2VE7C

Crystal structure of a bonsai version of the human ndc80 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
238
structure length
219
Chain Sequence
LSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSGVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLEIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHQPIHLDSTQLSRKFISDYLWSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for Kinetochore-Microtubule Attachment from the Structure of an Engineered Ndc80 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN SPC25
total genus 55
structure length 219
sequence length 238
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03800 Nuf2 Nuf2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.60 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2ve7C01
3.30.160.570 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ve7C02
2VE7C
chains in the Genus database with same CATH superfamily
2ELZA 2YPNA 2VZCA 3HPSA 4GEQB 2EN4A 4DR4E 3VHTB 3EQ1A 5AE1A 2FV4B 4N4RB 1JK1A 5A2QC 1EH8A 2EPZA 2EPNA 2M4IA 3OMLA 2ENHA 2JYAA 4DV2E 2YZTA 1RC7A 2D85A 2EZ6A 2B9DA 2CTDA 2EM0A 2EQ1A 2HL9A 1FJGE 1YUIA 1WIXA 4DR2E 1T4NA 2DLKA 1DGCA 2ADRA 2UUBE 1PJTA 2LV2A 3F6HA 2DB2A 3C6KA 1STUA 2LMZA 2EMAA 4X65E 1G2DC 1YYWA 2LO3A 2EPLX 1UEGA 2YTGA 2RS7A 1TF3A 4F9BB 1X6HA 2A25A 3IWCA 3T1YE 1MEYC 2YTFA 5AE2A 2EPRA 2EQ3A 3BGHA 2DLQA 2V8QB 1HR0E 1SR9A 3K6QA 3IWDA 1A1KA 1XNQE 5BR8E 4NXME 1I94E 2EN6A 2EN2A 4TUIA 2RS6A 1BKRA 2EPKX 2F8BA 4JI8E 1RQ0A 2UXCE 4YHHE 2ODRC 4B3ME 1IQOA 2V87A 4DV5E 4KHPE 2DK9A 4LF5E 2K4VA 3JARM 2YU5A 2YTOA 3JTZA 4B3RE 2YSOA 3FIGA 3EPHA 2MC6A 5TSEA 5KL3A 2V88A 5ADZA 2EMZA 4JI7E 3VYYA 1BB8A 1WYRA 2WBUA 1A1JA 1AA2A 1N36E 2EPXA 2YTDA 4M0VA 4LVPA 2LE2A 4F9AB 4FK5C 3QG5C 2NUEA 4F6MA 1TF6A 2EN8A 4EDMA 3BBGA 1UBDC 5IWAE 3ADLA 1IQSA 4DR3E 2QJXA 2VE7C 3BF2A 4JI0E 4IJDA 3HORA 1AH5A 1NCSA 2EYNA 1P47A 2EOXA 2JPAA 2JY9A 2WA6A 1WYLA 4F54A 2RSIA 2EPPA 4GKKE 5KL2A 2LJHA 1T4LB 5A6AA 2E5LE 2KHXA 1X5WA 2EPAA 1LLMC 1IBLE 5AC4A 2DRPA 2EOFA 2EM4A 2B7TA 2JR1A 1KJKA 1N33E 1YYOA 2HGHA 1YSAC 4O43A 