1CZMA

Drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
260
structure length
260
Chain Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE I
publication title Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
total genus 74
structure length 260
sequence length 260
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1993-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1czmA00
4CACA 4Q08A 1KOQA 5JESB 1CRMA 1DCBA 2WEGA 4HT2A 2FMGA 6CA2A 4KNMA 4FIKA 3DVDA 3V7XA 4WUQA 1G4OA 4M2VA 1TTMA 3F7UA 3R16A 1CINA 1I9LA 3HS4A 4Q7WA 3JXHC 3SAXA 3N3JA 3HKNA 2FOQA 1CAJA 3M67A 4YX4A 5BRWA 5FNGA 4QIZA 5E2RA 4L5UA 1HCBA 3IAIA 1CVAA 4K1QA 3HFPA 2NWZA 4Q7SA 3RZ8A 1CCSA 3M14A 2VVAX 1CAOA 1KWRA 3M04A 3P4VA 2VVBX 3DCCA 5CLUA 4Q8XA 4HEZA 4KNIA 1YO2A 1HEDA 3S72B 1ZGEA 1LG5A 5SZ3A 1BV3A 4PQ7A 4COQA 3KONA 4JSSA 5FNKA 1FQNA 2X7TA 1DMXA 1OKMA 4PYXA 4Q6EA 3B4FA 5EH8A 4Q87A 4Q9YA 4DZ9A 2EU3A 3MNKA 4MLXA 5J8ZA 4E9OX 5FNLA 2NXSA 1CNJA 4LU3A 4K13A 1KOPA 4RH2A 5AMGA 3SBHA 1UGFA 5DSNA 4ZWIA 3RYXB 1LUGA 2ILIA 5FL5A 3ML2A 1BN1A 5SZ4A 4QIYA 4ZWYA 2O4ZA 4E5QA 4ZWXA 4YGJA 4CNRA 4E3HA 3IBUA 2NWYA 4HT0A 1YDBA 1I91A 4BF1A 5JG5B 9CA2A 3LXEA 4Q09A 3K7KA 5A25A 4YGLA 4ILXA 2HD6A 4Z1JA 1DMYA 1FLJA 1CNKA 1TEUX 2FW4A 4K0TA 3W6HA 3S73B 3T84A 3T83A 1HECA 3D92A 3DC3A 3V2JA 4YWPA 3M2YA 5JEGB 1UGDA 3M1JA 3EFIA 4MO8A 5SZ1A 4Y0JA 3DD8A 1FQMA 3M2XA 1BN3A 4WW6A 1I9PA 1IF8A 4E3DA 4MDGA 2CBDA 4Z0QA 4Q7PA 4YGKA 3IEOA 1YDAA 3OYQA 5C8IA 4Q06A 3DVBA 3HKQA 3DCWA 5CA2A 1LG6A 1BZMA 4MTYA 5FLOA 1G46A 2NNOA 5EH5A 1H9QA 3RLDA 4QY3A 1ZSBA 1TH9A 4YXIA 3KNEA 1IF7A 4G0CA 4RUZA 4QK3A 1TEQX 1THKA 4L5VA 1BICA 1IF5A 5A6HA 2FNMA 2FNNA 5EH7A 2AX2A 1ZFKA 1BNQA 3UYNA 3S9TA 1BNUA 3OIMA 1HEAA 5JGTB 3P3JA 4C3TA 1RJ6A 3BL0A 2QP6A 3KS3A 2IT4A 3IGPA 3B1BA 3T5UA 2ZNCA 5FNJA 1CVHA 1BCDA 3RZ5A 5FDIA 1G54A 1IF9A 1CNYA 1ZSAA 4IWZA 1G0FA 3V5GA 3S8XA 4UOVA 4Q7VA 3OIKA 3HKTA 2X7SA 3U47A 1FQLA 3S74B 1OKNA 1BNNA 2X7UA 3DVCA 3NJ9A 4PZHA 7CA2A 4E3GA 5FLQA 3JXFA 1CA3A 5EZTX 3F8EA 4YXUA 1HUGA 5JQTA 3D93A 1JCZA 1XQ0A 2HOCA 1H4NA 3C7PA 1BNTA 4Q49A 4E49A 5IPZA 1CVBA 4CNWA 5DSKA 5G03A 1CALA 2NN1A 12CAA 1CANA 3MHMA 1G45A 2Q1BA 4RFDA 1T9NA 3M96A 5DSIA 3MHCA 2H4NA 5DVXA 1G6VA 1OQ5A 3M1QA 1EOUA 1Z93A 1I90A 3RGEA 1Z97A 4FPTA 3FFPX 1FR7A 1AM6A 3RZ7A 1OKLA 4LHIA 4Q83A 4LP6A 3MHOA 4FRCA 3DAZA 2OSFA 5JDVB 4Q8ZA 4QJPA 3MMFA 1RZAA 4RUYA 4KAPA 1ZGFA 1CVFA 1UGGA 3DD0A 3DCSA 1ZH9A 3ZP9A 4YYTA 4XFWA 1YDDA 3PO6A 4QJMA 1BNVA 1JD0A 4HU1A 3L14A 5DSLA 5LMDA 3DV7A 5BRVA 3V3FA 2HL4A 1FR4A 3U7CA 5HPJA 4RN4A 1A42A 5CACA 4TWLA 3W6IA 2HKKA 2HFWA 2POWA 4RFCA 3RYZA 1XEGA 4WW8A 5AMLA 2CBBA 3BL1A 3R17B 3GZ0A 3M1WA 5EOIA 4QEFA 5G0BA 3IBIA 4XIXA 3P3HA 1HVAA 5EHEA 2CABA 2GD8A 4IDRX 3DBUA 3MNIA 3M5SA 4MDLA 1XPZA 2EZ7A 3V3HB 1LZVA 1CAKA 3KIGA 5BNLA 5DSOA 1CAMA 2Q38A 4Q07A 4TWMA 8CA2A 1YDCA 5FLRA 1CNWA 3JXGA 3T82A 3TVOX 4YGFA 1JV0A 5L6KA 2NXRA 2QOAA 5DSJA 5E2MA 2HNCA 3MNHA 2FOSA 1KWQA 1CA2A 4CNXA 5FNHA 2FOUA 1TBTX 3S97A 5FLTA 3M5EA 4CQ0A 2NWPA 3KOKA 4QK2A 5DSRA 2F14A 1FSQA 2EU2A 1CCUA 1FQRA 4HEYA 4ZX1A 5E5RA 3U45X 1I9MA 3P58A 4N16A 1RAYA 1ZSCA 5G0CA 4CNVA 4M2WA 4Q6DA 4MDMA 2WEHA 4HF3A 1V9EA 3FE4A 1CIMA 2H15A 3S75B 3TMJA 1UGAA 3F7BA 5SZ5A 5DSPA 4ETQC 1RZBA 1UGCA 3D9ZA 4Q8YA 1RZCA 5DOGA 1TE3X 4K0ZA 3VBDA 3OKUA 1ZFQA 4QSBA 5SZ7A 2NXTA 4PYYA 2CBAA 3V3JA 4Z1KA 1G48A 4QTLA 4KUYA 4YVYA 4BF6A 1CNHA 3V3GB 2GEHA 1Z9YA 3N4BA 2QO8A 5FLPA 4RIVA 3IBNA 3MHLA 1CAZA 1UGBA 3EFTA 3IBLA 4JS6A 4QJWA 