2VE7C

Crystal structure of a bonsai version of the human ndc80 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
238
structure length
219
Chain Sequence
LSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSGVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLEIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHQPIHLDSTQLSRKFISDYLWSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN SPC25
publication title Implications for Kinetochore-Microtubule Attachment from the Structure of an Engineered Ndc80 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 219
sequence length 238
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03800 Nuf2 Nuf2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.60 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2ve7C01
3.30.160.570 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ve7C02
2VE7C
chains in the Genus database with same CATH superfamily
2L92A 4OX9E 1A1IA 1AOAA 2EPCA 2EQ1A 4R2EA 1T4LB 3KMUB 2NUGA 4LF8E 4R2PA 4JI2E 1HR0E 1UN6B 2F4VE 1ZAAC 2Q8UA 4F9BB 4LF5E 2EMYA 2CTDA 1XNRE 2VZGB 3IWDA 2YTFA 2EWLA 2V88A 5FMUA 2EPXA 4WSPA 2NABA 1RC7A 4P7DA 5LLQA 4DR5E 4KWYA 2K7IA 2N8XA 3MSWA 3EPJA 3H09A 4L5NC 1YUJA 5A4BA 3F6GA 3HXLA 3CO1A 1NEIA 2CT1A 2R1FA 3THOB 4JI4E 5AC4A 4DR2E 2K4VA 4ZYEA 4LVPA 2EYNA 5BVRA 2UXDE 3EPKA 5FMTA 4RH8A 3F6HA 1A1KA 2MDRA 2V89A 3FIGA 2B7TA 2UXBE 2RTXA 2VQFE 1XMOE 1PDAA 2VE7A 2ENCA 1UILA 2EPAA 1TF6A 4F9AB 2L33A 2ZM6E 5KL5A 4X66E 5AE3A 5DNYA 1L4SA 2LE2A 2YTEA 2VZIB 1WJOA 5A37A 4BCAA 1AH5A 2MDGA 4LF9E 4GKKE 2EMLA 2EOEA 4IS1C 2EM8A 3C4TA 1MB8A 4M30A 4LF7E 1EH6A 1SH5A 1AA2A 2JY9A 4O5GA 4JI0E 3KWRA 4Q58A 2NUEA 2EYIA 2WA7A 1QNTA 2EOOA 5A6AA 1A1HA 2J7JA 1A1GA 2M9AA 2EPLX 2MKDA 2YSOA 2YTJA 1T4OA 4JI7E 2WZOA 1TJTA 5FLXC 2I9IA 2JR1A 2YTOA 2ADRA 5AASA 1SH6A 2NUFA 2EPKX 1KJKA 2F8BA 4WPYA 4DV3E 4X62E 2E1MA 2L2NA 2VRDA 2WBSA 1N36E 1GQEA 3IWCA 3HOCA 4WXCA 4YY3E 2EL4A 4RHBB 4X9JA 5F3WA 2LCEA 2L3JA 5AE2A 5A6BD 3HQ1A 4LF4E 3I6XA 3EPLA 5IXMB 1J26A 4P78A 1V5KA 3THNA 4OOGC 2M1SA 2HKPA 2E72A 3K6QA 3ADGA 5LL6R 2LUPB 