1WYQA

Solution structure of the second ch domain of human spectrin beta chain, brain 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
GSSGSSGAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin beta chain, brain 2
publication title Solution structure of the second CH domain of human spectrin beta chain, brain 2
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1wyqA01
2VZIB 3CO1A 1WYQA 2L3GA 1SH6A 2D88A 3I6XA 1PXYA 1H67A 2YRNA 3HOPA 3JALM 1P5SA 2K3SA 1UEGA 2VZGB 2WA5A 5A36A 2VZCA 4EDLA 2R8UA 4TXIA 4Q58A 2D89A 4B7LA 1BKRA 2VZDA 5A38A 1WYLA 1AA2A 3FERA 1WYNA 2D86A 1WYOA 2K2RA 1BHDA 2WA7A 5A37A 3HORA 1TJTA 1WJOA 1WYRA 2QJXA 5L0OA 4EDMA 1WIXA 2EYIA 3KMWB 3HOCA 2JV9A 4EDNA 2EE7A 1DXXA 2WA6A 1SH5A 2EYNA 1MB8A 3JAKM 1QAGA 1WKUA 3KY9A 1PA7A 1AOAA 4Q57B 5J8EA 1V5KA 1P2XA 4TXKA 2DK9A 5A4BA 3REPB 1RT8A 2D85A 2E9KA 5BVRA 3KMUB 1VKAA 2WFNA 2R0OA 2QJZA 3JARM 2D87A 1UJOA 1WYMA 2RR8A 3F7PA 4Q59A 1WYPA
chains in the Genus database with same CATH superfamily
2VZIB 3CO1A 2HKPA 1WYQA 2L3GA 1SH6A 2D88A 3I6XA 1PXYA 1H67A 2WDTA 2YRNA 3HOPA 3JALM 1P5SA 2K3SA 1UEGA 2VZGB 2WA5A 5A36A 2VZCA 4EDLA 2R8UA 4LVPA 4TXIA 4Q58A 2D89A 4B7LA 1BKRA 2VZDA 5A38A 1WYLA 1AA2A 4LVRA 3FERA 1WYNA 2D86A 1WYOA 2K2RA 3EAYA 1BHDA 2WA7A 4DDPA 2IGPA 5A37A 3HORA 3VP7A 1TJTA 1WJOA 1WYRA 2QJXA 5L0OA 4EDMA 1WIXA 2HL8A 2EYIA 2HL9A 3KMWB 3HOCA 2JV9A 4EDNA 2EE7A 1DXXA 1EUVA 2WA6A 1SH5A 2EYNA 1MB8A 3JAKM 1QAGA 1WKUA 3KY9A 1PA7A 1AOAA 4Q57B 2VE7C 5FMTA 5J8EA 2WE6A 1V5KA 1P2XA 4TXKA 2DK9A 5A4BA 3REPB 1RT8A 2D85A 2E9KA 5BVRA 3KMUB 5FMUA 1VKAA 2WFNA 2R0OA 2QJZA 2VE7A 3JARM 2EQOA 2D87A 1UJOA 1WYMA 2RR8A 3F7PA 4Q59A 1WYPA
chains in the Genus database with same CATH topology
2VZIB 3CO1A 1WYQA 2L3GA 1SH6A 2D88A 3I6XA 1PXYA 1H67A 2YRNA 3HOPA 3JALM 1P5SA 2K3SA 1UEGA 2VZGB 2WA5A 5A36A 2VZCA 4EDLA 2R8UA 4TXIA 4Q58A 2D89A 4B7LA 1BKRA 2VZDA 5A38A 1WYLA 1AA2A 3FERA 1WYNA 2D86A 1WYOA 2K2RA 1BHDA 2WA7A 5A37A 3HORA 1TJTA 1WJOA 1WYRA 2QJXA 5L0OA 4EDMA 1WIXA 2EYIA 3KMWB 3HOCA 2JV9A 4EDNA 2EE7A 1DXXA 2WA6A 1SH5A 2EYNA 1MB8A 3JAKM 1QAGA 1WKUA 3KY9A 1PA7A 1AOAA 4Q57B 5J8EA 1V5KA 1P2XA 4TXKA 2DK9A 5A4BA 3REPB 1RT8A 2D85A 2E9KA 5BVRA 3KMUB 1VKAA 2WFNA 2R0OA 2QJZA 3JARM 2D87A 1UJOA 1WYMA 2RR8A 3F7PA 4Q59A 1WYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZI B;  3CO1 A;  1WYQ A;  2L3G A;  1SH6 A;  2D88 A;  3I6X A;  1PXY A;  1H67 A;  2YRN A;  3HOP A;  3JAL M;  1P5S A;  2K3S A;  1UEG A;  2VZG B;  2WA5 A;  5A36 A;  2VZC A;  4EDL A;  2R8U A;  4TXI A;  4Q58 A;  2D89 A;  4B7L A;  1BKR