1WXR A;  2ELY A;  3ECR A;  4R2P A;  1AH5 A;  4ZYG A;  2NUE A;  2EPL X;  2YRN A;  2IHR 1;  2MKD A;  3KY9 A;  2EOF A;  3AV0 A;  4NXM E;  2WA5 A;  2EL4 A;  2I13 A;  4OX9 E;  2ENC A;  2B9D A;  2UUC E;  5FMU A;  4WXC A;  2V85 A;  4DV7 E;  1IBL E;  2EL5 A;  3MSW A;  2EQO A;  1A1F A;  1X3C A;  2ADR A;  2YTN A;  2A25 A;  3BF2 A;  4GZN C;  1BBG A;  4BCA A;  1FKA E;  1T4L B;  2DGC A;  1YPN A;  1WHQ A;  1UEG A;  3J7A G;  2LUQ A;  2GPI A;  4R2R A;  1UJO A;  4BHC A;  2EOQ A;  4N4R B;  4JI1 E;  4WSG A;  1EH8 A;  1EH6 A;  4DV1 E;  4F9B B;  1WYR A;  1UHZ A;  2EM9 A;  1DGC A;  2V87 A;  2YU5 A;  4BS9 A;  2L3C A;  2R0O A;  4DR2 E;  2JVA A;  4LU9 A;  4LFC E;  2YTG A;  3HPZ A;  2N3H A;  2JOX A;  1BHD A;  3M99 B;  5LMU E;  1A1L A;  4MLQ A;  2F8B A;  2RSM A;  4EDN A;  2FTX B;  4JV5 E;  4KWY A;  1PDA A;  1X49 A;  4DUZ E;  3IWD A;  2DRP A;  1KYQ A;  2VZI B;  2FV4 B;  1Z1B A;  4KHP E;  2JPA A;  2LUP B;  2EPR A;  2V83 A;  2EM6 A;  2B7V A;  3VYX A;  1TF6 A;  2YRH A;  3UK3 C;  5A4B A;  3EPH A;  4M2Z A;  2ODR D;  4P7D A;  5IV8 B;  2YSP A;  5KL7 A;  4R2S A;  5IWA E;  2L2K B;  2GHF A;  3JTZ A;  1WYP A;  2YPN A;  1XNQ E;  3VHT B;  4Q35 B;  1MEY C;  1X6E A;  4JI6 E;  2E72 A;  2K4V A;  2V89 A;  1STU A;  5BR8 E;  2BBG A;  4ZYH A;  3EPJ A;  5AE2 A;  4F9A B;  4B3S E;  2D88 A;  2LTR A;  1WJO A;  4WXD A;  4IS1 C;  1JK2 A;  4IJD A;  2LJH A;  2YT4 A;  2DIX A;  2J7J A;  1HNZ E;  4AQY E;  1ZR9 A;  3LML A;  1NEI A;  2EQ1 A;  4X65 E;  2EN7 A;  3BID A;  1J26 A;  4NHR A;  2WA7 A;  3JAR M;  2DMY A;  2HL9 A;  3HTX A;  4HTG A;  4DV6 E;  3LLH A;  2EOO A;  4HEI A;  1RT8 A;  1A1G A;  3EPK A;  2D86 A;  2EOS A;  1PA7 A;  4DV0 E;  2EMG A;  2D89 A;  1MGT A;  2DK9 A;  2RR8 A;  1P2X A;  1BKR A;  4M9V C;  2VZD A;  3ADI A;  4LFA E;  4F6N A;  2EPM X;  4DR7 E;  4WPY A;  3I6X A;  1T38 A;  5A6A A;  2EYI A;  2D87 A;  5LMN E;  2EOX A;  2JYA A;  1I94 E;  2EOI A;  2LT7 A;  1ZU1 A;  3KZZ A;  2NAB A;  1RC7 A;  2QJX A;  4R2Q A;  1ZBT A;  5DNY A;  4LF6 E;  1O0W A;  2EN3 A;  4EDM A;  3IWB A;  1YYK A;  4JI7 E;  1X6F A;  2E1M A;  2JWO A;  3MHH C;  1GQE A;  3KMW B;  1F2I G;  1XNR E;  1PXY A;  2EPC A;  5A6J A;  4DMI A;  1J5E E;  2EMY A;  2JP9 A;  1WKU A;  3DJW A;  4MLV A;  2EOZ A;  2N8X A;  1RQ0 A;  2CSH A;  2L92 A;  1LLM C;  4JI8 E;  1PJQ A;  4TXK A;  1IBM E;  3REP B;  4DV5 E;  2K2R A;  2EE7 A;  2EL6 A;  2EM7 A;  2WDT A;  4DDP A;  2ZM6 E;  2LJU A;  2WBU A;  2EMA A;  1B69 A;  2YSO A;  2VZG B;  2K7I A;  1VKA A;  2EN8 A;  1A1J A;  1SR9 A;  4Q59 A;  4BC7 A;  2ENH A;  2MKN A;  1DXX A;  1MB8 A;  4RH8 A;  2EMC A;  2EM4 A;  2YTE A;  