1WYMA 2DMYA 2EORA 3JAKM 2EN1A 2GLIA 4K0KE 1A1FA 2EM9A 4BHBA 2EOYA 4O24A 4FK5C 2YZTA 4JI8E 4X64E 2LTRA 4F6NA 1YSAC 4JI5E 1IBLE 3KZZA 2YRMA 5A69A 4WSGA 4LU9A 2ELZA 2EOZA 3P1XA 1X3CA 2B9DA 2I13A 2JV9A 1HNWE 3T1HE 4R2AA 3EAYA 4MLQA 5IV8B 3T1YE 2EMWA 2ENHA 3KY9A 1RMDA 4BBYA 2LJUA 1HNZE 2EOJA 2YT4A 2MKNA 4LFBE 2WDTA 2EN7A 2ODRC 2L3CA 3ADIA 2JVAA 2L3GA 3JALM 2EN4A 1XNQE 2IGPA 4Q28A 1T38A 5A6JA 1PKPA 4GZNC 2EN3A 1FKAE 1WYQA 2JP9A 4Q57B 5IWAE 2R8UA 4B3ME 1IMUA 1RT8A 3BGHA 4M2ZA 4TXKA 3IWBA 2D86A 1XMQE 2EN2A 1IBME 2PRTA 5KL7A 3VYXA 1DXXA 2YPNA 5AE1A 2JPAA 2EQOA 2D88A 4DMIA 4DV2E 4LTYA 4I8OA 2CSHA 4Q35B 5A6BA 4DR7E 2HHHE 2HGHA 2EM5A 2V86A 1UEGA 2IHR1 2E9KA 5A2QC 4LVRA 5LMNE 4JV5E 4NXME 1PJSA 2DMIA 2LUQA 2DLQA 2GPIA 1YYOA 5A36A 1EH7A 1X6FA 3OMLA 1WYPA 4YHHE 2UU9E 2G7HA 1X47A 1X5WA 2D87A 4WX9A 3C6MA 2EZ6A 1Z1BA 3AUZA 2EOMA 2LTSA 3DF6A 1UJOA 4EDMA 2EPRA 4WFTA 5LMUE 2EJ4A 1AAYA 2RS6A 4BHCA 2UXCE 4O43A 4DKKA 2LJHA 2LT7A 2LRSA 4DV0E 4AQYE 4N4RB 2EN6A 2DB2A 2YTPA 2NA2A 1BBGA 4DDPA 2EMAA 4DV7E 5T6JA 2R76A 1EUVA 4BMJA 3FERA 4R2SA 2L2KB 1STUA 2YWQA 3J7Yp 2DRPA 2EPPA 2UUCE 1ZBTA 2EL5A 2EPMX 3HPZA 3VHTB 3HOPA 1WXRA 2JWOA 3LMLA 2HC5A 3RMPA 1WYOA 1WRJA 2JXPA 2YTNA 2FGGA 2GHFA 3UK3C 2EPUA 4JYAE 1IQOA 2L2MA 2YTIA 4JI1E 3QG5C 5ADZA 4KHPE 4DUYE 2MC6A 3LLHA 2EMGA 2LO3A 4R2QA 2JYAA 2RR8A 2HL8A 1FJGE 4F2JC 4MLVA 2UUAE 1WHNA 2N3GA 1YFHA 2EMBA 2VE7C 2HJJA 3M99B 2DGCA 4B3RE 2YRNA 3EPHA 1BB8A 2E5LE 1YPNA 4DUZE 1P2XA 1F2IG 2WA5A 1PJTA 4HEIA 2N3HA 4F6MA 1BKRA 4DV1E 1N3GA 4DR4E 3KMWB 5IT9C 4LF6E 2WE6A 3L00A 2LVHA 2EMCA 3C4BA 3C6KA 4WXDA 4R8OA 2V83A 2EE8A 2EOXA 2YSPA 4O4KA 5J8EA 1LLMC 1TN9A 2RSMA 4DR1E 2WBUA 1PXYA 4NZVA 2EMXA 1N34E 2QJZA 1WYNA 2LBSB 1YUIA 2VZCA 2RS7A 2FTXB 2WCC3 1BHDA 4J8ZA 2RQLA 3OTOE 1O0WA 2RPCA 1DQ3A 2QJXA 4LFCE 1ZU1A 2WA6A 2EM2A 2YTDA 2EM3A 2EMZA 1YYKA 4B3SE 3JARM 4GKJE 2WFNA 1WJPA 2ODRD 1X6EA 1ZBQA 2JOBA 5BR8E 4TUIA 4DR3E 4JI3E 3BBGA 4GEQB 4M9VC 3TQMA 2KONA 4F9CB 5KL4A 3J80C 4B7LA 4DV4E 2LV2A 3J7AG 2EM0A 2EPOA 2BB8A 3ECRA 3MHHC 1X48A 3VYYA 1VKAA 4BS9A 1KYQA 1X6HA 1X49A 2V85A 1MEYC 4R2DA 2K3SA 