4N0XB 4Q0LA 5EHWA 4CA2A 3V3IB 3PJJA 4RUXA 5FL6A 1CCTA 5E2NA 3M1KA 3OILA 1KEQA 1G1DA 1I9NA 5FL4A 3P44A 3HKUA 1CVDA 1RZEA 2FMZA 2Q1QA 1CAYA 3Q31A 2FNKA 4M2UA 5DRSA 2WD2A 1CNBA 2WD3A 4QSIA 3P55A 5SZ6A 2CA2A 2CBCA 1V9IC 3ZNCA 4YGNA 1ZE8A 4Q78A 1G52A 4KP8A 4KV0A 3S71B 3U3AX 1CNGA 5G01A 1AVNA 5BYIA 4QJOA 4ZX0A 4DZ7A 1G0EA 3OYSA 1RAZA 2POVA 2ABEA 3BETA 5DSMA 5FNIA 2NMXA 4KNNA 5FLSA 3S78B 3D8WA 4XZ5A 2WEOA 1FSRA 4ITOA 3CA2A 1CNCA 1MUAA 2NN7A 1F2WA 1RZDA 4FVNA 4R5AA 1CNXA 4QJXA 4KUVA 2NWOA 1HEBA 1CAHA 3M2ZA 1CNIA 4WR7A 1BNWA 3S76A 1G3ZA 3RG3A 3SAPA 4M2RA 3RG4A 5BRUA 1H9NA 3V2MA 5FDCA 2W2JA 4FL7A 4JSWA 4FVOA 3RYJB 5EKMA 5JGSB 4KUWA 5DOHA 5FNMA 2POUA 3MYQA 4K0SA 5EKJA 4X5SA 3N2PA 1URTA 5E2KA 2WEJA 4KP5A 5JEPB 3NB5A 1I9OA 4MLTA 5JEHB 4ITPA 1G4JA 3MNAA 4R59A 1TG9A 4WL4A 4G7AA 3KLDB 1TB0X 4R5BA 2OSMA 3M40A 4XE1A 4QSAA 1CVEA 3FW3A 1BN4A 3M98A 4HBAA 4Z1EA 5AMDA 4E4AA 3CYUA 3D0NA 3KWAA 1G53A 5JQ0A 3OY0A 4YXOA 4HEWA 1YO1A 3OKVA 2CBEA 1CAIA 3K2FA 3MHIA 3M3XA 1TG3A 2FOYA 1HCAA 4Q99A 4KNJA 4QJ0A 3DA2A 4XIWA 1I8ZA 1YO0A 5E2SA 5L3OA 4Z1NA 3RZ1B 1HUHA 3N0NA 3CZVA 3ML5A 3M2NA 3UYQA 3MDZA 1AZMA 3S77B 1CVCA 3P5LA 4L5WA 3RJ7A 4YHAA 5JG3B 1IF4A 5DSQA 3KKXA 5SZ0A 4WUPA 3DC9A 1IF6A 4BCWA 4RIUA 3HLJA 1FSNA 3M5TA 3QYKA 3MZCA 3K34A 3KOIA 3NI5A 1CILA 4GL1X 1MOOA 3MNJA 3PYKA 5EKHA 4Q90A 3RYVB 5EHVA 4FU5A 2AW1A 3MWOA 1BNMA 1J9WA 3MNUA 5CJFA 1ZNCA 4JSAA 4Q81A 2NNVA 4JSZA 3P5AA 4ZWZA 5E5UA 3T5ZA 1DCAA 5EIJA 4QSJA 3RYYA 1I9QA 2NNGA 3F4XA 4QK1A 1Y7WA 5E28A 4ZAOA 4E3FA 5SZ2A 1XEVA 2FOVA 3TVNX 2NNSA 3CAJA 1RJ5A 1UGEA 1CZMA 1CRAA 3SBIA 3RZ0B 3T85A 1LGDA 4PXXA
chains in the Genus database with same CATH superfamily
4CACA 4Q08A 1KOQA 5JESB 1CRMA 1DCBA 2WEGA 4HT2A 2FMGA 6CA2A 4KNMA 4FIKA 3DVDA 3V7XA 4WUQA 1G4OA 4M2VA 1TTMA 3F7UA 3R16A 1CINA 1I9LA 3HS4A 4Q7WA 3JXHC 3SAXA 3N3JA 3HKNA 2FOQA 1CAJA 3M67A 4YX4A 5BRWA 5FNGA 4QIZA 5E2RA 4L5UA 1HCBA 3IAIA 1CVAA 4K1QA 3HFPA 2NWZA 4Q7SA 3RZ8A 1CCSA 3M14A 2VVAX 1CAOA 1KWRA 3M04A 3P4VA 2VVBX 3DCCA 5CLUA 4Q8XA 4HEZA 4KNIA 1YO2A 1HEDA 3S72B 1ZGEA 1LG5A 5SZ3A 1BV3A 4PQ7A 4COQA 3KONA 4JSSA 5FNKA 1FQNA 2X7TA 1DMXA 1OKMA 4PYXA 4Q6EA 3B4FA 5EH8A 4Q87A 4Q9YA 4DZ9A 2EU3A 3MNKA 4MLXA 5J8ZA 4E9OX 5FNLA 2NXSA 1CNJA 4LU3A 4K13A 1KOPA 4RH2A 5AMGA 3SBHA 1UGFA 5DSNA 4ZWIA 3RYXB 1LUGA 2ILIA 5FL5A 3ML2A 1BN1A 5SZ4A 4QIYA 4ZWYA 2O4ZA 4E5QA 4ZWXA 4YGJA 4CNRA 4E3HA 3IBUA 2NWYA 4HT0A 1YDBA 1I91A 4BF1A 5JG5B 9CA2A 3LXEA 4Q09A 3K7KA 5A25A 4YGLA 4ILXA 2HD6A 4Z1JA 1DMYA 1FLJA 1CNKA 1TEUX 2FW4A 4K0TA 3W6HA 3S73B 3T84A 3T83A 1HECA 3D92A 3DC3A 3V2JA 4YWPA 3M2YA 5JEGB 1UGDA 3M1JA 3EFIA 4MO8A 5SZ1A 4Y0JA 3DD8A 1FQMA 3M2XA 1BN3A 4WW6A 1I9PA 1IF8A 4E3DA 4MDGA 2CBDA 4Z0QA 4Q7PA 4YGKA 3IEOA 1YDAA 3OYQA 5C8IA 4Q06A 3DVBA 3HKQA 3DCWA 5CA2A 1LG6A 1BZMA 4MTYA 5FLOA 1G46A 2NNOA 5EH5A 1H9QA 3RLDA 4QY3A 1ZSBA 1TH9A 4YXIA 3KNEA 1IF7A 4G0CA 4RUZA 4QK3A 1TEQX 1THKA 4L5VA 1BICA 1IF5A 5A6HA 2FNMA 2FNNA 5EH7A 2AX2A 1ZFKA 1BNQA 3UYNA 3S9TA 1BNUA 3OIMA 1HEAA 5JGTB 3P3JA 4C3TA 1RJ6A 3BL0A 2QP6A 3KS3A 2IT4A 3IGPA 3B1BA 3T5UA 2ZNCA 5FNJA 1CVHA 1BCDA 3RZ5A 5FDIA 1G54A 1IF9A 1CNYA 1ZSAA 4IWZA 1G0FA 3V5GA 3S8XA 4UOVA 4Q7VA 3OIKA 3HKTA 2X7SA 3U47A 1FQLA 3S74B 1OKNA 1BNNA 2X7UA 3DVCA 3NJ9A 4PZHA 7CA2A 4E3GA 5FLQA 3JXFA 1CA3A 5EZTX 3F8EA 4YXUA 1HUGA 5JQTA 3D93A 1JCZA 1XQ0A 2HOCA 1H4NA 3C7PA 1BNTA 4Q49A 4E49A 5IPZA 1CVBA 4CNWA 5DSKA 5G03A 1CALA 2NN1A 12CAA 1CANA 3MHMA 1G45A 2Q1BA 4RFDA 1T9NA 3M96A 5DSIA 3MHCA 2H4NA 