The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
126
|
structure length |
124
|
Chain Sequence |
AMGDVSYIVDSLGLPPFSYQMSLLSFTEKGPQELLQLLSDVFSTISPQKVDVAKEVPDQTADRLIGFLKIIKYRPNVQDPLLFRQLVAAGDRETLYQILRWVVPQAQLLEKRAFVGYYLSFPDM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular Basis of Tubulin Transport Within the Cilium by IFT74 and IFT81.
pubmed doi rcsb |
| molecule keywords |
Intraflagellar transport protein 81
|
| molecule tags |
Transport protein
|
| source organism |
Chlamydomonas reinhardtii
|
| total genus |
38
|
| structure length |
124
|
| sequence length |
126
|
| ec nomenclature | |
| pdb deposition date | 2013-07-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18383 | IFT81_CH | Intraflagellar transport 81 calponin homology domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Actin-binding Protein, T-fimbrin; domain 1 | Actin-binding Protein, T-fimbrin; domain 1 |
#chains in the Genus database with same CATH superfamily 4LVP A; 4LVR A; #chains in the Genus database with same CATH topology 4DDP A; 2WDT A; 3EAY A; 1UEG A; 3REP B; 4TXI A; 2RR8 A; 1WKU A; 5FMT A; 1SH6 A; 1WYN A; 1P5S A; 4Q57 B; 1VKA A; 2WA5 A; 4LVP A; 2YRN A; 1DXX A; 5L0O A; 4EDM A; 5J8E A; 2WFN A; 4EDN A; 1V5K A; 2E9K A; 2JV9 A; 1WYM A; 2VZI B; 2L3G A; 2EQO A; 2R8U A; 4B7L A; 3I6X A; 3F7P A; 1UJO A; 2WA6 A; 3KMU B; 1SH5 A; 2WE6 A; 1MB8 A; 3JAL M; 4Q59 A; 2VZC A; 2EYI A; 2VE7 C; 2VZD A; 1BKR A; 4LVR A; 2K3S A; 3FER A; 1WYQ A; 3VP7 A; 2D86 A; 2EE7 A; 1WYP A; 5A36 A; 2VE7 A; 3KMW B; 1BHD A; 1H67 A; 2D89 A; 1TJT A; 4TXK A; 2D88 A; 2D87 A; 2QJZ A; 2QJX A; 1PA7 A; 3HOC A; 1WJO A; 4Q58 A; 1EUV A; 1WYL A; 1AA2 A; 2D85 A; 3KY9 A; 3JAK M; 3HOR A; 1QAG A; 1WYR A; 3JAR M; 3HOP A; 2R0O A; 1RT8 A; 1WYO A; 1WIX A; 2VZG B; 3CO1 A; 2HL8 A; 5A38 A; 2EYN A; 1P2X A; 2IGP A; 4EDL A; 5BVR A; 2HL9 A; 2K2R A; 1PXY A; 5FMU A; 2HKP A; 2DK9 A; 2WA7 A; 1AOA A; 5A37 A; 5A4B A; #chains in the Genus database with same CATH homology 4DDP A; 2HKP A; 2WDT A; 3EAY A; 2VE7 A; 2EQO A; 2VE7 C; 1EUV A; 4LVR A; 2HL9 A; 2HL8 A; 2WE6 A; 4LVP A; 3VP7 A; 5FMU A; 5FMT A; 2IGP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