2YTQA 2EN8A 1T39A 1N32E 1I94E 2BBGA 2EQ0A 3HORA 2EOQA 2YTGA 1IBKE 5KL6A 4Q59A 4TUGA 4R03A 5TSEA 2VZDA 2M4IA 1YZ9A 2EPNA 1WIXA 1WYRA 1WKUA 2ELYA 2EOFA 1JK1A 4M0VA 3DJWA 2A25A 2D89A 3HPSA 1P5SA 2DLKA 1UBDC 3BIDA 2YU5A 2D9HA 1EKZA 1MGTA 4F54A 2EL6A 2EMFA 2EMIA 5KL2A 2L8TA 3KZYA 4DR6E 2KHXA 1HNXE 3VP7A 2K2RA 2YRHA 4ZYDA 2JOXA 1A1LA 2FV4B 1G2DC 1PA7A 3EQ1A 4WYQB 3JTZA 1RQ0A 2H36X 3HTXA 4EDLA 5L0OA 2V87A 3VK6A 1BBOA 4NHRA 4JI6E 2DIXA 1IQSA 1UHZA 2EMHA 2YRKA 2M7QA 4R2CA 1GTKA 4ZYHA 5A6KA 2B3TB 1DGCA 4HTGA 4X8WA 3BF2A 2EOHA 2LMZA 4ZYGA 2B7VA 3AV0A 4BC7A 2UUBE 2MC5A 3J81C 4TXIA 4L8NA 1QU6A 4IJDA 2D85A 4LFAE 3MHSC 2DK9A 2HL9A 4KZSA 4B3TE 1J5EE 1EH8A 2VF1A 2WBTA 1A1JA 2EOIA 1DI2A 1H67A 1WHQA 1P47A 1NCSA 3ADLA 5CFFE 1WYLA 4BC9A 1SFEA 4NXNE 3ADJA 1B69A 1SR9A 5A38A 3F7PA 2YU8A 3JAMC 1TF3A 1N33E 2EMKA 5AC5A 4R2RA 2R0OA 3REPB 1GZ6A 4EDNA 1QAGA 1ZR9A 2KOUA 1T4NA 2VQEE 2CPNA 2EOSA 2EP3A 2EM7A 2V8QB 2ENAA 2EM6A 2EE7A 4DV5E 4X65E 2EPZA 3JU0A 5KL3A 1PJQA 2EQ3A 2DSYA 2L6MA 1G2FC 4DV6E 1JK2A 1YYWA 3ZOQB 2EM4A 2RSIA
chains in the Genus database with same CATH topology
2L92A 4OX9E 1T4LB 2NUGA 4LF8E 4JI2E 1HR0E 2F4VE 4F9BB 4LF5E 1XNRE 3IWDA 2EWLA 2V88A 5FMUA 4WSPA 1RC7A 4P7DA 4DR5E 3MSWA 3H09A 4L5NC 3F6GA 3HXLA 4JI4E 4DR2E 2K4VA 4LVPA 2UXDE 5FMTA 3F6HA 2MDRA 2V89A 3FIGA 2B7TA 2UXBE 2RTXA 2VQFE 1XMOE 2VE7A 1UILA 4F9AB 2L33A 2ZM6E 4X66E 5AE3A 5DNYA 2LE2A 4BCAA 4LF9E 4GKKE 3C4TA 4LF7E 4M30A 2JY9A 4JI0E 3KWRA 2NUEA 1T4OA 4JI7E 2WZOA 5FLXC 2JR1A 5AASA 2NUFA 2F8BA 4WPYA 4DV3E 4X62E 2E1MA 2L2NA 1N36E 1GQEA 3IWCA 4YY3E 5F3WA 2L3JA 5AE2A 3HQ1A 4LF4E 1J26A 4P78A 4OOGC 2M1SA 2HKPA 3K6QA 3ADGA 5LL6R 2LUPB 2DMYA 4K0KE 2YZTA 4JI8E 4X64E 2LTRA 4JI5E 1IBLE 4LU9A 3P1XA 2B9DA 1HNWE 3T1HE 3EAYA 3T1YE 4BBYA 1HNZE 2YT4A 4LFBE 2WDTA 2L3CA 2ODRC 3ADIA 2JVAA 1XNQE 2IGPA 4Q28A 1PKPA 1FKAE 5IWAE 4B3ME 4M2ZA 3IWBA 1XMQE 1IBME 3VYXA 5AE1A 2EQOA 4DMIA 4DV2E 4LTYA 4I8OA 4DR7E 2HHHE 2V86A 2IHR1 5A2QC 4LVRA 5LMNE 4JV5E 4NXME 1YYOA 2LUQA 3OMLA 4YHHE 2UU9E 2G7HA 1X47A 2EZ6A 3AUZA 2LTSA 3DF6A 4WFTA 5LMUE 2RS6A 2UXCE 4DKKA 2LJHA 