1HNWE 4B3SE 2M7QA 4DV4E 2HJJA 4DR5E 2D89A 1YFHA 2BBGA 4JI3E 1X47A 2LUQA 1ZAAC 2EL4A 2YWQA 5A6KA 2GHFA 1JK2A 4WSGA 1AAYA 2F4VE 2RPCA 2LBSB 3AV0A 2MC5A 2R0OA 2EOQA 1WKUA 3C6MA 2D88A 2D86A 5AASA 1QU6A 1RMDA 2YTNA 4DUYE 2HKPA 4WPYA 3TQMA 3VK6A 1N34E 3JALM 2EOEA 5FMUA 1BBOA 1X6EA 4JYAE 2YTPA 3ECRA 5IT9C 5KL6A 2EOZA 2EL5A 2HL8A 1IBME 2V89A 2YT4A 2RTXA 1IBKE 2EMKA 1EH6A 2K3SA 2EJ4A 4EDLA 2EMBA 4O24A 1PJSA 4B3TE 3ZOQB 3HPZA 1SH5A 5FMTA 2KONA 2LRSA 3VYXA 3OTOE 1YZ9A 5A37A 2EMCA 2EP3A 5DNYA 2YU8A 1HNXE 2YRMA 4RHBB 2L2MA 2JVAA 1IMUA 3J7Yp 2WBTA 4Q28A 2EMYA 4WSPA 2IHR1 3HXLA 1A1LA 5A36A 4JI5E 4Q59A 2EM3A 2MDRA 4LVRA 3REPB 4O5GA 2EE8A 1VKAA 4LTYA 5T6JA 1UN6B 2EMIA 2EN1A 4NHRA 3LLHA 1RT8A 3KY9A 2L3JA 1X6FA 1WJOA 1J26A 4GZNC 3HTXA 2VE7A 4DV0E 2EWLA 3MHSC 2IGPA 5LL6R 4DV1E 1WHNA 3J81C 2JWOA 1G2FC 4WFTA 2EM2A 2MKNA 2EMXA 4BMJA 2UUCE 2EYIA 2EPUA 4R03A 2JOXA 2L2KB 1L4SA 1T4OA 2JP9A 4L5NC 4F2JC 2VQEE 4F9CB 2EMHA 2R8UA 3KZYA 4LF7E 4X62E 4M30A 4HEIA 2FTXB 2L92A 2QJZA 1A1GA 1XNRE 1WYOA 4LU9A 1T38A 2GLIA 4F6NA 2EMWA 2LJUA 5CFFE 2EQOA 1PJQA 2EM5A 3MHHC 2ZM6E 2VQFE 3J7AG 1PDAA 3T1HE 2E9KA 3C4TA 2R76A 1EUVA 2K2RA 4EDNA 3CO1A 2L3GA 2RR8A 2E72A 2DMIA 5LMNE 4LFCE 4OX9E 1WYNA 2Q8UA 2EN3A 3ADIA 2ODRD 3DF6A 2EMGA 2LVHA 5A38A 5LMUE 2HC5A 2EOIA 3HQ1A 4J8ZA 1X48A 3EPKA 1WYQA 4R2AA 4DV7E 5L0OA 1WRJA 5KL4A 4R2SA 4JI2E 4M9VC 3BIDA 2D9HA 4IS1C 4LFAE 1H67A 1N3GA 4DR7E 5AC5A 1XMOE 4Q58A 2GPIA 1EH7A 2KOUA 1GZ6A 4OOGC 1TN9A 4B7LA 1X3CA 1B69A 2ENCA 1TJTA 4MLVA 4O4KA 2I13A 2UXBE 3H09A 3ADGA 4KZSA 3KMUB 1BHDA 2NUFA 3AUZA 2HHHE 1A1HA 3KWRA 1PA7A 4M2ZA 2WA7A 1WJPA 4R2PA 4JV5E 2EOJA 3EPLA 4BS9A 1AOAA 4WXCA 4BC7A 4X66E 2N3GA 2LUPB 2L33A 3UK3C 2YRKA 1P5SA 2MKDA 2UU9E 3THNA 4TXIA 4DDPA 2EMLA 4YY3E 2EMFA 3EPJA 4BC9A 2EPCA 1V5KA 4LFBE 4R2RA 1Z1BA 2FGGA 2NABA 5FLXC 2JV9A 3J80C 5IV8B 5J8EA 2LTRA 4LF6E 1YPNA 4R8OA 4JI6E 4TXKA 2MDGA 4LF4E 5A6JA 5KL5A 4MLQA 1WHQA 2EM8A 2V85A 2PRTA 1YUJA 4RH8A 1HNZE 3FERA 2LCEA 2K7IA 2NA2A 2WE6A 3JAMC 4AQYE 2VZDA 1J5EE 1FKAE 3THOB 4R2QA 2G7HA 1GTKA 4P78A 4WX9A 3JU0A 2EL6A 4Q57B 2DIXA 4LF9E 2R1FA 2EM9A 