5DVXA 1G6VA 1OQ5A 3M1QA 1EOUA 1Z93A 1I90A 3RGEA 1Z97A 4FPTA 3FFPX 1FR7A 1AM6A 3RZ7A 1OKLA 4LHIA 4Q83A 4LP6A 3MHOA 4FRCA 3DAZA 2OSFA 5JDVB 4Q8ZA 4QJPA 3MMFA 1RZAA 4RUYA 4KAPA 1ZGFA 1CVFA 1UGGA 3DD0A 3DCSA 1ZH9A 3ZP9A 4YYTA 4XFWA 1YDDA 3PO6A 4QJMA 1BNVA 1JD0A 4HU1A 3L14A 5DSLA 5LMDA 3DV7A 5BRVA 3V3FA 2HL4A 1FR4A 3U7CA 5HPJA 4RN4A 1A42A 5CACA 4TWLA 3W6IA 2HKKA 2HFWA 2POWA 4RFCA 3RYZA 1XEGA 4WW8A 5AMLA 2CBBA 3BL1A 3R17B 3GZ0A 3M1WA 5EOIA 4QEFA 5G0BA 3IBIA 4XIXA 3P3HA 1HVAA 5EHEA 2CABA 2GD8A 4IDRX 3DBUA 3MNIA 3M5SA 4MDLA 1XPZA 2EZ7A 3V3HB 1LZVA 1CAKA 3KIGA 5BNLA 5DSOA 1CAMA 2Q38A 4Q07A 4TWMA 8CA2A 1YDCA 5FLRA 1CNWA 3JXGA 3T82A 3TVOX 4YGFA 1JV0A 5L6KA 2NXRA 2QOAA 5DSJA 5E2MA 2HNCA 3MNHA 2FOSA 1KWQA 1CA2A 4CNXA 5FNHA 2FOUA 1TBTX 3S97A 5FLTA 3M5EA 4CQ0A 2NWPA 3KOKA 4QK2A 5DSRA 2F14A 1FSQA 2EU2A 1CCUA 1FQRA 4HEYA 4ZX1A 5E5RA 3U45X 1I9MA 3P58A 4N16A 1RAYA 1ZSCA 5G0CA 4CNVA 4M2WA 4Q6DA 4MDMA 2WEHA 4HF3A 1V9EA 3FE4A 1CIMA 2H15A 3S75B 3TMJA 1UGAA 3F7BA 5SZ5A 5DSPA 4ETQC 1RZBA 1UGCA 3D9ZA 4Q8YA 1RZCA 5DOGA 1TE3X 4K0ZA 3VBDA 3OKUA 1ZFQA 4QSBA 5SZ7A 2NXTA 4PYYA 2CBAA 3V3JA 4Z1KA 1G48A 4QTLA 4KUYA 4YVYA 4BF6A 1CNHA 3V3GB 2GEHA 1Z9YA 3N4BA 2QO8A 5FLPA 4RIVA 3IBNA 3MHLA 1CAZA 1UGBA 3EFTA 3IBLA 4JS6A 4QJWA 4N0XB 4Q0LA 5EHWA 4CA2A 3V3IB 3PJJA 4RUXA 5FL6A 1CCTA 5E2NA 3M1KA 3OILA 1KEQA 1G1DA 1I9NA 5FL4A 3P44A 3HKUA 1CVDA 1RZEA 2FMZA 2Q1QA 1CAYA 3Q31A 2FNKA 4M2UA 5DRSA 2WD2A 1CNBA 2WD3A 4QSIA 3P55A 5SZ6A 2CA2A 2CBCA 1V9IC 3ZNCA 4YGNA 1ZE8A 4Q78A 1G52A 4KP8A 4KV0A 3S71B 3U3AX 1CNGA 5G01A 1AVNA 5BYIA 4QJOA 4ZX0A 4DZ7A 1G0EA 3OYSA 1RAZA 2POVA 2ABEA 3BETA 5DSMA 5FNIA 2NMXA 4KNNA 5FLSA 3S78B 3D8WA 4XZ5A 2WEOA 1FSRA 4ITOA 3CA2A 1CNCA 1MUAA 2NN7A 1F2WA 1RZDA 4FVNA 4R5AA 1CNXA 4QJXA 4KUVA 2NWOA 1HEBA 1CAHA 3M2ZA 1CNIA 4WR7A 1BNWA 3S76A 1G3ZA 3RG3A 3SAPA 4M2RA 3RG4A 5BRUA 1H9NA 3V2MA 5FDCA 2W2JA 4FL7A 4JSWA 4FVOA 3RYJB 5EKMA 5JGSB 4KUWA 5DOHA 5FNMA 2POUA 3MYQA 4K0SA 5EKJA 4X5SA 3N2PA 1URTA 5E2KA 2WEJA 4KP5A 5JEPB 3NB5A 1I9OA 4MLTA 5JEHB 4ITPA 1G4JA 3MNAA 4R59A 1TG9A 4WL4A 4G7AA 3KLDB 1TB0X 4R5BA 2OSMA 3M40A 4XE1A 4QSAA 1CVEA 3FW3A 1BN4A 3M98A 4HBAA 4Z1EA 5AMDA 4E4AA 3CYUA 3D0NA 3KWAA 1G53A 5JQ0A 3OY0A 4YXOA 4HEWA 1YO1A 3OKVA 2CBEA 1CAIA 3K2FA 3MHIA 3M3XA 1TG3A 2FOYA 1HCAA 4Q99A 4KNJA 4QJ0A 3DA2A 4XIWA 1I8ZA 1YO0A 5E2SA 5L3OA 4Z1NA 3RZ1B 1HUHA 3N0NA 3CZVA 3ML5A 3M2NA 3UYQA 3MDZA 1AZMA 3S77B 1CVCA 3P5LA 4L5WA 3RJ7A 4YHAA 5JG3B 1IF4A 5DSQA 3KKXA 5SZ0A 4WUPA 3DC9A 1IF6A 4BCWA 4RIUA 3HLJA 1FSNA 3M5TA 3QYKA 3MZCA 3K34A 3KOIA 3NI5A 1CILA 4GL1X 1MOOA 3MNJA 3PYKA 5EKHA 4Q90A 3RYVB 5EHVA 4FU5A 2AW1A 3MWOA 1BNMA 1J9WA 3MNUA 5CJFA 1ZNCA 4JSAA 4Q81A 2NNVA 4JSZA 3P5AA 4ZWZA 5E5UA 3T5ZA 1DCAA 5EIJA 4QSJA 3RYYA 1I9QA 2NNGA 3F4XA 4QK1A 1Y7WA 5E28A 4ZAOA 4E3FA 5SZ2A 1XEVA 2FOVA 3TVNX 2NNSA 3CAJA 1RJ5A 1UGEA 1CZMA 1CRAA 3SBIA 3RZ0B 3T85A 1LGDA 4PXXA
chains in the Genus database with same CATH topology
4CACA 4Q08A 1KOQA 5JESB 1CRMA 1DCBA 2WEGA 4HT2A 2FMGA 6CA2A 4KNMA 4FIKA 3DVDA 3V7XA 4WUQA 1G4OA 4M2VA 1TTMA 3F7UA 3R16A 1CINA 1I9LA 3HS4A 4Q7WA 3JXHC 3SAXA 3N3JA 3HKNA 2FOQA 1CAJA 3M67A 4YX4A 5BRWA 5FNGA 4QIZA 5E2RA 4L5UA 1HCBA 3IAIA 1CVAA 4K1QA 3HFPA 2NWZA 4Q7SA 3RZ8A 1CCSA 3M14A 2VVAX 1CAOA 1KWRA 3M04A 3P4VA 2VVBX 3DCCA 5CLUA 4Q8XA 4HEZA 4KNIA 1YO2A 1HEDA 3S72B 1ZGEA 1LG5A 5SZ3A 1BV3A 4PQ7A 4COQA 3KONA 4JSSA 5FNKA 1FQNA 2X7TA 1DMXA 1OKMA 4PYXA 4Q6EA 3B4FA 5EH8A 4Q87A 4Q9YA 4DZ9A 2EU3A 3MNKA 4MLXA 5J8ZA 