2LRSA 4DV0E 4AQYE 2DB2A 2NA2A 4DDPA 4DV7E 5T6JA 1EUVA 4BMJA 2L2KB 1STUA 3J7Yp 2UUCE 1ZBTA 3HPZA 1WXRA 2JWOA 3LMLA 3RMPA 2FGGA 4JYAE 2L2MA 4JI1E 5ADZA 4KHPE 4DUYE 2MC6A 3LLHA 2HL8A 1FJGE 2UUAE 1WHNA 2N3GA 2VE7C 4B3RE 2E5LE 4DUZE 2N3HA 4DV1E 4DR4E 5IT9C 4LF6E 2WE6A 3C4BA 4R8OA 2V83A 2RSMA 4DR1E 1N34E 2LBSB 2RS7A 2FTXB 4J8ZA 3OTOE 1O0WA 1DQ3A 4LFCE 1YYKA 4B3SE 4GKJE 4TUIA 1ZBQA 2ODRD 2JOBA 5BR8E 4JI3E 4DR3E 4GEQB 2KONA 4F9CB 3J80C 4DV4E 3J7AG 1X48A 3VYYA 4BS9A 1X49A 2V85A 1N32E 1I94E 1IBKE 4TUGA 4R03A 2M4IA 1YZ9A 4M0VA 3DJWA 3HPSA 1EKZA 4F54A 2L8TA 4DR6E 2KHXA 1HNXE 3VP7A 2JOXA 2FV4B 4WYQB 3JTZA 1RQ0A 2H36X 3HTXA 2V87A 3VK6A 4JI6E 2DIXA 1UHZA 2M7QA 2B3TB 4X8WA 2LMZA 2B7VA 3AV0A 4BC7A 2UUBE 2MC5A 3J81C 4L8NA 1QU6A 4LFAE 2HL9A 4KZSA 4B3TE 1J5EE 2VF1A 1DI2A 1WHQA 3ADLA 5CFFE 4BC9A 4NXNE 3ADJA 1SR9A 3JAMC 1N33E 1GZ6A 2KOUA 1T4NA 2VQEE 2CPNA 2V8QB 4DV5E 4X65E 3JU0A 2DSYA 2L6MA 4DV6E 1YYWA 3ZOQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE7 C; 
#chains in the Genus database with same CATH topology
 2L92 A;  4OX9 E;  1A1I A;  1AOA A;  2EPC A;  2EQ1 A;  4R2E A;  1T4L B;  3KMU B;  2NUG A;  4LF8 E;  4R2P A;  4JI2 E;  1HR0 E;  1UN6 B;  2F4V E;  1ZAA C;  2Q8U A;  4F9B B;  4LF5 E;  2EMY A;  2CTD A;  1XNR E;  2VZG B;  3IWD A;  2YTF A;  2EWL A;  2V88 A;  5FMU A;  2EPX A;  4WSP A;  2NAB A;  1RC7 A;  4P7D A;  5LLQ A;  4DR5 E;  4KWY A;  2K7I A;  2N8X A;  3MSW A;  3EPJ A;  3H09 A;  4L5N C;  1YUJ A;  5A4B A;  3F6G A;  3HXL A;  3CO1 A;  1NEI A;  2CT1 A;  2R1F A;  3THO B;  4JI4 E;  5AC4 A;  4DR2 E;  2K4V A;  4ZYE A;  4LVP A;  2EYN A;  5BVR A;  2UXD E;  3EPK A;  5FMT A;  4RH8 A;  3F6H A;  1A1K A;  2MDR A;  2V89 A;  3FIG A;  2B7T A;  2UXB E;  2RTX A;  2VQF E;  1XMO E;  1PDA A;  2VE7 A;  2ENC A;  1UIL A;  2EPA A;  1TF6 A;  4F9A B;  2L33 A;  2ZM6 E;  5KL5 A;  4X66 E;  5AE3 A;  5DNY A;  1L4S A;  2LE2 A;  2YTE A;  2VZI B;  1WJO A;  5A37 A;  4BCA A;  1AH5 A;  2MDG A;  4LF9 E;  4GKK E;  2EML A;  2EOE A;  4IS1 C;  2EM8 A;  3C4T A;  1MB8 A;  4M30 A;  4LF7 E;  1EH6 A;  1SH5 A;  1AA2 A;  2JY9 A;  4O5G