A;  2VZD A;  5A38 A;  1WYL A;  1AA2 A;  3FER A;  1WYN A;  2D86 A;  1WYO A;  2K2R A;  1BHD A;  2WA7 A;  5A37 A;  3HOR A;  1TJT A;  1WJO A;  1WYR A;  2QJX A;  5L0O A;  4EDM A;  1WIX A;  2EYI A;  3KMW B;  3HOC A;  2JV9 A;  4EDN A;  2EE7 A;  1DXX A;  2WA6 A;  1SH5 A;  2EYN A;  1MB8 A;  3JAK M;  1QAG A;  1WKU A;  3KY9 A;  1PA7 A;  1AOA A;  4Q57 B;  5J8E A;  1V5K A;  1P2X A;  4TXK A;  2DK9 A;  5A4B A;  3REP B;  1RT8 A;  2D85 A;  2E9K A;  5BVR A;  3KMU B;  1VKA A;  2WFN A;  2R0O A;  2QJZ A;  3JAR M;  2D87 A;  1UJO A;  1WYM A;  2RR8 A;  3F7P A;  4Q59 A;  1WYP A; 
#chains in the Genus database with same CATH topology
 2VZI B;  3CO1 A;  2HKP A;  1WYQ A;  2L3G A;  1SH6 A;  2D88 A;  3I6X A;  1PXY A;  1H67 A;  2WDT A;  2YRN A;  3HOP A;  3JAL M;  1P5S A;  2K3S A;  1UEG A;  2VZG B;  2WA5 A;  5A36 A;  2VZC A;  4EDL A;  2R8U A;  4LVP A;  4TXI A;  4Q58 A;  2D89 A;  4B7L A;  1BKR A;  2VZD A;  5A38 A;  1WYL A;  1AA2 A;  4LVR A;  3FER A;  1WYN A;  2D86 A;  1WYO A;  2K2R A;  3EAY A;  1BHD A;  2WA7 A;  4DDP A;  2IGP A;  5A37 A;  3HOR A;  3VP7 A;  1TJT A;  1WJO A;  1WYR A;  2QJX A;  5L0O A;  4EDM A;  1WIX A;  2HL8 A;  2EYI A;  2HL9 A;  3KMW B;  3HOC A;  2JV9 A;  4EDN A;  2EE7 A;  1DXX A;  1EUV A;  2WA6 A;  1SH5 A;  2EYN A;  1MB8 A;  3JAK M;  1QAG A;  1WKU A;  3KY9 A;  1PA7 A;  1AOA A;  4Q57 B;  2VE7 C;  5FMT A;  5J8E A;  2WE6 A;  1V5K A;  1P2X A;  4TXK A;  2DK9 A;  5A4B A;  3REP B;  1RT8 A;  2D85 A;  2E9K A;  5BVR A;  3KMU B;  5FMU A;  1VKA A;  2WFN A;  2R0O A;  2QJZ A;  2VE7 A;  3JAR M;  2EQO A;  2D87 A;  1UJO A;  1WYM A;  2RR8 A;  3F7P A;  4Q59 A;  1WYP A; 
#chains in the Genus database with same CATH homology
 2VZI B;  3CO1 A;  1WYQ A;  2L3G A;  1SH6 A;  2D88 A;  3I6X A;  1PXY A;  1H67 A;  2YRN A;  3HOP A;  3JAL M;  1P5S A;  2K3S A;  1UEG A;  2VZG B;  2WA5 A;  5A36 A;  2VZC A;  4EDL A;  2R8U A;  4TXI A;  4Q58 A;  2D89 A;  4B7L A;  1BKR A;  2VZD A;  5A38 A;  1WYL A;  1AA2 A;  3FER A;  1WYN A;  2D86 A;  1WYO A;  2K2R A;  1BHD A;  2WA7 A;  5A37 A;  3HOR A;  1TJT A;  1WJO A;  1WYR A;  2QJX A;  5L0O A;  4EDM A;  1WIX A;  2EYI A;  3KMW B;  3HOC A;  2JV9 A;  4EDN A;  2EE7 A;  1DXX A;  2WA6 A;  1SH5 A;  2EYN A;  1MB8 A;  3JAK M;  1QAG A;  1WKU A;  3KY9 A;  1PA7 A;  1AOA A;  4Q57 B;  5J8E A;  1V5K A;  1P2X A;  4TXK A;  2DK9 A;  5A4B A;  3REP B;  1RT8 A;  2D85 A;  2E9K A;  5BVR A;  3KMU B;  1VKA A;  2WFN A;  2R0O A;  2QJZ A;  3JAR M;  2D87 A;  1UJO A;  1WYM A;  2RR8 A;  3F7P A;  4Q59 A;  1WYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...