4E9OX 5FNLA 2NXSA 1CNJA 4LU3A 4K13A 1KOPA 4RH2A 5AMGA 3SBHA 1UGFA 5DSNA 4ZWIA 3RYXB 1LUGA 2ILIA 5FL5A 3ML2A 1BN1A 5SZ4A 4QIYA 4ZWYA 2O4ZA 4E5QA 4ZWXA 4YGJA 4CNRA 4E3HA 3IBUA 2NWYA 4HT0A 1YDBA 1I91A 4BF1A 5JG5B 9CA2A 3LXEA 4Q09A 3K7KA 5A25A 4YGLA 4ILXA 2HD6A 4Z1JA 1DMYA 1FLJA 1CNKA 1TEUX 2FW4A 4K0TA 3W6HA 3S73B 3T84A 3T83A 1HECA 3D92A 3DC3A 3V2JA 4YWPA 3M2YA 5JEGB 1UGDA 3M1JA 3EFIA 4MO8A 5SZ1A 4Y0JA 3DD8A 1FQMA 3M2XA 1BN3A 4WW6A 1I9PA 1IF8A 4E3DA 4MDGA 2CBDA 4Z0QA 4Q7PA 4YGKA 3IEOA 1YDAA 3OYQA 5C8IA 4Q06A 3DVBA 3HKQA 3DCWA 5CA2A 1LG6A 1BZMA 4MTYA 5FLOA 1G46A 2NNOA 5EH5A 1H9QA 3RLDA 4QY3A 1ZSBA 1TH9A 4YXIA 3KNEA 1IF7A 4G0CA 4RUZA 4QK3A 1TEQX 1THKA 4L5VA 1BICA 1IF5A 5A6HA 2FNMA 2FNNA 5EH7A 2AX2A 1ZFKA 1BNQA 3UYNA 3S9TA 1BNUA 3OIMA 1HEAA 5JGTB 3P3JA 4C3TA 1RJ6A 3BL0A 2QP6A 3KS3A 2IT4A 3IGPA 3B1BA 3T5UA 2ZNCA 5FNJA 1CVHA 1BCDA 3RZ5A 5FDIA 1G54A 1IF9A 1CNYA 1ZSAA 4IWZA 1G0FA 3V5GA 3S8XA 4UOVA 4Q7VA 3OIKA 3HKTA 2X7SA 3U47A 1FQLA 3S74B 1OKNA 1BNNA 2X7UA 3DVCA 3NJ9A 4PZHA 7CA2A 4E3GA 5FLQA 3JXFA 1CA3A 5EZTX 3F8EA 4YXUA 1HUGA 5JQTA 3D93A 1JCZA 1XQ0A 2HOCA 1H4NA 3C7PA 1BNTA 4Q49A 4E49A 5IPZA 1CVBA 4CNWA 5DSKA 5G03A 1CALA 2NN1A 12CAA 1CANA 3MHMA 1G45A 2Q1BA 4RFDA 1T9NA 3M96A 5DSIA 3MHCA 2H4NA 5DVXA 1G6VA 1OQ5A 3M1QA 1EOUA 1Z93A 1I90A 3RGEA 1Z97A 4FPTA 3FFPX 1FR7A 1AM6A 3RZ7A 1OKLA 4LHIA 4Q83A 4LP6A 3MHOA 4FRCA 3DAZA 2OSFA 5JDVB 4Q8ZA 4QJPA 3MMFA 1RZAA 4RUYA 4KAPA 1ZGFA 1CVFA 1UGGA 3DD0A 3DCSA 1ZH9A 3ZP9A 4YYTA 4XFWA 1YDDA 3PO6A 4QJMA 1BNVA 1JD0A 4HU1A 3L14A 5DSLA 5LMDA 3DV7A 5BRVA 3V3FA 2HL4A 1FR4A 3U7CA 5HPJA 4RN4A 1A42A 5CACA 4TWLA 3W6IA 2HKKA 2HFWA 2POWA 4RFCA 3RYZA 1XEGA 4WW8A 5AMLA 2CBBA 3BL1A 3R17B 3GZ0A 3M1WA 5EOIA 4QEFA 5G0BA 3IBIA 4XIXA 3P3HA 1HVAA 5EHEA 2CABA 2GD8A 4IDRX 3DBUA 3MNIA 3M5SA 4MDLA 1XPZA 2EZ7A 3V3HB 1LZVA 1CAKA 3KIGA 5BNLA 5DSOA 1CAMA 2Q38A 4Q07A 4TWMA 8CA2A 1YDCA 5FLRA 1CNWA 3JXGA 3T82A 3TVOX 4YGFA 1JV0A 5L6KA 2NXRA 2QOAA 5DSJA 5E2MA 2HNCA 3MNHA 2FOSA 1KWQA 1CA2A 4CNXA 5FNHA 2FOUA 1TBTX 3S97A 5FLTA 3M5EA 4CQ0A 2NWPA 3KOKA 4QK2A 5DSRA 2F14A 1FSQA 2EU2A 1CCUA 1FQRA 4HEYA 4ZX1A 5E5RA 3U45X 1I9MA 3P58A 4N16A 1RAYA 1ZSCA 5G0CA 4CNVA 4M2WA 4Q6DA 4MDMA 2WEHA 4HF3A 1V9EA 3FE4A 1CIMA 2H15A 3S75B 3TMJA 1UGAA 3F7BA 5SZ5A 5DSPA 4ETQC 1RZBA 1UGCA 3D9ZA 4Q8YA 1RZCA 5DOGA 1TE3X 4K0ZA 3VBDA 3OKUA 1ZFQA 4QSBA 5SZ7A 2NXTA 4PYYA 2CBAA 3V3JA 4Z1KA 1G48A 4QTLA 4KUYA 4YVYA 4BF6A 1CNHA 3V3GB 2GEHA 1Z9YA 3N4BA 2QO8A 5FLPA 4RIVA 3IBNA 3MHLA 1CAZA 1UGBA 3EFTA 3IBLA 4JS6A 4QJWA 4N0XB 4Q0LA 5EHWA 4CA2A 3V3IB 3PJJA 4RUXA 5FL6A 1CCTA 5E2NA 3M1KA 3OILA 1KEQA 1G1DA 1I9NA 5FL4A 3P44A 3HKUA 1CVDA 1RZEA 2FMZA 2Q1QA 1CAYA 3Q31A 2FNKA 4M2UA 5DRSA 2WD2A 1CNBA 2WD3A 4QSIA 3P55A 5SZ6A 2CA2A 2CBCA 1V9IC 3ZNCA 4YGNA 1ZE8A 4Q78A 1G52A 4KP8A 4KV0A 3S71B 3U3AX 1CNGA 5G01A 1AVNA 5BYIA 4QJOA 4ZX0A 4DZ7A 1G0EA 3OYSA 1RAZA 2POVA 2ABEA 3BETA 5DSMA 5FNIA 2NMXA 4KNNA 5FLSA 3S78B 3D8WA 4XZ5A 2WEOA 1FSRA 4ITOA 3CA2A 1CNCA 1MUAA 2NN7A 1F2WA 1RZDA 4FVNA 4R5AA 1CNXA 4QJXA 4KUVA 2NWOA 1HEBA 1CAHA 3M2ZA 1CNIA 4WR7A 1BNWA 3S76A 1G3ZA 3RG3A 3SAPA 4M2RA 3RG4A 5BRUA 1H9NA 3V2MA 5FDCA 2W2JA 4FL7A 4JSWA 4FVOA 3RYJB 5EKMA 5JGSB 4KUWA 5DOHA 5FNMA 2POUA 3MYQA 4K0SA 5EKJA 4X5SA 3N2PA 1URTA 5E2KA 2WEJA 4KP5A 5JEPB 3NB5A 1I9OA 4MLTA 5JEHB 4ITPA 1G4JA 3MNAA 4R59A 1TG9A 4WL4A 4G7AA 3KLDB 1TB0X 4R5BA 2OSMA 3M40A 4XE1A 4QSAA 1CVEA 3FW3A 1BN4A 3M98A 4HBAA 4Z1EA 5AMDA 4E4AA 3CYUA 3D0NA 3KWAA 1G53A 5JQ0A 3OY0A 