A;  4JI0 E;  3KWR A;  4Q58 A;  2NUE A;  2EYI A;  2WA7 A;  1QNT A;  2EOO A;  5A6A A;  1A1H A;  2J7J A;  1A1G A;  2M9A A;  2EPL X;  2MKD A;  2YSO A;  2YTJ A;  1T4O A;  4JI7 E;  2WZO A;  1TJT A;  5FLX C;  2I9I A;  2JR1 A;  2YTO A;  2ADR A;  5AAS A;  1SH6 A;  2NUF A;  2EPK X;  1KJK A;  2F8B A;  4WPY A;  4DV3 E;  4X62 E;  2E1M A;  2L2N A;  2VRD A;  2WBS A;  1N36 E;  1GQE A;  3IWC A;  3HOC A;  4WXC A;  4YY3 E;  2EL4 A;  4RHB B;  4X9J A;  5F3W A;  2LCE A;  2L3J A;  5AE2 A;  5A6B D;  3HQ1 A;  4LF4 E;  3I6X A;  3EPL A;  5IXM B;  1J26 A;  4P78 A;  1V5K A;  3THN A;  4OOG C;  2M1S A;  2HKP A;  2E72 A;  3K6Q A;  3ADG A;  5LL6 R;  2LUP B;  1WYM A;  2DMY A;  2EOR A;  3JAK M;  2EN1 A;  2GLI A;  4K0K E;  1A1F A;  2EM9 A;  4BHB A;  2EOY A;  4O24 A;  4FK5 C;  2YZT A;  4JI8 E;  4X64 E;  2LTR A;  4F6N A;  1YSA C;  4JI5 E;  1IBL E;  3KZZ A;  2YRM A;  5A69 A;  4WSG A;  4LU9 A;  2ELZ A;  2EOZ A;  3P1X A;  1X3C A;  2B9D A;  2I13 A;  2JV9 A;  1HNW E;  3T1H E;  4R2A A;  3EAY A;  4MLQ A;  5IV8 B;  3T1Y E;  2EMW A;  2ENH A;  3KY9 A;  1RMD A;  4BBY A;  2LJU A;  1HNZ E;  2EOJ A;  2YT4 A;  2MKN A;  4LFB E;  2WDT A;  2EN7 A;  2ODR C;  2L3C A;  3ADI A;  2JVA A;  2L3G A;  3JAL M;  2EN4 A;  1XNQ E;  2IGP A;  4Q28 A;  1T38 A;  5A6J A;  1PKP A;  4GZN C;  2EN3 A;  1FKA E;  1WYQ A;  2JP9 A;  4Q57 B;  5IWA E;  2R8U A;  4B3M E;  1IMU A;  1RT8 A;  3BGH A;  4M2Z A;  4TXK A;  3IWB A;  2D86 A;  1XMQ E;  2EN2 A;  1IBM E;  2PRT A;  5KL7 A;  3VYX A;  1DXX A;  2YPN A;  5AE1 A;  2JPA A;  2EQO A;  2D88 A;  4DMI A;  4DV2 E;  4LTY A;  4I8O A;  2CSH A;  4Q35 B;  5A6B A;  4DR7 E;  2HHH E;  2HGH A;  2EM5 A;  2V86 A;  1UEG A;  2IHR 1;  2E9K A;  5A2Q C;  4LVR A;  5LMN E;  4JV5 E;  4NXM E;  1PJS A;  2DMI A;  2LUQ A;  2DLQ A;  2GPI A;  1YYO A;  5A36 A;  1EH7 A;  1X6F A;  3OML A;  1WYP A;  4YHH E;  2UU9 E;  2G7H A;  1X47 A;  1X5W A;  2D87 A;  4WX9 A;  3C6M A;  2EZ6 A;  1Z1B A;  3AUZ A;  2EOM A;  2LTS A;  3DF6 A;  1UJO A;  4EDM A;  2EPR A;  4WFT A;  5LMU E;  2EJ4 A;  1AAY A;  2RS6 A;  4BHC A;  2UXC E;  4O43 A;  4DKK A;  2LJH A;  2LT7 