2BB8 A;  2QJZ A;  2UU9 E;  2L3G A;  2YTF A;  2F4V E;  3BGH A;  2L3J A;  2DLQ A;  4F9C B;  2EPN A;  5AE1 A;  4X64 E;  3T1H E;  2EMH A;  1WYM A;  2JXP A;  2EM0 A;  2RS6 A;  5IXM B;  2E5L E;  4R8O A;  2B7T A;  1N32 E;  3KZY A;  3C6M A;  1DQ3 A;  3MHS C;  2EPO A;  2LV2 A;  2WA6 A;  4LF8 E;  3L00 A;  2EP3 A;  5L0O A;  1T4O A;  1V5K A;  1KJK A;  2LMZ A;  1BBO A;  2HJJ A;  3RMP A;  4DV4 E;  4Q28 A;  1SH6 A;  2V86 A;  4R2D A;  1YSA C;  3HPS A;  5AAS A;  2KON A;  4L8N A;  4DV3 E;  1GZ6 A;  1AAY A;  4K0K E;  1QNT A;  3TQM A;  2EM2 A;  4J8Z A;  1N33 E;  3J81 C;  4B3T E;  3C4B A;  2NA2 A;  2IGP A;  4DR5 E;  2VE7 A;  2VRD A;  4WX9 A;  1BB8 A;  1EH7 A;  5AE3 A;  2R76 A;  2M1S A;  4F2J C;  2B3T B;  1HNX E;  3H09 A;  4O24 A;  1T39 A;  2CPN A;  2EPX A;  3KWR A;  5KL3 A;  3BBG A;  1WHN A;  2L2M A;  2EOE A;  1N34 E;  4LF7 E;  4F6M A;  1IMU A;  2EN4 A;  4DR1 E;  1UIL A;  2VF1 A;  4BBY A;  1N3G A;  2EPU A;  2PRT A;  4JI0 E;  3JAM C;  2M4I A;  2YZT A;  5BVR A;  2EML A;  1XMQ E;  4RHB B;  1AOA A;  1TF3 A;  2YRM A;  4LF5 E;  4LTY A;  4JI3 E;  5A6K A;  2L33 A;  5F3W A;  2MDG A;  3F6H A;  1UBD C;  4WSP A;  3JAK M;  4ZYE A;  2RQL A;  2YTQ A;  4LF4 E;  4B3R E;  3HOR A;  4KZS A;  2DSY A;  4X66 E;  5KL5 A;  4BC9 A;  2HC5 A;  2LTS A;  1NCS A;  2ENA A;  2MDR A;  2VE7 C;  1X6H A;  2JY9 A;  2LO3 A;  4JI5 E;  1ZAA C;  2EWL A;  3C6K A;  5A69 A;  5IT9 C;  2HHH E;  4EDL A;  2LVH A;  2EZ6 A;  5KL4 A;  2EPZ A;  2EYN A;  3EAY A;  1WRJ A;  2L2N A;  4M0V A;  4WFT A;  2WBT A;  2EMK A;  5A38 A;  1P5S A;  1X5W A;  4ZYD A;  1A1I A;  2UUA E;  5LLQ A;  2WCC 3;  5CFF E;  4LVP A;  2V88 A;  1A1H A;  4LF9 E;  5A37 A;  3IWC A;  4L5N C;  2EJ4 A;  3T1Y E;  1ZBQ A;  2DB2 A;  4OOG C;  1EKZ A;  2VZC A;  2NUG A;  2MC5 A;  2CTD A;  4R2E A;  1L4S A;  2EOH A;  5A6B A;  5LL6 R;  2EMB A;  3HOC A;  2EPP A;  4R2A A;  2D9H A;  3VK6 A;  2EM8 A;  2YTP A;  2EPK X;  2YTD A;  1IQO A;  2LCE A;  4I8O A;  2R8U A;  4LFB E;  2EM5 A;  4NZV A;  2L8T A;  3P1X A;  1QU6 A;  4P78 A;  4F54 A;  2WFN A;  1QAG A;  2CT1 A;  3FIG A;  2EOJ A;  2YWQ A;  4FK5 C;  4GEQ B;  1HNW E;  4GKJ E;  1IBK E;  1G2D C;  2RS7 A;  1WYO A;  5TSE A;  2YRK A;  3THN A;  1SH5 A;  2WE6 A;  2EOY A; 
#chains in the Genus database with same CATH homology
