3CO1A

Crystal structure of microtubule binding domain of human eb3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
GSMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 3
publication title Mammalian end binding proteins control persistent microtubule growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 3co1A00
1AA2A 1QAGA 1PXYA 5A37A 1TJTA 2D87A 3HOCA 3KMUB 1WJOA 2VZGB 1MB8A 3HOPA 2QJXA 4Q59A 1SH6A 1WYOA 3F7PA 2D88A 2K2RA 4EDMA 3CO1A 1WKUA 2K3SA 5A38A 5L0OA 2D86A 1PA7A 1V5KA 2VZIB 2D85A 1SH5A 3KMWB 4EDNA 3KY9A 1WYLA 2YRNA 3JALM 3FERA 2VZCA 5BVRA 4TXIA 3HORA 2QJZA 2E9KA 2WFNA 2RR8A 1WYRA 4Q57B 2WA6A 3I6XA 1WYNA 1WYMA 1VKAA 1UJOA 3REPB 1BHDA 2VZDA 1WIXA 2L3GA 2EE7A 2WA5A 3JARM 1BKRA 4TXKA 1WYPA 1AOAA 2DK9A 1DXXA 4EDLA 1P5SA 5J8EA 1UEGA 2EYIA 5A4BA 2JV9A 2D89A 2EYNA 3JAKM 2R0OA 1RT8A 2R8UA 2WA7A 4B7LA 4Q58A 1P2XA 1H67A 1WYQA 5A36A
chains in the Genus database with same CATH superfamily
1AA2A 2VE7A 1QAGA 1PXYA 2WDTA 1TJTA 5A37A 2D87A 3HOCA 3KMUB 1WJOA 2VZGB 1MB8A 3HOPA 2QJXA 5FMTA 4Q59A 1SH6A 1WYOA 3F7PA 2D88A 2K2RA 4EDMA 3CO1A 1WKUA 2IGPA 2K3SA 5A38A 5L0OA 2D86A 1PA7A 2HL9A 1V5KA 2VZIB 2D85A 1SH5A 3KMWB 4EDNA 3KY9A 1WYLA 2YRNA 3JALM 4LVPA 2WE6A 3FERA 2VZCA 5BVRA 4TXIA 3HORA 3EAYA 5FMUA 2QJZA 2E9KA 2WFNA 2RR8A 1WYRA 4Q57B 2WA6A 3I6XA 1WYNA 1WYMA 1VKAA 1UJOA 3REPB 1BHDA 2VZDA 1WIXA 2L3GA 2EE7A 2WA5A 3JARM 1BKRA 4TXKA 1WYPA 1AOAA 2DK9A 1DXXA 4EDLA 1P5SA 5J8EA 1UEGA 2EYIA 5A4BA 2JV9A 2VE7C 2D89A 2EQOA 4LVRA 2EYNA 2HKPA 3JAKM 3VP7A 2R0OA 1RT8A 2R8UA 1EUVA 2WA7A 2HL8A 4B7LA 4DDPA 4Q58A 1P2XA 1H67A 1WYQA 5A36A
chains in the Genus database with same CATH topology
1AA2A 1QAGA 1PXYA 5A37A 1TJTA 2D87A 3HOCA 3KMUB 1WJOA 2VZGB 1MB8A 3HOPA 2QJXA 4Q59A 1SH6A 1WYOA 3F7PA 2D88A 2K2RA 4EDMA 3CO1A 1WKUA 2K3SA 5A38A 5L0OA 2D86A 1PA7A 1V5KA 2VZIB 2D85A 1SH5A 3KMWB 4EDNA 3KY9A 1WYLA 2YRNA 3JALM 3FERA 2VZCA 5BVRA 4TXIA 3HORA 2QJZA 2E9KA 2WFNA 2RR8A 1WYRA 4Q57B 2WA6A 3I6XA 1WYNA 1WYMA 1VKAA 1UJOA 3REPB 1BHDA 2VZDA 1WIXA 2L3GA 2EE7A 2WA5A 3JARM 1BKRA 4TXKA 1WYPA 1AOAA 2DK9A 1DXXA 4EDLA 1P5SA 5J8EA 1UEGA 2EYIA 5A4BA 2JV9A 2D89A 2EYNA 3JAKM 2R0OA 1RT8A 2R8UA 2WA7A 4B7LA 4Q58A 1P2XA 1H67A 1WYQA 5A36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA2 A;  1QAG A;  1PXY A;  5A37 A;  1TJT A;  2D87 A;  3HOC A;  3KMU B;  1WJO A;  2VZG B;  1MB8 A;  3HOP A;  2QJX A;  4Q59 A;  1SH6 A;  1WYO A;  3F7P A;  2D88 A;  2K2R A;  4EDM A;  3CO1 A;  1WKU A;  2K3S A;  5A38 A;  5L0O A;  2D86 A;  1PA7 A;  1V5K A;  2VZI B;  