A;  2LRS A;  4DV0 E;  4AQY E;  4N4R B;  2EN6 A;  2DB2 A;  2YTP A;  2NA2 A;  1BBG A;  4DDP A;  2EMA A;  4DV7 E;  5T6J A;  2R76 A;  1EUV A;  4BMJ A;  3FER A;  4R2S A;  2L2K B;  1STU A;  2YWQ A;  3J7Y p;  2DRP A;  2EPP A;  2UUC E;  1ZBT A;  2EL5 A;  2EPM X;  3HPZ A;  3VHT B;  3HOP A;  1WXR A;  2JWO A;  3LML A;  2HC5 A;  3RMP A;  1WYO A;  1WRJ A;  2JXP A;  2YTN A;  2FGG A;  2GHF A;  3UK3 C;  2EPU A;  4JYA E;  1IQO A;  2L2M A;  2YTI A;  4JI1 E;  3QG5 C;  5ADZ A;  4KHP E;  4DUY E;  2MC6 A;  3LLH A;  2EMG A;  2LO3 A;  4R2Q A;  2JYA A;  2RR8 A;  2HL8 A;  1FJG E;  4F2J C;  4MLV A;  2UUA E;  1WHN A;  2N3G A;  1YFH A;  2EMB A;  2VE7 C;  2HJJ A;  3M99 B;  2DGC A;  4B3R E;  2YRN A;  3EPH A;  1BB8 A;  2E5L E;  1YPN A;  4DUZ E;  1P2X A;  1F2I G;  2WA5 A;  1PJT A;  4HEI A;  2N3H A;  4F6M A;  1BKR A;  4DV1 E;  1N3G A;  4DR4 E;  3KMW B;  5IT9 C;  4LF6 E;  2WE6 A;  3L00 A;  2LVH A;  2EMC A;  3C4B A;  3C6K A;  4WXD A;  4R8O A;  2V83 A;  2EE8 A;  2EOX A;  2YSP A;  4O4K A;  5J8E A;  1LLM C;  1TN9 A;  2RSM A;  4DR1 E;  2WBU A;  1PXY A;  4NZV A;  2EMX A;  1N34 E;  2QJZ A;  1WYN A;  2LBS B;  1YUI A;  2VZC A;  2RS7 A;  2FTX B;  2WCC 3;  1BHD A;  4J8Z A;  2RQL A;  3OTO E;  1O0W A;  2RPC A;  1DQ3 A;  2QJX A;  4LFC E;  1ZU1 A;  2WA6 A;  2EM2 A;  2YTD A;  2EM3 A;  2EMZ A;  1YYK A;  4B3S E;  3JAR M;  4GKJ E;  2WFN A;  1WJP A;  2ODR D;  1X6E A;  1ZBQ A;  2JOB A;  5BR8 E;  4TUI A;  4DR3 E;  4JI3 E;  3BBG A;  4GEQ B;  4M9V C;  3TQM A;  2KON A;  4F9C B;  5KL4 A;  3J80 C;  4B7L A;  4DV4 E;  2LV2 A;  3J7A G;  2EM0 A;  2EPO A;  2BB8 A;  3ECR A;  3MHH C;  1X48 A;  3VYY A;  1VKA A;  4BS9 A;  1KYQ A;  1X6H A;  1X49 A;  2V85 A;  1MEY C;  4R2D A;  2K3S A;  2YTQ A;  2EN8 A;  1T39 A;  1N32 E;  1I94 E;  2BBG A;  2EQ0 A;  3HOR A;  2EOQ A;  2YTG A;  1IBK E;  5KL6 A;  4Q59 A;  4TUG A;  4R03 A;  5TSE A;  2VZD A;  2M4I A;  1YZ9 A;  2EPN A;  1WIX A;  1WYR A;  1WKU A;  2ELY A;  2EOF A;  1JK1 A;  4M0V A;  3DJW A;  2A25 A;  2D89 A;  3HPS A;  1P5S A;  2DLK A;  1UBD C;  3BID A;  2YU5 A;  2D9H A;  1EKZ A;  1MGT A;  4F54 A;  2EL6 