The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
140
|
structure length |
140
|
Chain Sequence |
GSSGSSGMNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKSDNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLSSDDAVRRVLAGEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution structure of the stn_TRAF3IP1_nd domain of interleukin 13 receptor alpha 1-binding protein-1 [Homo sapiens]
rcsb |
molecule tags |
Transcription
|
source organism |
Homo sapiens
|
molecule keywords |
TNF receptor-associated factor 3-interacting protein 1
|
total genus |
30
|
structure length |
140
|
sequence length |
140
|
ec nomenclature | |
pdb deposition date | 2007-03-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10243 | MIP-T3 | Microtubule-binding protein MIP-T3 CH-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Actin-binding Protein, T-fimbrin; domain 1 | Actin-binding Protein, T-fimbrin; domain 1 |
#chains in the Genus database with same CATH superfamily 2EQO A; 5FMT A; 5FMU A; #chains in the Genus database with same CATH topology 3F7P A; 1H67 A; 3HOP A; 5FMT A; 2VE7 A; 3HOC A; 2D87 A; 4Q57 B; 1PXY A; 2YRN A; 1WYR A; 2HL8 A; 4Q59 A; 2QJZ A; 1WYL A; 4TXK A; 2DK9 A; 4LVP A; 2EYN A; 3KY9 A; 2WA5 A; 1UJO A; 1VKA A; 4LVR A; 2EE7 A; 1WIX A; 1SH6 A; 4EDM A; 3EAY A; 3KMW B; 1TJT A; 5J8E A; 4DDP A; 2D88 A; 4EDL A; 4TXI A; 5A4B A; 3JAR M; 2IGP A; 2WA6 A; 2WE6 A; 1WYP A; 2QJX A; 5FMU A; 2D86 A; 2VZI B; 1AA2 A; 1PA7 A; 3VP7 A; 5BVR A; 1BKR A; 3HOR A; 5A37 A; 3CO1 A; 2R0O A; 3FER A; 2E9K A; 1MB8 A; 1SH5 A; 1V5K A; 1WYQ A; 2WA7 A; 3JAK M; 4Q58 A; 1AOA A; 1P5S A; 2WDT A; 2EQO A; 4B7L A; 2HKP A; 2VZC A; 1UEG A; 1RT8 A; 2EYI A; 1QAG A; 2VZG B; 2D85 A; 3REP B; 3JAL M; 1WKU A; 3KMU B; 4EDN A; 1P2X A; 5L0O A; 1EUV A; 2HL9 A; 3I6X A; 1BHD A; 2K2R A; 2WFN A; 2JV9 A; 1WYN A; 2K3S A; 2L3G A; 1DXX A; 2VE7 C; 2R8U A; 2RR8 A; 5A38 A; 2D89 A; 1WJO A; 1WYO A; 5A36 A; 1WYM A; 2VZD A; #chains in the Genus database with same CATH homology 1EUV A; 2EQO A; 2VE7 C; 2HKP A; 2VE7 A; 5FMT A; 2HL9 A; 4LVR A; 2IGP A; 4LVP A; 5FMU A; 2WE6 A; 4DDP A; 2HL8 A; 2WDT A; 3VP7 A; 3EAY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...