3MSWA 4R2CA 2CT1A 5A69A 1QAGA 3KZZA 2DMYA 4Q35B 4DUZE 4NZVA 5BVRA 4R2EA 3VP7A 2YTEA 2YTQA 3ADJA 2WDTA 2V83A 1WYPA 4GKJE 5AE3A 4BHBA 1X49A 4DR1E 4ZYGA 2JXPA 4BHCA 1NEIA 5IXMB 4ZYDA 1ZBTA 1N32E 2E1MA 2YTJA 2L8TA 4K0KE 1UJOA 2VRDA 4LF8E 1QNTA 4BBYA 3I6XA 3P1XA 1UHZA 2WZOA 1PXYA 2BB8A 1SH6A 2WCC3 4R2DA 3F7PA 3IWBA 2EE7A 2CPNA 2YSPA 2EOHA 1ZBQA 5LLQA 2DSYA 2ELYA 3M99B 1PKPA 4WYQB 2EORA 2EQ0A 1MB8A 2I9IA 4DV6E 3RMPA 1EKZA 1DQ3A 2J7JA 4TUGA 4KWYA 2EM6A 2L6MA 5F3WA 4X64E 2UXDE 3F6GA 4DKKA 2UUAE 3C4BA 4NXNE 2EN7A 1O0WA 1P2XA 4DR6E 2VF1A 4L8NA 4HTGA 4DMIA 1GQEA 2L2NA 3HOPA 3KMWB 2EPOA 4X9JA 2YRHA 1XMQE 4JI4E 3LMLA 2D87A 2M9AA 2EOMA 4ZYHA 3L00A 4I8OA 1WXRA 4WXDA 2EOSA 4BCAA 5A6BA 2WA5A 1DXXA 2JOBA 2RQLA 2EOOA 2CSHA 2EPMX 1DI2A 1ZR9A 2H36X 2N8XA 4JI1E 3DJWA 1A1IA 1MGTA 2B3TB 1BBGA 1A1FA 1ZU1A 2NUGA 2DGCA 5A6BD 2L3CA 2WBSA 2N3HA 2YTIA 2VZGB 3EAYA 2LT7A 1SFEA 2WFNA 4P7DA 2RSMA 4ZYEA 1KYQA 3HOCA 2M1SA 1WYMA 2LTSA 1YYKA 2EM7A 1F2IG 2EOYA 1T39A 4X8WA 5KL7A 2V86A 5A4BA 1UILA 2YRNA 3JAKM 2ENAA 2VZIB 2B7VA 4DV3E
chains in the Genus database with same CATH topology
4P78A 2JOXA 4R03A 2L2KB 3JU0A 1T4OA 4GKKE 2DIXA 4LF9E 3HPSA 4L5NC 2VQEE 4GEQB 3MSWA 4DR4E 4F9CB 4LF7E 5AE1A 4X62E 2FV4B 4M30A 2LJHA 1T4LB 2E5LE 2DMYA 2FTXB 2KHXA 2L92A 5A2QC 1IBLE 4DUZE 1XNRE 4LU9A 3VP7A 5CFFE 2EQOA 3ADJA 2WDTA 2V83A 2B7TA 4GKJE 2ZM6E 2M4IA 2VQFE 3J7AG 3OMLA 5AE3A 2JR1A 4DV2E 3T1HE 1X49A 4DR1E 3C4TA 1EUVA 2YZTA 1RC7A 1N33E 2EZ6A 2B9DA 1YYOA 2HL9A 4OX9E 5LMNE 1FJGE 4B3SE 4LFCE 2M7QA 1ZBTA 4DV4E 3ADIA 4DR5E 1N32E 2ODRD 2E1MA 3DF6A 2L8TA 4K0KE 4DR2E 1T4NA 4JI3E 5LMUE 4LF8E 4BBYA 1X47A 2LUQA 3HQ1A 2UUBE 3P1XA 3F6HA 4J8ZA 1UHZA 2DB2A 1STUA 2LMZA 2WZOA 1X48A 2F4VE 4X65E 2LBSB 3AV0A 2MC5A 3IWBA 2CPNA 4DV7E 1YYWA 1ZBQA 4JI2E 4LFAE 2DSYA 2RS7A 4DR7E 4F9BB 1PKPA 4WYQB 1QU6A 3IWCA 5AASA 3T1YE 1XMOE 4DUYE 2HKPA 4DV6E 5AE2A 3RMPA 1EKZA 1DQ3A 4WPYA 2KOUA 3VK6A 2V8QB 4TUGA 1GZ6A 1N34E 5FMUA 1SR9A 1HR0E 4OOGC 3K6QA 4JYAE 3IWDA 5F3WA 2L6MA 4X64E 5IT9C 1XNQE 5BR8E 4NXME 2UXDE 1I94E 3F6GA 4DKKA 2UUAE 2HL8A 3C4BA 2V89A 1IBME 4NXNE 