A;  2EMF A;  2EMI A;  5KL2 A;  2L8T A;  3KZY A;  4DR6 E;  2KHX A;  1HNX E;  3VP7 A;  2K2R A;  2YRH A;  4ZYD A;  2JOX A;  1A1L A;  2FV4 B;  1G2D C;  1PA7 A;  3EQ1 A;  4WYQ B;  3JTZ A;  1RQ0 A;  2H36 X;  3HTX A;  4EDL A;  5L0O A;  2V87 A;  3VK6 A;  1BBO A;  4NHR A;  4JI6 E;  2DIX A;  1IQS A;  1UHZ A;  2EMH A;  2YRK A;  2M7Q A;  4R2C A;  1GTK A;  4ZYH A;  5A6K A;  2B3T B;  1DGC A;  4HTG A;  4X8W A;  3BF2 A;  2EOH A;  2LMZ A;  4ZYG A;  2B7V A;  3AV0 A;  4BC7 A;  2UUB E;  2MC5 A;  3J81 C;  4TXI A;  4L8N A;  1QU6 A;  4IJD A;  2D85 A;  4LFA E;  3MHS C;  2DK9 A;  2HL9 A;  4KZS A;  4B3T E;  1J5E E;  1EH8 A;  2VF1 A;  2WBT A;  1A1J A;  2EOI A;  1DI2 A;  1H67 A;  1WHQ A;  1P47 A;  1NCS A;  3ADL A;  5CFF E;  1WYL A;  4BC9 A;  1SFE A;  4NXN E;  3ADJ A;  1B69 A;  1SR9 A;  5A38 A;  3F7P A;  2YU8 A;  3JAM C;  1TF3 A;  1N33 E;  2EMK A;  5AC5 A;  4R2R A;  2R0O A;  3REP B;  1GZ6 A;  4EDN A;  1QAG A;  1ZR9 A;  2KOU A;  1T4N A;  2VQE E;  2CPN A;  2EOS A;  2EP3 A;  2EM7 A;  2V8Q B;  2ENA A;  2EM6 A;  2EE7 A;  4DV5 E;  4X65 E;  2EPZ A;  3JU0 A;  5KL3 A;  1PJQ A;  2EQ3 A;  2DSY A;  2L6M A;  1G2F C;  4DV6 E;  1JK2 A;  1YYW A;  3ZOQ B;  2EM4 A;  2RSI A; 
#chains in the Genus database with same CATH homology
 2L92 A;  4OX9 E;  1T4L B;  2NUG A;  4LF8 E;  4JI2 E;  1HR0 E;  2F4V E;  4F9B B;  4LF5 E;  1XNR E;  3IWD A;  2EWL A;  2V88 A;  5FMU A;  4WSP A;  1RC7 A;  4P7D A;  4DR5 E;  3MSW A;  3H09 A;  4L5N C;  3F6G A;  3HXL A;  4JI4 E;  4DR2 E;  2K4V A;  4LVP A;  2UXD E;  5FMT A;  3F6H A;  2MDR A;  2V89 A;  3FIG A;  2B7T A;  2UXB E;  2RTX A;  2VQF E;  1XMO E;  2VE7 A;  1UIL A;  4F9A B;  2L33 A;  2ZM6 E;  4X66 E;  5AE3 A;  5DNY A;  2LE2 A;  4BCA A;  4LF9 E;  4GKK E;  3C4T A;  4LF7 E;  4M30 A;  2JY9 A;  4JI0 E;  3KWR A;  2NUE A;  1T4O A;  4JI7 E;  2WZO A;  5FLX C;  2JR1 A;  5AAS A;  2NUF A;  2F8B A;  4WPY A;  4DV3 E;  4X62 E;  2E1M A;  2L2N A;  1N36 E;  1GQE A;  3IWC A;  4YY3 E;  5F3W A;  2L3J A;  5AE2 A;  3HQ1 A;  4LF4 E;  1J26 A;  4P78 A;  4OOG C;  2M1S A;  2HKP A;  3K6Q A;  3ADG A;  5LL6 R;  2LUP B;  2DMY