4YXOA 4HEWA 1YO1A 3OKVA 2CBEA 1CAIA 3K2FA 3MHIA 3M3XA 1TG3A 2FOYA 1HCAA 4Q99A 4KNJA 4QJ0A 3DA2A 4XIWA 1I8ZA 1YO0A 5E2SA 5L3OA 4Z1NA 3RZ1B 1HUHA 3N0NA 3CZVA 3ML5A 3M2NA 3UYQA 3MDZA 1AZMA 3S77B 1CVCA 3P5LA 4L5WA 3RJ7A 4YHAA 5JG3B 1IF4A 5DSQA 3KKXA 5SZ0A 4WUPA 3DC9A 1IF6A 4BCWA 4RIUA 3HLJA 1FSNA 3M5TA 3QYKA 3MZCA 3K34A 3KOIA 3NI5A 1CILA 4GL1X 1MOOA 3MNJA 3PYKA 5EKHA 4Q90A 3RYVB 5EHVA 4FU5A 2AW1A 3MWOA 1BNMA 1J9WA 3MNUA 5CJFA 1ZNCA 4JSAA 4Q81A 2NNVA 4JSZA 3P5AA 4ZWZA 5E5UA 3T5ZA 1DCAA 5EIJA 4QSJA 3RYYA 1I9QA 2NNGA 3F4XA 4QK1A 1Y7WA 5E28A 4ZAOA 4E3FA 5SZ2A 1XEVA 2FOVA 3TVNX 2NNSA 3CAJA 1RJ5A 1UGEA 1CZMA 1CRAA 3SBIA 3RZ0B 3T85A 1LGDA 4PXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAC A;  4Q08 A;  1KOQ A;  5JES B;  1CRM A;  1DCB A;  2WEG A;  4HT2 A;  2FMG A;  6CA2 A;  4KNM A;  4FIK A;  3DVD A;  3V7X A;  4WUQ A;  1G4O A;  4M2V A;  1TTM A;  3F7U A;  3R16 A;  1CIN A;  1I9L A;  3HS4 A;  4Q7W A;  3JXH C;  3SAX A;  3N3J A;  3HKN A;  2FOQ A;  1CAJ A;  3M67 A;  4YX4 A;  5BRW A;  5FNG A;  4QIZ A;  5E2R A;  4L5U A;  1HCB A;  3IAI A;  1CVA A;  4K1Q A;  3HFP A;  2NWZ A;  4Q7S A;  3RZ8 A;  1CCS A;  3M14 A;  2VVA X;  1CAO A;  1KWR A;  3M04 A;  3P4V A;  2VVB X;  3DCC A;  5CLU A;  4Q8X A;  4HEZ A;  4KNI A;  1YO2 A;  1HED A;  3S72 B;  1ZGE A;  1LG5 A;  5SZ3 A;  1BV3 A;  4PQ7 A;  4COQ A;  3KON A;  4JSS A;  5FNK A;  1FQN A;  2X7T A;  1DMX A;  1OKM A;  4PYX A;  4Q6E A;  3B4F A;  5EH8 A;  4Q87 A;  4Q9Y A;  4DZ9 A;  2EU3 A;  3MNK A;  4MLX A;  5J8Z A;  4E9O X;  5FNL A;  2NXS A;  1CNJ A;  4LU3 A;  4K13 A;  1KOP A;  4RH2 A;  5AMG A;  3SBH A;  1UGF A;  5DSN A;  4ZWI A;  3RYX B;  1LUG A;  2ILI A;  5FL5 A;  3ML2 A;  1BN1 A;  5SZ4 A;  4QIY A;  4ZWY A;  2O4Z A;  4E5Q A;  4ZWX A;  4YGJ A;  4CNR A;  4E3H A;  3IBU A;  2NWY A;  4HT0 A;  1YDB A;  1I91 A;  4BF1 A;  5JG5 B;  9CA2 A;  3LXE A;  4Q09 A;  3K7K A;  5A25 A;  4YGL A;  4ILX A;  2HD6 A;  4Z1J A;  1DMY A;  1FLJ A;  1CNK A;  1TEU X;  2FW4 A;  4K0T A;  3W6H A;  3S73 B;  3T84 A;  3T83 A;  1HEC A;  3D92 A;  3DC3 A;  3V2J A;  4YWP A;  3M2Y A;  5JEG B;  1UGD A;  3M1J A;  3EFI A;  4MO8 A;  5SZ1 A;  4Y0J A;  3DD8 A;  1FQM A;  3M2X A;  1BN3 A;  4WW6 A;  1I9P A;  1IF8 A;  4E3D A;  4MDG A;  2CBD A;  4Z0Q A;  4Q7P A;  4YGK A;  3IEO A;  1YDA A;  3OYQ A;  5C8I A;  4Q06 A;  3DVB A;  3HKQ A;  3DCW A;  5CA2 A;  1LG6 A;  1BZM A;  4MTY A;  5FLO A;  1G46 A;  2NNO A;  5EH5 A;  1H9Q A;  3RLD A;  4QY3 A;  1ZSB A;  1TH9 A;  4YXI A;  3KNE A;  1IF7 A;  4G0C A;  4RUZ A;  4QK3 A;  1TEQ X;  1THK A;  4L5V A;  1BIC A;  1IF5 A;  5A6H A;  2FNM A;  2FNN A;  5EH7 A;  2AX2 A;  1ZFK A;  1BNQ A;  3UYN A;  3S9T A;  1BNU A;  3OIM A;  1HEA A;  5JGT B;  3P3J A;  4C3T A;  1RJ6 A;  3BL0 A;  2QP6 A;  3KS3 A;  2IT4 A;  3IGP A;  3B1B A;  3T5U A;  2ZNC A;  5FNJ A;  1CVH A;  1BCD A;  3RZ5 A;  5FDI A;  1G54 A;  1IF9 A;  1CNY A;  1ZSA A;  4IWZ A;  1G0F A;  3V5G A;  3S8X A;  4UOV A;  4Q7V A;  3OIK A;  3HKT A;  2X7S A;  3U47 A;  1FQL A;  3S74 B;  1OKN A;  1BNN A;  2X7U A;  3DVC A;  3NJ9 A;  4PZH A;  7CA2 A;  4E3G A;  5FLQ A;  3JXF A;  1CA3 A;  5EZT X;  3F8E A;  4YXU A;  1HUG A;  5JQT A;  3D93 A;  1JCZ A;  1XQ0 A;  2HOC A;  1H4N A;  3C7P A;  1BNT A;  4Q49 A;  4E49 A;  5IPZ A;  1CVB A;  4CNW A;  5DSK A;  5G03 A;  1CAL A;  2NN1 A;  12CA A;  1CAN A;  3MHM A;  1G45 A;  2Q1B A;  4RFD A;  1T9N A;  3M96 A;  5DSI A;  3MHC A;  2H4N A;  5DVX A;  1G6V A;  1OQ5 A;  3M1Q A;  1EOU A;  1Z93 A;  