The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
MGHHHHHHMGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSELQGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of calponin homology domain of Human MICAL-1
pubmed doi rcsb |
| molecule keywords |
NEDD9-interacting protein with calponin homology and LIM dom
|
| molecule tags |
Signaling protein
|
| source organism |
Homo sapiens
|
| total genus |
31
|
| structure length |
118
|
| sequence length |
118
|
| ec nomenclature |
ec
1.14.13.225: F-actin monooxygenase. |
| pdb deposition date | 2006-04-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00307 | CH | Calponin homology (CH) domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Actin-binding Protein, T-fimbrin; domain 1 | Calponin-like domain |
#chains in the Genus database with same CATH superfamily 1TJT A; 2VZG B; 1P5S A; 1MB8 A; 3JAR M; 4TXK A; 4Q58 A; 2QJZ A; 1PA7 A; 4Q59 A; 1WIX A; 2EYI A; 1UJO A; 5J8E A; 1WYL A; 3F7P A; 1AA2 A; 1DXX A; 1PXY A; 4Q57 B; 3FER A; 1P2X A; 2WA7 A; 3HOC A; 3KY9 A; 1H67 A; 1WYQ A; 5A38 A; 2RR8 A; 1WYR A; 3JAK M; 2EE7 A; 5A37 A; 2L3G A; 2VZC A; 5BVR A; 2K2R A; 2JV9 A; 3HOR A; 1QAG A; 1BKR A; 2YRN A; 3CO1 A; 2E9K A; 3JAL M; 2D85 A; 1VKA A; 1V5K A; 2EYN A; 2K3S A; 5L0O A; 2VZD A; 1SH5 A; 2D89 A; 4B7L A; 3KMW B; 3REP B; 2QJX A; 4EDN A; 3KMU B; 3HOP A; 2VZI B; 1WJO A; 2WA6 A; 1WYO A; 2D86 A; 2R8U A; 2WFN A; 5A4B A; 1SH6 A; 4EDL A; 2D87 A; 1WYP A; 1WKU A; 5A36 A; 1RT8 A; 3I6X A; 2DK9 A; 1AOA A; 2R0O A; 1WYN A; 1UEG A; 4TXI A; 4EDM A; 1WYM A; 1BHD A; 2WA5 A; 2D88 A; #chains in the Genus database with same CATH topology 1TJT A; 2VZG B; 2VE7 A; 1P5S A; 1MB8 A; 2HL8 A; 3JAR M; 4TXK A; 4Q58 A; 2QJZ A; 1PA7 A; 4Q59 A; 1WIX A; 2EYI A; 1UJO A; 5J8E A; 1WYL A; 3VP7 A; 3F7P A; 1AA2 A; 2HL9 A; 4LVR A; 1DXX A; 1PXY A; 4Q57 B; 3FER A; 5FMT A; 1P2X A; 2WA7 A; 3HOC A; 3KY9 A; 1H67 A; 1WYQ A; 5A38 A; 2RR8 A; 1WYR A; 3JAK M; 2EE7 A; 5A37 A; 2L3G A; 2VZC A; 5BVR A; 2K2R A; 2JV9 A; 3HOR A; 1QAG A; 1BKR A; 2WE6 A; 2YRN A; 3CO1 A; 2E9K A; 3JAL M; 2D85 A; 4LVP A; 1VKA A; 1V5K A; 2EYN A; 3EAY A; 2IGP A; 2K3S A; 5L0O A; 2VZD A; 1SH5 A; 2D89 A; 4B7L A; 3KMW B; 2EQO A; 3REP B; 2QJX A; 4EDN A; 3KMU B; 3HOP A; 2VZI B; 1WJO A; 2WA6 A; 1WYO A; 2D86 A; 2R8U A; 2WFN A; 5A4B A; 1SH6 A; 4EDL A; 2D87 A; 1WYP A; 1WKU A; 5A36 A; 1RT8 A; 2HKP A; 2DK9 A; 3I6X A; 2VE7 C; 1AOA A; 2R0O A; 1WYN A; 1UEG A; 4TXI A; 4DDP A; 5FMU A; 4EDM A; 1EUV A; 1WYM A; 1BHD A; 2WA5 A; 2D88 A; 2WDT A; #chains in the Genus database with same CATH homology 1TJT A; 2VZG B; 1P5S A; 1MB8 A; 3JAR M; 4TXK A; 4Q58 A; 2QJZ A; 1PA7 A; 4Q59 A; 1WIX A; 2EYI A; 1UJO A; 5J8E A; 1WYL A; 3F7P A; 1AA2 A; 1DXX A; 1PXY A; 4Q57 B; 3FER A; 1P2X A; 2WA7 A; 3HOC A; 3KY9 A; 1H67 A; 1WYQ A; 5A38 A; 2RR8 A; 1WYR A; 3JAK M; 2EE7 A; 5A37 A; 2L3G A; 2VZC A; 5BVR A; 2K2R A; 2JV9 A; 3HOR A; 1QAG A; 1BKR A; 2YRN A; 3CO1 A; 2E9K A; 3JAL M; 2D85 A; 1VKA A; 1V5K A; 2EYN A; 2K3S A; 5L0O A; 2VZD A; 1SH5 A; 2D89 A; 4B7L A; 3KMW B; 3REP B; 2QJX A; 4EDN A; 3KMU B; 3HOP A; 2VZI B; 1WJO A; 2WA6 A; 1WYO A; 2D86 A; 2R8U A; 2WFN A; 5A4B A; 1SH6 A; 4EDL A; 2D87 A; 1WYP A; 1WKU A; 5A36 A; 1RT8 A; 3I6X A; 2DK9 A; 1AOA A; 2R0O A; 1WYN A; 1UEG A; 4TXI A; 4EDM A; 1WYM A; 1BHD A; 2WA5 A; 2D88 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...