2YT4A 1O0WA 2RS6A 3H09A 4TUIA 3ADGA 2UXBE 2RTXA 1IBKE 2F8BA 4KZSA 1RQ0A 2VF1A 4L8NA 4JI8E 4YHHE 4DR6E 4DMIA 1GQEA 2L2NA 2ODRC 2NUFA 3AUZA 2HHHE 4B3ME 1HNWE 2V87A 3KWRA 4DV5E 4KHPE 4B3TE 3ZOQB 4LF5E 4M2ZA 1XMQE 2K4VA 3HPZA 2KONA 5FMTA 2LRSA 4JI4E 4JV5E 3VYXA 3LMLA 3OTOE 1YZ9A 3JTZA 4B3RE 3FIGA 4I8OA 4BS9A 1WXRA 5DNYA 2MC6A 4BC7A 4BCAA 4X66E 2N3GA 2LUPB 1HNXE 2V88A 2L33A 5ADZA 2L2MA 4JI7E 2JOBA 2JVAA 3J7Yp 3VYYA 2UU9E 4Q28A 1DI2A 4WSPA 2IHR1 4DDPA 3HXLA 2H36X 4YY3E 1N36E 4JI1E 4BC9A 4JI5E 2MDRA 3DJWA 4LVRA 4M0VA 4LFBE 4LVPA 2LE2A 4LTYA 5T6JA 2B3TB 4F9AB 2FGGA 5FLXC 2NUEA 3J80C 2NUGA 3LLHA 2L3CA 2N3HA 2L3JA 5IWAE 2LTRA 3EAYA 4LF6E 3ADLA 1J26A 4P7DA 3HTXA 4R8OA 2RSMA 2VE7A 4DR3E 4JI6E 2VE7C 4DV0E 2EWLA 2M1SA 4LF4E 4JI0E 2LTSA 1YYKA 2IGPA 1WHQA 2V85A 5LL6R 4DV1E 2UXCE 1WHNA 1HNZE 3J81C 2JWOA 2NA2A 4WFTA 2WE6A 3JAMC 4X8WA 4AQYE 2V86A 4BMJA 1J5EE 1UILA 1FKAE 2JY9A 2UUCE 2G7HA 2B7VA 4DV3E 4F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE7 C; 
#chains in the Genus database with same CATH topology
 2ELZ A;  2YPN A;  2VZC A;  3HPS A;  4GEQ B;  2EN4 A;  4DR4 E;  3VHT B;  3EQ1 A;  5AE1 A;  2FV4 B;  4N4R B;  1JK1 A;  5A2Q C;  1EH8 A;  2EPZ A;  2EPN A;  2M4I A;  3OML A;  2ENH A;  2JYA A;  4DV2 E;  2YZT A;  1RC7 A;  2D85 A;  2EZ6 A;  2B9D A;  2CTD A;  2EM0 A;  2EQ1 A;  2HL9 A;  1FJG E;  1YUI A;  1WIX A;  4DR2 E;  1T4N A;  2DLK A;  1DGC A;  2ADR A;  2UUB E;  1PJT A;  2LV2 A;  3F6H A;  2DB2 A;  3C6K A;  1STU A;  2LMZ A;  2EMA A;  4X65 E;  1G2D C;  1YYW A;  2LO3 A;  2EPL X;  1UEG A;  2YTG A;  2RS7 A;  1TF3 A;  4F9B B;  1X6H A;  2A25 A;  3IWC A;  3T1Y E;  1MEY C;  2YTF A;  5AE2 A;  2EPR A;  2EQ3 A;  3BGH A;  2DLQ A;  2V8Q B;  1HR0 E;  1SR9 A;  3K6Q A;  3IWD A;  1A1K A;  1XNQ E;  5BR8 E;  4NXM E;  1I94 E;  2EN6 A;  2EN2 A;  4TUI A;  2RS6 A;  1BKR A;  2EPK X;  2F8B A;  4JI8 E;  1RQ0 A;  2UXC E;  4YHH E;  2ODR C;  4B3M E;  1IQO A;  2V87 A;  4DV5 E;  4KHP E;  2DK9 A;  4LF5 E;  2K4V A;  3JAR M;  2YU5 A;  2YTO A;  3JTZ A;  4B3R E;  2YSO A;  3FIG A;  3EPH A;  2MC6 A;  5TSE A;  5KL3 A;  2V88 