1I90 A;  3RGE A;  1Z97 A;  4FPT A;  3FFP X;  1FR7 A;  1AM6 A;  3RZ7 A;  1OKL A;  4LHI A;  4Q83 A;  4LP6 A;  3MHO A;  4FRC A;  3DAZ A;  2OSF A;  5JDV B;  4Q8Z A;  4QJP A;  3MMF A;  1RZA A;  4RUY A;  4KAP A;  1ZGF A;  1CVF A;  1UGG A;  3DD0 A;  3DCS A;  1ZH9 A;  3ZP9 A;  4YYT A;  4XFW A;  1YDD A;  3PO6 A;  4QJM A;  1BNV A;  1JD0 A;  4HU1 A;  3L14 A;  5DSL A;  5LMD A;  3DV7 A;  5BRV A;  3V3F A;  2HL4 A;  1FR4 A;  3U7C A;  5HPJ A;  4RN4 A;  1A42 A;  5CAC A;  4TWL A;  3W6I A;  2HKK A;  2HFW A;  2POW A;  4RFC A;  3RYZ A;  1XEG A;  4WW8 A;  5AML A;  2CBB A;  3BL1 A;  3R17 B;  3GZ0 A;  3M1W A;  5EOI A;  4QEF A;  5G0B A;  3IBI A;  4XIX A;  3P3H A;  1HVA A;  5EHE A;  2CAB A;  2GD8 A;  4IDR X;  3DBU A;  3MNI A;  3M5S A;  4MDL A;  1XPZ A;  2EZ7 A;  3V3H B;  1LZV A;  1CAK A;  3KIG A;  5BNL A;  5DSO A;  1CAM A;  2Q38 A;  4Q07 A;  4TWM A;  8CA2 A;  1YDC A;  5FLR A;  1CNW A;  3JXG A;  3T82 A;  3TVO X;  4YGF A;  1JV0 A;  5L6K A;  2NXR A;  2QOA A;  5DSJ A;  5E2M A;  2HNC A;  3MNH A;  2FOS A;  1KWQ A;  1CA2 A;  4CNX A;  5FNH A;  2FOU A;  1TBT X;  3S97 A;  5FLT A;  3M5E A;  4CQ0 A;  2NWP A;  3KOK A;  4QK2 A;  5DSR A;  2F14 A;  1FSQ A;  2EU2 A;  1CCU A;  1FQR A;  4HEY A;  4ZX1 A;  5E5R A;  3U45 X;  1I9M A;  3P58 A;  4N16 A;  1RAY A;  1ZSC A;  5G0C A;  4CNV A;  4M2W A;  4Q6D A;  4MDM A;  2WEH A;  4HF3 A;  1V9E A;  3FE4 A;  1CIM A;  2H15 A;  3S75 B;  3TMJ A;  1UGA A;  3F7B A;  5SZ5 A;  5DSP A;  4ETQ C;  1RZB A;  1UGC A;  3D9Z A;  4Q8Y A;  1RZC A;  5DOG A;  1TE3 X;  4K0Z A;  3VBD A;  3OKU A;  1ZFQ A;  4QSB A;  5SZ7 A;  2NXT A;  4PYY A;  2CBA A;  3V3J A;  4Z1K A;  1G48 A;  4QTL A;  4KUY A;  4YVY A;  4BF6 A;  1CNH A;  3V3G B;  2GEH A;  1Z9Y A;  3N4B A;  2QO8 A;  5FLP A;  4RIV A;  3IBN A;  3MHL A;  1CAZ A;  1UGB A;  3EFT A;  3IBL A;  4JS6 A;  4QJW A;  4N0X B;  4Q0L A;  5EHW A;  4CA2 A;  3V3I B;  3PJJ A;  4RUX A;  5FL6 A;  1CCT A;  5E2N A;  3M1K A;  3OIL A;  1KEQ A;  1G1D A;  1I9N A;  5FL4 A;  3P44 A;  3HKU A;  1CVD A;  1RZE A;  2FMZ A;  2Q1Q A;  1CAY A;  3Q31 A;  2FNK A;  4M2U A;  5DRS A;  2WD2 A;  1CNB A;  2WD3 A;  4QSI A;  3P55 A;  5SZ6 A;  2CA2 A;  2CBC A;  1V9I C;  3ZNC A;  4YGN A;  1ZE8 A;  4Q78 A;  1G52 A;  4KP8 A;  4KV0 A;  3S71 B;  3U3A X;  1CNG A;  5G01 A;  1AVN A;  5BYI A;  4QJO A;  4ZX0 A;  4DZ7 A;  1G0E A;  3OYS A;  1RAZ A;  2POV A;  2ABE A;  3BET A;  5DSM A;  5FNI A;  2NMX A;  4KNN A;  5FLS A;  3S78 B;  3D8W A;  4XZ5 A;  2WEO A;  1FSR A;  4ITO A;  3CA2 A;  1CNC A;  1MUA A;  2NN7 A;  1F2W A;  1RZD A;  4FVN A;  4R5A A;  1CNX A;  4QJX A;  4KUV A;  2NWO A;  1HEB A;  1CAH A;  3M2Z A;  1CNI A;  4WR7 A;  1BNW A;  3S76 A;  1G3Z A;  3RG3 A;  3SAP A;  4M2R A;  3RG4 A;  5BRU A;  1H9N A;  3V2M A;  5FDC A;  2W2J A;  4FL7 A;  4JSW A;  4FVO A;  3RYJ B;  5EKM A;  5JGS B;  4KUW A;  5DOH A;  5FNM A;  2POU A;  3MYQ A;  4K0S A;  5EKJ A;  4X5S A;  3N2P A;  1URT A;  5E2K A;  2WEJ A;  4KP5 A;  5JEP B;  3NB5 A;  1I9O A;  4MLT A;  5JEH B;  4ITP A;  1G4J A;  3MNA A;  4R59 A;  1TG9 A;  4WL4 A;  4G7A A;  3KLD B;  1TB0 X;  4R5B A;  2OSM A;  3M40 A;  4XE1 A;  4QSA A;  1CVE A;  3FW3 A;  1BN4 A;  3M98 A;  4HBA A;  4Z1E A;  5AMD A;  4E4A A;  3CYU A;  3D0N A;  3KWA A;  1G53 A;  5JQ0 A;  3OY0 A;  4YXO A;  4HEW A;  1YO1 A;  3OKV A;  2CBE A;  1CAI A;  3K2F A;  3MHI A;  3M3X A;  1TG3 A;  2FOY A;  1HCA A;  4Q99 A;  4KNJ A;  4QJ0 A;  3DA2 A;  4XIW A;  1I8Z A;  1YO0 A;  5E2S A;  5L3O A;  4Z1N A;  3RZ1 B;  