The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
140
|
structure length |
140
|
Chain Sequence |
GSSGSSGMNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKSDNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLSSDDAVRRVLAGEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
source organism |
Homo sapiens
|
publication title |
Solution structure of the stn_TRAF3IP1_nd domain of interleukin 13 receptor alpha 1-binding protein-1 [Homo sapiens]
rcsb |
molecule keywords |
TNF receptor-associated factor 3-interacting protein 1
|
total genus |
30
|
structure length |
140
|
sequence length |
140
|
ec nomenclature | |
pdb deposition date | 2007-03-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10243 | MIP-T3 | Microtubule-binding protein MIP-T3 CH-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Actin-binding Protein, T-fimbrin; domain 1 | Actin-binding Protein, T-fimbrin; domain 1 |
#chains in the Genus database with same CATH superfamily 5FMT A; 2EQO A; 5FMU A; #chains in the Genus database with same CATH topology 1RT8 A; 3HOC A; 4LVR A; 1QAG A; 5J8E A; 1EUV A; 3KY9 A; 2JV9 A; 2R8U A; 4EDM A; 1WYQ A; 3HOP A; 1SH6 A; 2WFN A; 1WKU A; 2HKP A; 3KMU B; 2D89 A; 2D86 A; 1VKA A; 2WDT A; 2R0O A; 2E9K A; 2VE7 C; 2WA5 A; 1PA7 A; 1MB8 A; 1WYP A; 1UJO A; 2D88 A; 2DK9 A; 1H67 A; 1WYM A; 2WE6 A; 1UEG A; 3JAL M; 2K2R A; 1WJO A; 4LVP A; 1WYL A; 1V5K A; 5A36 A; 1P2X A; 2EYI A; 5BVR A; 1BHD A; 2EYN A; 5FMT A; 2HL9 A; 2QJZ A; 2L3G A; 1BKR A; 4Q58 A; 4DDP A; 2VZC A; 1AOA A; 5A37 A; 2YRN A; 2WA7 A; 1P5S A; 3JAR M; 5FMU A; 2K3S A; 3I6X A; 3VP7 A; 5A4B A; 2RR8 A; 2VZG B; 3REP B; 2WA6 A; 2HL8 A; 2IGP A; 1PXY A; 1SH5 A; 1WYR A; 3KMW B; 2D87 A; 4B7L A; 4Q59 A; 1DXX A; 1WYO A; 3JAK M; 2QJX A; 3HOR A; 2EE7 A; 4Q57 B; 5L0O A; 2VZD A; 2VE7 A; 3CO1 A; 4TXK A; 1AA2 A; 2D85 A; 5A38 A; 3EAY A; 3FER A; 1WIX A; 2EQO A; 4TXI A; 4EDL A; 1WYN A; 4EDN A; 2VZI B; 3F7P A; 1TJT A; #chains in the Genus database with same CATH homology 2WE6 A; 3VP7 A; 2VE7 C; 1EUV A; 2VE7 A; 2WDT A; 3EAY A; 2HL8 A; 2IGP A; 2EQO A; 5FMU A; 4DDP A; 4LVP A; 5FMT A; 2HKP A; 4LVR A; 2HL9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...