A;  5ADZ A;  2EMZ A;  4JI7 E;  3VYY A;  1BB8 A;  1WYR A;  2WBU A;  1A1J A;  1AA2 A;  1N36 E;  2EPX A;  2YTD A;  4M0V A;  4LVP A;  2LE2 A;  4F9A B;  4FK5 C;  3QG5 C;  2NUE A;  4F6M A;  1TF6 A;  2EN8 A;  4EDM A;  3BBG A;  1UBD C;  5IWA E;  3ADL A;  1IQS A;  4DR3 E;  2QJX A;  2VE7 C;  3BF2 A;  4JI0 E;  4IJD A;  3HOR A;  1AH5 A;  1NCS A;  2EYN A;  1P47 A;  2EOX A;  2JPA A;  2JY9 A;  2WA6 A;  1WYL A;  4F54 A;  2RSI A;  2EPP A;  4GKK E;  5KL2 A;  2LJH A;  1T4L B;  5A6A A;  2E5L E;  2KHX A;  1X5W A;  2EPA A;  1LLM C;  1IBL E;  5AC4 A;  2DRP A;  2EOF A;  2EM4 A;  2B7T A;  2JR1 A;  1KJK A;  1N33 E;  1YYO A;  2HGH A;  1YSA C;  4O43 A;  1HNW E;  4B3S E;  2M7Q A;  4DV4 E;  2HJJ A;  4DR5 E;  2D89 A;  1YFH A;  2BBG A;  4JI3 E;  1X47 A;  2LUQ A;  1ZAA C;  2EL4 A;  2YWQ A;  5A6K A;  2GHF A;  1JK2 A;  4WSG A;  1AAY A;  2F4V E;  2RPC A;  2LBS B;  3AV0 A;  2MC5 A;  2R0O A;  2EOQ A;  1WKU A;  3C6M A;  2D88 A;  2D86 A;  5AAS A;  1QU6 A;  1RMD A;  2YTN A;  4DUY E;  2HKP A;  4WPY A;  3TQM A;  3VK6 A;  1N34 E;  3JAL M;  2EOE A;  5FMU A;  1BBO A;  1X6E A;  4JYA E;  2YTP A;  3ECR A;  5IT9 C;  5KL6 A;  2EOZ A;  2EL5 A;  2HL8 A;  1IBM E;  2V89 A;  2YT4 A;  2RTX A;  1IBK E;  2EMK A;  1EH6 A;  2K3S A;  2EJ4 A;  4EDL A;  2EMB A;  4O24 A;  1PJS A;  4B3T E;  3ZOQ B;  3HPZ A;  1SH5 A;  5FMT A;  2KON A;  2LRS A;  3VYX A;  3OTO E;  1YZ9 A;  5A37 A;  2EMC A;  2EP3 A;  5DNY A;  2YU8 A;  1HNX E;  2YRM A;  4RHB B;  2L2M A;  2JVA A;  1IMU A;  3J7Y p;  2WBT A;  4Q28 A;  2EMY A;  4WSP A;  2IHR 1;  3HXL A;  1A1L A;  5A36 A;  4JI5 E;  4Q59 A;  2EM3 A;  2MDR A;  4LVR A;  3REP B;  4O5G A;  2EE8 A;  1VKA A;  4LTY A;  5T6J A;  1UN6 B;  2EMI A;  2EN1 A;  4NHR A;  3LLH A;  1RT8 A;  3KY9 A;  2L3J A;  1X6F A;  1WJO A;  1J26 A;  4GZN C;  3HTX A;  2VE7 A;  4DV0 E;  2EWL A;  3MHS C;  2IGP A;  5LL6 R;  4DV1 E;  1WHN A;  3J81 C;  2JWO A;  1G2F C;  4WFT A;  2EM2 A;  2MKN A;  2EMX A;  4BMJ A;  2UUC E;  2EYI A;  2EPU A;  4R03 A;  2JOX A;  2L2K B;  1L4S A;  1T4O A;  2JP9 A;  4L5N C;  4F2J C;  2VQE E;  4F9C B;  2EMH A;  2R8U A;  3KZY