A;  4K0K E;  2YZT A;  4JI8 E;  4X64 E;  2LTR A;  4JI5 E;  1IBL E;  4LU9 A;  3P1X A;  2B9D A;  1HNW E;  3T1H E;  3EAY A;  3T1Y E;  4BBY A;  1HNZ E;  2YT4 A;  4LFB E;  2WDT A;  2L3C A;  2ODR C;  3ADI A;  2JVA A;  1XNQ E;  2IGP A;  4Q28 A;  1PKP A;  1FKA E;  5IWA E;  4B3M E;  4M2Z A;  3IWB A;  1XMQ E;  1IBM E;  3VYX A;  5AE1 A;  2EQO A;  4DMI A;  4DV2 E;  4LTY A;  4I8O A;  4DR7 E;  2HHH E;  2V86 A;  2IHR 1;  5A2Q C;  4LVR A;  5LMN E;  4JV5 E;  4NXM E;  1YYO A;  2LUQ A;  3OML A;  4YHH E;  2UU9 E;  2G7H A;  1X47 A;  2EZ6 A;  3AUZ A;  2LTS A;  3DF6 A;  4WFT A;  5LMU E;  2RS6 A;  2UXC E;  4DKK A;  2LJH A;  2LRS A;  4DV0 E;  4AQY E;  2DB2 A;  2NA2 A;  4DDP A;  4DV7 E;  5T6J A;  1EUV A;  4BMJ A;  2L2K B;  1STU A;  3J7Y p;  2UUC E;  1ZBT A;  3HPZ A;  1WXR A;  2JWO A;  3LML A;  3RMP A;  2FGG A;  4JYA E;  2L2M A;  4JI1 E;  5ADZ A;  4KHP E;  4DUY E;  2MC6 A;  3LLH A;  2HL8 A;  1FJG E;  2UUA E;  1WHN A;  2N3G A;  2VE7 C;  4B3R E;  2E5L E;  4DUZ E;  2N3H A;  4DV1 E;  4DR4 E;  5IT9 C;  4LF6 E;  2WE6 A;  3C4B A;  4R8O A;  2V83 A;  2RSM A;  4DR1 E;  1N34 E;  2LBS B;  2RS7 A;  2FTX B;  4J8Z A;  3OTO E;  1O0W A;  1DQ3 A;  4LFC E;  1YYK A;  4B3S E;  4GKJ E;  4TUI A;  1ZBQ A;  2ODR D;  2JOB A;  5BR8 E;  4JI3 E;  4DR3 E;  4GEQ B;  2KON A;  4F9C B;  3J80 C;  4DV4 E;  3J7A G;  1X48 A;  3VYY A;  4BS9 A;  1X49 A;  2V85 A;  1N32 E;  1I94 E;  1IBK E;  4TUG A;  4R03 A;  2M4I A;  1YZ9 A;  4M0V A;  3DJW A;  3HPS A;  1EKZ A;  4F54 A;  2L8T A;  4DR6 E;  2KHX A;  1HNX E;  3VP7 A;  2JOX A;  2FV4 B;  4WYQ B;  3JTZ A;  1RQ0 A;  2H36 X;  3HTX A;  2V87 A;  3VK6 A;  4JI6 E;  2DIX A;  1UHZ A;  2M7Q A;  2B3T B;  4X8W A;  2LMZ A;  2B7V A;  3AV0 A;  4BC7 A;  2UUB E;  2MC5 A;  3J81 C;  4L8N A;  1QU6 A;  4LFA E;  2HL9 A;  4KZS A;  4B3T E;  1J5E E;  2VF1 A;  1DI2 A;  1WHQ A;  3ADL A;  5CFF E;  4BC9 A;  4NXN E;  3ADJ A;  1SR9 A;  3JAM C;  1N33 E;  1GZ6 A;  2KOU A;  1T4N A;  2VQE E;  2CPN A;  2V8Q B;  4DV5 E;  4X65 E;  3JU0 A;  2DSY A;  2L6M A;  4DV6 E;  1YYW A;  3ZOQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...