1HUH A;  3N0N A;  3CZV A;  3ML5 A;  3M2N A;  3UYQ A;  3MDZ A;  1AZM A;  3S77 B;  1CVC A;  3P5L A;  4L5W A;  3RJ7 A;  4YHA A;  5JG3 B;  1IF4 A;  5DSQ A;  3KKX A;  5SZ0 A;  4WUP A;  3DC9 A;  1IF6 A;  4BCW A;  4RIU A;  3HLJ A;  1FSN A;  3M5T A;  3QYK A;  3MZC A;  3K34 A;  3KOI A;  3NI5 A;  1CIL A;  4GL1 X;  1MOO A;  3MNJ A;  3PYK A;  5EKH A;  4Q90 A;  3RYV B;  5EHV A;  4FU5 A;  2AW1 A;  3MWO A;  1BNM A;  1J9W A;  3MNU A;  5CJF A;  1ZNC A;  4JSA A;  4Q81 A;  2NNV A;  4JSZ A;  3P5A A;  4ZWZ A;  5E5U A;  3T5Z A;  1DCA A;  5EIJ A;  4QSJ A;  3RYY A;  1I9Q A;  2NNG A;  3F4X A;  4QK1 A;  1Y7W A;  5E28 A;  4ZAO A;  4E3F A;  5SZ2 A;  1XEV A;  2FOV A;  3TVN X;  2NNS A;  3CAJ A;  1RJ5 A;  1UGE A;  1CZM A;  1CRA A;  3SBI A;  3RZ0 B;  3T85 A;  1LGD A;  4PXX A; 
#chains in the Genus database with same CATH topology
 4CAC A;  4Q08 A;  1KOQ A;  5JES B;  1CRM A;  1DCB A;  2WEG A;  4HT2 A;  2FMG A;  6CA2 A;  4KNM A;  4FIK A;  3DVD A;  3V7X A;  4WUQ A;  1G4O A;  4M2V A;  1TTM A;  3F7U A;  3R16 A;  1CIN A;  1I9L A;  3HS4 A;  4Q7W A;  3JXH C;  3SAX A;  3N3J A;  3HKN A;  2FOQ A;  1CAJ A;  3M67 A;  4YX4 A;  5BRW A;  5FNG A;  4QIZ A;  5E2R A;  4L5U A;  1HCB A;  3IAI A;  1CVA A;  4K1Q A;  3HFP A;  2NWZ A;  4Q7S A;  3RZ8 A;  1CCS A;  3M14 A;  2VVA X;  1CAO A;  1KWR A;  3M04 A;  3P4V A;  2VVB X;  3DCC A;  5CLU A;  4Q8X A;  4HEZ A;  4KNI A;  1YO2 A;  1HED A;  3S72 B;  1ZGE A;  1LG5 A;  5SZ3 A;  1BV3 A;  4PQ7 A;  4COQ A;  3KON A;  4JSS A;  5FNK A;  1FQN A;  2X7T A;  1DMX A;  1OKM A;  4PYX A;  4Q6E A;  3B4F A;  5EH8 A;  4Q87 A;  4Q9Y A;  4DZ9 A;  2EU3 A;  3MNK A;  4MLX A;  5J8Z A;  4E9O X;  5FNL A;  2NXS A;  1CNJ A;  4LU3 A;  4K13 A;  1KOP A;  4RH2 A;  5AMG A;  3SBH A;  1UGF A;  5DSN A;  4ZWI A;  3RYX B;  1LUG A;  2ILI A;  5FL5 A;  3ML2 A;  1BN1 A;  5SZ4 A;  4QIY A;  4ZWY A;  2O4Z A;  4E5Q A;  4ZWX A;  4YGJ A;  4CNR A;  4E3H A;  3IBU A;  2NWY A;  4HT0 A;  1YDB A;  1I91 A;  4BF1 A;  5JG5 B;  9CA2 A;  3LXE A;  4Q09 A;  3K7K A;  5A25 A;  4YGL A;  4ILX A;  2HD6 A;  4Z1J A;  1DMY A;  1FLJ A;  1CNK A;  1TEU X;  2FW4 A;  4K0T A;  3W6H A;  3S73 B;  3T84 A;  3T83 A;  1HEC A;  3D92 A;  3DC3 A;  3V2J A;  4YWP A;  3M2Y A;  5JEG B;  1UGD A;  3M1J A;  3EFI A;  4MO8 A;  5SZ1 A;  4Y0J A;  3DD8 A;  1FQM A;  3M2X A;  1BN3 A;  4WW6 A;  1I9P A;  1IF8 A;  4E3D A;  4MDG A;  2CBD A;  4Z0Q A;  4Q7P A;  4YGK A;  3IEO A;  1YDA A;  3OYQ A;  5C8I A;  4Q06 A;  3DVB A;  3HKQ A;  3DCW A;  5CA2 A;  1LG6 A;  1BZM A;  4MTY A;  5FLO A;  1G46 A;  2NNO A;  5EH5 A;  1H9Q A;  3RLD A;  4QY3 A;  1ZSB A;  1TH9 A;  4YXI A;  3KNE A;  1IF7 A;  4G0C A;  4RUZ A;  4QK3 A;  1TEQ X;  1THK A;  4L5V A;  1BIC A;  1IF5 A;  5A6H A;  2FNM A;  2FNN A;  5EH7 A;  2AX2 A;  1ZFK A;  1BNQ A;  3UYN A;  3S9T A;  1BNU A;  3OIM A;  1HEA A;  5JGT B;  3P3J A;  4C3T A;  1RJ6 A;  3BL0 A;  2QP6 A;  3KS3 A;  2IT4 A;  3IGP A;  3B1B A;  3T5U A;  2ZNC A;  5FNJ A;  1CVH A;  1BCD A;  3RZ5 A;  5FDI A;  1G54 A;  1IF9 A;  1CNY A;  1ZSA A;  4IWZ A;  1G0F A;  3V5G A;  3S8X A;  4UOV A;  4Q7V A;  3OIK A;  3HKT A;  2X7S A;  3U47 A;  1FQL A;  3S74 B;  1OKN A;  1BNN A;  2X7U A;  3DVC A;  3NJ9 A;  4PZH A;  7CA2 A;  4E3G A;  5FLQ A;  3JXF A;  1CA3 A;  5EZT X;  3F8E A;  4YXU A;  1HUG A;  5JQT A;  3D93 A;  1JCZ A;  1XQ0 A;  2HOC A;  1H4N A;  3C7P A;  1BNT A;  4Q49 A;  4E49 A;  5IPZ A;  1CVB A;  4CNW A;  5DSK A;  5G03 A;  1CAL A;  2NN1 A;  12CA A;  1CAN A;  3MHM A;  1G45 