A;  4LF7 E;  4X62 E;  4M30 A;  4HEI A;  2FTX B;  2L92 A;  2QJZ A;  1A1G A;  1XNR E;  1WYO A;  4LU9 A;  1T38 A;  2GLI A;  4F6N A;  2EMW A;  2LJU A;  5CFF E;  2EQO A;  1PJQ A;  2EM5 A;  3MHH C;  2ZM6 E;  2VQF E;  3J7A G;  1PDA A;  3T1H E;  2E9K A;  3C4T A;  2R76 A;  1EUV A;  2K2R A;  4EDN A;  3CO1 A;  2L3G A;  2RR8 A;  2E72 A;  2DMI A;  5LMN E;  4LFC E;  4OX9 E;  1WYN A;  2Q8U A;  2EN3 A;  3ADI A;  2ODR D;  3DF6 A;  2EMG A;  2LVH A;  5A38 A;  5LMU E;  2HC5 A;  2EOI A;  3HQ1 A;  4J8Z A;  1X48 A;  3EPK A;  1WYQ A;  4R2A A;  4DV7 E;  5L0O A;  1WRJ A;  5KL4 A;  4R2S A;  4JI2 E;  4M9V C;  3BID A;  2D9H A;  4IS1 C;  4LFA E;  1H67 A;  1N3G A;  4DR7 E;  5AC5 A;  1XMO E;  4Q58 A;  2GPI A;  1EH7 A;  2KOU A;  1GZ6 A;  4OOG C;  1TN9 A;  4B7L A;  1X3C A;  1B69 A;  2ENC A;  1TJT A;  4MLV A;  4O4K A;  2I13 A;  2UXB E;  3H09 A;  3ADG A;  4KZS A;  3KMU B;  1BHD A;  2NUF A;  3AUZ A;  2HHH E;  1A1H A;  3KWR A;  1PA7 A;  4M2Z A;  2WA7 A;  1WJP A;  4R2P A;  4JV5 E;  2EOJ A;  3EPL A;  4BS9 A;  1AOA A;  4WXC A;  4BC7 A;  4X66 E;  2N3G A;  2LUP B;  2L33 A;  3UK3 C;  2YRK A;  1P5S A;  2MKD A;  2UU9 E;  3THN A;  4TXI A;  4DDP A;  2EML A;  4YY3 E;  2EMF A;  3EPJ A;  4BC9 A;  2EPC A;  1V5K A;  4LFB E;  4R2R A;  1Z1B A;  2FGG A;  2NAB A;  5FLX C;  2JV9 A;  3J80 C;  5IV8 B;  5J8E A;  2LTR A;  4LF6 E;  1YPN A;  4R8O A;  4JI6 E;  4TXK A;  2MDG A;  4LF4 E;  5A6J A;  5KL5 A;  4MLQ A;  1WHQ A;  2EM8 A;  2V85 A;  2PRT A;  1YUJ A;  4RH8 A;  1HNZ E;  3FER A;  2LCE A;  2K7I A;  2NA2 A;  2WE6 A;  3JAM C;  4AQY E;  2VZD A;  1J5E E;  1FKA E;  3THO B;  4R2Q A;  2G7H A;  1GTK A;  4P78 A;  4WX9 A;  3JU0 A;  2EL6 A;  4Q57 B;  2DIX A;  4LF9 E;  2R1F A;  2EM9 A;  3MSW A;  4R2C A;  2CT1 A;  5A69 A;  1QAG A;  3KZZ A;  2DMY A;  4Q35 B;  4DUZ E;  4NZV A;  5BVR A;  4R2E A;  3VP7 A;  2YTE A;  2YTQ A;  3ADJ A;  2WDT A;  2V83 A;  1WYP A;  4GKJ E;  5AE3 A;  4BHB A;  1X49 A;  4DR1 E;  4ZYG A;  2JXP A;  4BHC A;  1NEI A;  5IXM B;  4ZYD A;  1ZBT A;  1N32 E;  2E1M A;  2YTJ A;  2L8T A;  4K0K E;  1UJO A;  2VRD A;  4LF8 E;  1QNT A;  4BBY