 3HXL A;  3OTO E;  3ZOQ B;  3J80 C;  2M7Q A;  2FGG A;  3K6Q A;  2UUB E;  1FJG E;  2N3G A;  5FLX C;  3HQ1 A;  4GKK E;  1YZ9 A;  2KHX A;  5ADZ A;  1EUV A;  2LBS B;  2UXC E;  2MC6 A;  1X47 A;  3JU0 A;  5FMT A;  1PKP A;  3J7Y p;  1XMO E;  4JI4 E;  2G7H A;  3C4T A;  4WYQ B;  2LRS A;  4DR4 E;  1YYO A;  2JR1 A;  4LVR A;  2UXB E;  3ADL A;  5A2Q C;  1YYW A;  2VQE E;  2HKP A;  2JOB A;  3ADJ A;  3VYY A;  3VP7 A;  1HR0 E;  2LE2 A;  1T4N A;  1N36 E;  1DI2 A;  4DR3 E;  2RTX A;  2H36 X;  4M30 A;  4YHH E;  4TUG A;  4TUI A;  5T6J A;  4DR6 E;  2NUF A;  2HL8 A;  3ADG A;  4BMJ A;  4DV2 E;  3F6G A;  3OML A;  3DF6 A;  4X8W A;  2ODR C;  2L6M A;  2VQF E;  4DKK A;  3AUZ A;  4NXN E;  2V8Q B;  4DUY E;  2KOU A;  4YY3 E;  4X62 E;  1X48 A;  2WZO A;  4JI2 E;  2UXD E;  4JYA E;  4B3M E;  4R03 A;  1WXR A;  2NUE A;  2IHR 1;  3AV0 A;  4NXM E;  4OX9 E;  2B9D A;  2UUC E;  5FMU A;  2V85 A;  4DV7 E;  1IBL E;  3MSW A;  2EQO A;  4BCA A;  1FKA E;  1T4L B;  1WHQ A;  3J7A G;  2LUQ A;  4JI1 E;  4DV1 E;  4F9B B;  1UHZ A;  2V87 A;  4BS9 A;  2L3C A;  4DR2 E;  2JVA A;  4LU9 A;  4LFC E;  3HPZ A;  2N3H A;  2JOX A;  5LMU E;  2F8B A;  2RSM A;  2FTX B;  4JV5 E;  1X49 A;  4DUZ E;  3IWD A;  2FV4 B;  4KHP E;  2LUP B;  2V83 A;  2B7V A;  3VYX A;  4M2Z A;  2ODR D;  4P7D A;  5IWA E;  2L2K B;  3JTZ A;  1XNQ E;  4JI6 E;  2K4V A;  2V89 A;  1STU A;  5BR8 E;  5AE2 A;  4F9A B;  4B3S E;  2LTR A;  2LJH A;  2YT4 A;  2DIX A;  1HNZ E;  4AQY E;  3LML A;  4X65 E;  1J26 A;  2DMY A;  2HL9 A;  3HTX A;  4DV6 E;  3LLH A;  4DV0 E;  3ADI A;  4LFA E;  4DR7 E;  4WPY A;  5LMN E;  1I94 E;  1RC7 A;  1ZBT A;  5DNY A;  4LF6 E;  1O0W A;  3IWB A;  1YYK A;  4JI7 E;  2E1M A;  2JWO A;  1GQE A;  1XNR E;  4DMI A;  1J5E E;  3DJW A;  1RQ0 A;  2L92 A;  4JI8 E;  1IBM E;  4DV5 E;  2WDT A;  4DDP A;  2ZM6 E;  1SR9 A;  4BC7 A;  2UU9 E;  2F4V E;  2L3J A;  4F9C B;  5AE1 A;  4X64 E;  3T1H E;  2RS6 A;  2E5L E;  4R8O A;  2B7T A;  1N32 E;  1DQ3 A;  4LF8 E;  1T4O A;  2LMZ A;  3RMP A;  4DV4 E;  4Q28 A;  2V86 A;  3HPS A;  5AAS A;  2KON A;  4L8N A;  4DV3 E;  1GZ6 A;  4K0K E;  4J8Z A;  1N33 E;  3J81 C;  4B3T E;  3C4B A;  2NA2 A;  2IGP A;  4DR5 E;  2VE7 A;  5AE3 A;  2M1S A;  2B3T B;  1HNX E;  3H09 A;  2CPN A;  3KWR A;  1WHN A;  2L2M A;  1N34 E;  4LF7 E;  4DR1 E;  1UIL A;  2VF1 A;  4BBY A;  4JI0 E;  3JAM C;  2M4I A;  2YZT A;  1XMQ E;  4LF5 E;  4LTY A;  4JI3 E;  2L33 A;  5F3W A;  3F6H A;  4WSP A;  4B3R E;  4LF4 E;  4KZS A;  2DSY A;  4X66 E;  4BC9 A;  2LTS A;  2MDR A;  2VE7 C;  2JY9 A;  4JI5 E;  2EWL A;  5IT9 C;  2HHH E;  2EZ6 A;  3EAY A;  2L2N A;  4M0V A;  4WFT A;  2UUA E;  5CFF E;  4LVP A;  2V88 A;  4LF9 E;  3IWC A;  4L5N C;  3T1Y E;  1ZBQ A;  2DB2 A;  4OOG C;  1EKZ A;  2NUG A;  2MC5 A;  5LL6 R;  3VK6 A;  4I8O A;  4LFB E;  2L8T A;  3P1X A;  1QU6 A;  4P78 A;  4F54 A;  3FIG A;  4GEQ B;  1HNW E;  4GKJ E;  1IBK E;  2RS7 A;  2WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...