2D85 A;  1SH5 A;  3KMW B;  4EDN A;  3KY9 A;  1WYL A;  2YRN A;  3JAL M;  3FER A;  2VZC A;  5BVR A;  4TXI A;  3HOR A;  2QJZ A;  2E9K A;  2WFN A;  2RR8 A;  1WYR A;  4Q57 B;  2WA6 A;  3I6X A;  1WYN A;  1WYM A;  1VKA A;  1UJO A;  3REP B;  1BHD A;  2VZD A;  1WIX A;  2L3G A;  2EE7 A;  2WA5 A;  3JAR M;  1BKR A;  4TXK A;  1WYP A;  1AOA A;  2DK9 A;  1DXX A;  4EDL A;  1P5S A;  5J8E A;  1UEG A;  2EYI A;  5A4B A;  2JV9 A;  2D89 A;  2EYN A;  3JAK M;  2R0O A;  1RT8 A;  2R8U A;  2WA7 A;  4B7L A;  4Q58 A;  1P2X A;  1H67 A;  1WYQ A;  5A36 A; 
#chains in the Genus database with same CATH topology
 1AA2 A;  2VE7 A;  1QAG A;  1PXY A;  2WDT A;  1TJT A;  5A37 A;  2D87 A;  3HOC A;  3KMU B;  1WJO A;  2VZG B;  1MB8 A;  3HOP A;  2QJX A;  5FMT A;  4Q59 A;  1SH6 A;  1WYO A;  3F7P A;  2D88 A;  2K2R A;  4EDM A;  3CO1 A;  1WKU A;  2IGP A;  2K3S A;  5A38 A;  5L0O A;  2D86 A;  1PA7 A;  2HL9 A;  1V5K A;  2VZI B;  2D85 A;  1SH5 A;  3KMW B;  4EDN A;  3KY9 A;  1WYL A;  2YRN A;  3JAL M;  4LVP A;  2WE6 A;  3FER A;  2VZC A;  5BVR A;  4TXI A;  3HOR A;  3EAY A;  5FMU A;  2QJZ A;  2E9K A;  2WFN A;  2RR8 A;  1WYR A;  4Q57 B;  2WA6 A;  3I6X A;  1WYN A;  1WYM A;  1VKA A;  1UJO A;  3REP B;  1BHD A;  2VZD A;  1WIX A;  2L3G A;  2EE7 A;  2WA5 A;  3JAR M;  1BKR A;  4TXK A;  1WYP A;  1AOA A;  2DK9 A;  1DXX A;  4EDL A;  1P5S A;  5J8E A;  1UEG A;  2EYI A;  5A4B A;  2JV9 A;  2VE7 C;  2D89 A;  2EQO A;  4LVR A;  2EYN A;  2HKP A;  3JAK M;  3VP7 A;  2R0O A;  1RT8 A;  2R8U A;  1EUV A;  2WA7 A;  2HL8 A;  4B7L A;  4DDP A;  4Q58 A;  1P2X A;  1H67 A;  1WYQ A;  5A36 A; 
#chains in the Genus database with same CATH homology
 1AA2 A;  1QAG A;  1PXY A;  5A37 A;  1TJT A;  2D87 A;  3HOC A;  3KMU B;  1WJO A;  2VZG B;  1MB8 A;  3HOP A;  2QJX A;  4Q59 A;  1SH6 A;  1WYO A;  3F7P A;  2D88 A;  2K2R A;  4EDM A;  3CO1 A;  1WKU A;  2K3S A;  5A38 A;  5L0O A;  2D86 A;  1PA7 A;  1V5K A;  2VZI B;  2D85 A;  1SH5 A;  3KMW B;  4EDN A;  3KY9 A;  1WYL A;  2YRN A;  3JAL M;  3FER A;  2VZC A;  5BVR A;  4TXI A;  3HOR A;  2QJZ A;  2E9K A;  2WFN A;  2RR8 A;  1WYR A;  4Q57 B;  2WA6 A;  3I6X A;  1WYN A;  1WYM A;  1VKA A;  1UJO A;  3REP B;  1BHD A;  2VZD A;  1WIX A;  2L3G A;  2EE7 A;  2WA5 A;  3JAR M;  1BKR A;  4TXK A;  1WYP A;  1AOA A;  2DK9 A;  1DXX A;  4EDL A;  1P5S A;  5J8E A;  1UEG A;  2EYI A;  5A4B A;  2JV9 A;  2D89 A;  2EYN A;  3JAK M;  2R0O A;  1RT8 A;  2R8U A;  2WA7 A;  4B7L A;  4Q58 A;  1P2X A;  1H67 A;  1WYQ A;  5A36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...