A;  3I6X A;  3P1X A;  1UHZ A;  2WZO A;  1PXY A;  2BB8 A;  1SH6 A;  2WCC 3;  4R2D A;  3F7P A;  3IWB A;  2EE7 A;  2CPN A;  2YSP A;  2EOH A;  1ZBQ A;  5LLQ A;  2DSY A;  2ELY A;  3M99 B;  1PKP A;  4WYQ B;  2EOR A;  2EQ0 A;  1MB8 A;  2I9I A;  4DV6 E;  3RMP A;  1EKZ A;  1DQ3 A;  2J7J A;  4TUG A;  4KWY A;  2EM6 A;  2L6M A;  5F3W A;  4X64 E;  2UXD E;  3F6G A;  4DKK A;  2UUA E;  3C4B A;  4NXN E;  2EN7 A;  1O0W A;  1P2X A;  4DR6 E;  2VF1 A;  4L8N A;  4HTG A;  4DMI A;  1GQE A;  2L2N A;  3HOP A;  3KMW B;  2EPO A;  4X9J A;  2YRH A;  1XMQ E;  4JI4 E;  3LML A;  2D87 A;  2M9A A;  2EOM A;  4ZYH A;  3L00 A;  4I8O A;  1WXR A;  4WXD A;  2EOS A;  4BCA A;  5A6B A;  2WA5 A;  1DXX A;  2JOB A;  2RQL A;  2EOO A;  2CSH A;  2EPM X;  1DI2 A;  1ZR9 A;  2H36 X;  2N8X A;  4JI1 E;  3DJW A;  1A1I A;  1MGT A;  2B3T B;  1BBG A;  1A1F A;  1ZU1 A;  2NUG A;  2DGC A;  5A6B D;  2L3C A;  2WBS A;  2N3H A;  2YTI A;  2VZG B;  3EAY A;  2LT7 A;  1SFE A;  2WFN A;  4P7D A;  2RSM A;  4ZYE A;  1KYQ A;  3HOC A;  2M1S A;  1WYM A;  2LTS A;  1YYK A;  2EM7 A;  1F2I G;  2EOY A;  1T39 A;  4X8W A;  5KL7 A;  2V86 A;  5A4B A;  1UIL A;  2YRN A;  3JAK M;  2ENA A;  2VZI B;  2B7V A;  4DV3 E; 
#chains in the Genus database with same CATH homology
 4P78 A;  2JOX A;  4R03 A;  2L2K B;  3JU0 A;  1T4O A;  4GKK E;  2DIX A;  4LF9 E;  3HPS A;  4L5N C;  2VQE E;  4GEQ B;  3MSW A;  4DR4 E;  4F9C B;  4LF7 E;  5AE1 A;  4X62 E;  2FV4 B;  4M30 A;  2LJH A;  1T4L B;  2E5L E;  2DMY A;  2FTX B;  2KHX A;  2L92 A;  5A2Q C;  1IBL E;  4DUZ E;  1XNR E;  4LU9 A;  3VP7 A;  5CFF E;  2EQO A;  3ADJ A;  2WDT A;  2V83 A;  2B7T A;  4GKJ E;  2ZM6 E;  2M4I A;  2VQF E;  3J7A G;  3OML A;  5AE3 A;  2JR1 A;  4DV2 E;  3T1H E;  1X49 A;  4DR1 E;  3C4T A;  1EUV A;  2YZT A;  1RC7 A;  1N33 E;  2EZ6 A;  2B9D A;  1YYO A;  2HL9 A;  4OX9 E;  5LMN E;  1FJG E;  4B3S E;  4LFC E;  2M7Q A;  1ZBT A;  4DV4 E;  3ADI A;  4DR5 E;  1N32 E;  2ODR D;  2E1M A;  3DF6 A;  2L8T A;  4K0K E;  4DR2 E;  1T4N A;  4JI3 E;  5LMU E;  4LF8 E;  4BBY A;  1X47 A;  2LUQ A;  3HQ1 A;  2UUB E;  3P1X A;  3F6H A;  4J8Z A;  1UHZ A;  2DB2 A;  1STU A;  2LMZ A;  2WZO A;  1X48 A;  2F4V E;  4X65 E;  2LBS B;  3AV0 A;  2MC5 A;  3IWB A;  2CPN A;  4DV7 E;  1YYW A;  1ZBQ A;  4JI2 E;  4LFA E;  2DSY A;  2RS7 A;  4DR7 E;  4F9B B;  1PKP A;  4WYQ B;  1QU6 A;  3IWC A;  5AAS A;  3T1Y E;  1XMO E;  4DUY E;  2HKP A;  4DV6 E;  5AE2 A;  3RMP A;  1EKZ A;  1DQ3 A;  4WPY A;  2KOU A;  3VK6 A;  2V8Q B;  4TUG A;  1GZ6 A;  1N34 E;  5FMU A;  1SR9 A;  1HR0 E;  4OOG C;  3K6Q A;  4JYA E;  3IWD A;  5F3W A;  2L6M A;  4X64 E;  5IT9 C;  1XNQ E;  5BR8 E;  4NXM E;  2UXD E;  1I94 E;  3F6G A;  4DKK A;  2UUA E;  2HL8 A;  3C4B A;  2V89 A;  1IBM E;  4NXN E;  2YT4 A;  1O0W A;  2RS6 A;  3H09 A;  4TUI A;  3ADG A;  2UXB E;  2RTX A;  1IBK E;  2F8B A;  4KZS A;  1RQ0 A;  2VF1 A;  4L8N A;  4JI8 E;  4YHH E;  4DR6 E;  4DMI A;  1GQE A;  2L2N A;  2ODR C;  2NUF A;  3AUZ A;  2HHH E;  4B3M E;  1HNW E;  2V87 A;  3KWR A;  4DV5 E;  4KHP E;  4B3T E;  3ZOQ B;  4LF5 E;  4M2Z A;  1XMQ E;  2K4V A;  3HPZ A;  2KON A;  5FMT A;  2LRS A;  4JI4 E;  4JV5 E;  3VYX A;  3LML A;  3OTO E;  1YZ9 A;  3JTZ A;  4B3R E;  3FIG A;  4I8O A;  4BS9 A;  1WXR A;  5DNY A;  2MC6 A;  4BC7 A;  4BCA A;  4X66 E;  2N3G A;  2LUP B;  1HNX E;  2V88 A;  2L33 A;  5ADZ A;  2L2M A;  4JI7 E;  2JOB A;  2JVA A;  3J7Y p;  3VYY A;  2UU9 E;  4Q28 A;  1DI2 A;  4WSP A;  2IHR 1;  4DDP A;  3HXL A;  2H36 X;  4YY3 E;  1N36 E;  4JI1 E;  4BC9 A;  4JI5 E;  2MDR A;  3DJW A;  4LVR A;  4M0V A;  4LFB E;  4LVP A;  2LE2 A;  4LTY A;  5T6J A;  2B3T B;  4F9A B;  2FGG A;  5FLX C;  2NUE A;  3J80 C;  2NUG A;  3LLH A;  2L3C A;  2N3H A;  2L3J A;  5IWA E;  2LTR A;  3EAY A;  4LF6 E;  3ADL A;  1J26 A;  4P7D A;  3HTX A;  4R8O A;  2RSM A;  2VE7 A;  4DR3 E;  4JI6 E;  2VE7 C;  4DV0 E;  2EWL A;  2M1S A;  4LF4 E;  4JI0 E;  2LTS A;  1YYK A;  2IGP A;  1WHQ A;  2V85 A;  5LL6 R;  4DV1 E;  2UXC E;  1WHN A;  1HNZ E;  3J81 C;  2JWO A;  2NA2 A;  4WFT A;  2WE6 A;  3JAM C;  4X8W A;  4AQY E;  2V86 A;  4BMJ A;  1J5E E;  1UIL A;  1FKA E;  2JY9 A;  2UUC E;  2G7H A;  2B7V A;  4DV3 E;  4F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...