A;  2Q1B A;  4RFD A;  1T9N A;  3M96 A;  5DSI A;  3MHC A;  2H4N A;  5DVX A;  1G6V A;  1OQ5 A;  3M1Q A;  1EOU A;  1Z93 A;  1I90 A;  3RGE A;  1Z97 A;  4FPT A;  3FFP X;  1FR7 A;  1AM6 A;  3RZ7 A;  1OKL A;  4LHI A;  4Q83 A;  4LP6 A;  3MHO A;  4FRC A;  3DAZ A;  2OSF A;  5JDV B;  4Q8Z A;  4QJP A;  3MMF A;  1RZA A;  4RUY A;  4KAP A;  1ZGF A;  1CVF A;  1UGG A;  3DD0 A;  3DCS A;  1ZH9 A;  3ZP9 A;  4YYT A;  4XFW A;  1YDD A;  3PO6 A;  4QJM A;  1BNV A;  1JD0 A;  4HU1 A;  3L14 A;  5DSL A;  5LMD A;  3DV7 A;  5BRV A;  3V3F A;  2HL4 A;  1FR4 A;  3U7C A;  5HPJ A;  4RN4 A;  1A42 A;  5CAC A;  4TWL A;  3W6I A;  2HKK A;  2HFW A;  2POW A;  4RFC A;  3RYZ A;  1XEG A;  4WW8 A;  5AML A;  2CBB A;  3BL1 A;  3R17 B;  3GZ0 A;  3M1W A;  5EOI A;  4QEF A;  5G0B A;  3IBI A;  4XIX A;  3P3H A;  1HVA A;  5EHE A;  2CAB A;  2GD8 A;  4IDR X;  3DBU A;  3MNI A;  3M5S A;  4MDL A;  1XPZ A;  2EZ7 A;  3V3H B;  1LZV A;  1CAK A;  3KIG A;  5BNL A;  5DSO A;  1CAM A;  2Q38 A;  4Q07 A;  4TWM A;  8CA2 A;  1YDC A;  5FLR A;  1CNW A;  3JXG A;  3T82 A;  3TVO X;  4YGF A;  1JV0 A;  5L6K A;  2NXR A;  2QOA A;  5DSJ A;  5E2M A;  2HNC A;  3MNH A;  2FOS A;  1KWQ A;  1CA2 A;  4CNX A;  5FNH A;  2FOU A;  1TBT X;  3S97 A;  5FLT A;  3M5E A;  4CQ0 A;  2NWP A;  3KOK A;  4QK2 A;  5DSR A;  2F14 A;  1FSQ A;  2EU2 A;  1CCU A;  1FQR A;  4HEY A;  4ZX1 A;  5E5R A;  3U45 X;  1I9M A;  3P58 A;  4N16 A;  1RAY A;  1ZSC A;  5G0C A;  4CNV A;  4M2W A;  4Q6D A;  4MDM A;  2WEH A;  4HF3 A;  1V9E A;  3FE4 A;  1CIM A;  2H15 A;  3S75 B;  3TMJ A;  1UGA A;  3F7B A;  5SZ5 A;  5DSP A;  4ETQ C;  1RZB A;  1UGC A;  3D9Z A;  4Q8Y A;  1RZC A;  5DOG A;  1TE3 X;  4K0Z A;  3VBD A;  3OKU A;  1ZFQ A;  4QSB A;  5SZ7 A;  2NXT A;  4PYY A;  2CBA A;  3V3J A;  4Z1K A;  1G48 A;  4QTL A;  4KUY A;  4YVY A;  4BF6 A;  1CNH A;  3V3G B;  2GEH A;  1Z9Y A;  3N4B A;  2QO8 A;  5FLP A;  4RIV A;  3IBN A;  3MHL A;  1CAZ A;  1UGB A;  3EFT A;  3IBL A;  4JS6 A;  4QJW A;  4N0X B;  4Q0L A;  5EHW A;  4CA2 A;  3V3I B;  3PJJ A;  4RUX A;  5FL6 A;  1CCT A;  5E2N A;  3M1K A;  3OIL A;  1KEQ A;  1G1D A;  1I9N A;  5FL4 A;  3P44 A;  3HKU A;  1CVD A;  1RZE A;  2FMZ A;  2Q1Q A;  1CAY A;  3Q31 A;  2FNK A;  4M2U A;  5DRS A;  2WD2 A;  1CNB A;  2WD3 A;  4QSI A;  3P55 A;  5SZ6 A;  2CA2 A;  2CBC A;  1V9I C;  3ZNC A;  4YGN A;  1ZE8 A;  4Q78 A;  1G52 A;  4KP8 A;  4KV0 A;  3S71 B;  3U3A X;  1CNG A;  5G01 A;  1AVN A;  5BYI A;  4QJO A;  4ZX0 A;  4DZ7 A;  1G0E A;  3OYS A;  1RAZ A;  2POV A;  2ABE A;  3BET A;  5DSM A;  5FNI A;  2NMX A;  4KNN A;  5FLS A;  3S78 B;  3D8W A;  4XZ5 A;  2WEO A;  1FSR A;  4ITO A;  3CA2 A;  1CNC A;  1MUA A;  2NN7 A;  1F2W A;  1RZD A;  4FVN A;  4R5A A;  1CNX A;  4QJX A;  4KUV A;  2NWO A;  1HEB A;  1CAH A;  3M2Z A;  1CNI A;  4WR7 A;  1BNW A;  3S76 A;  1G3Z A;  3RG3 A;  3SAP A;  4M2R A;  3RG4 A;  5BRU A;  1H9N A;  3V2M A;  5FDC A;  2W2J A;  4FL7 A;  4JSW A;  4FVO A;  3RYJ B;  5EKM A;  5JGS B;  4KUW A;  5DOH A;  5FNM A;  2POU A;  3MYQ A;  4K0S A;  5EKJ A;  4X5S A;  3N2P A;  1URT A;  5E2K A;  2WEJ A;  4KP5 A;  5JEP B;  3NB5 A;  1I9O A;  4MLT A;  5JEH B;  4ITP A;  1G4J A;  3MNA A;  4R59 A;  1TG9 A;  4WL4 A;  4G7A A;  3KLD B;  1TB0 X;  4R5B A;  2OSM A;  3M40 A;  4XE1 A;  4QSA A;  1CVE A;  3FW3 A;  1BN4 A;  3M98 A;  4HBA A;  4Z1E A;  5AMD A;  4E4A A;  3CYU A;  3D0N A;  3KWA A;  1G53 A;  5JQ0 A;  3OY0 A;  4YXO A;  4HEW A;  1YO1 A;  3OKV A;  2CBE A;  1CAI A;  3K2F A;  3MHI A;  3M3X A;  1TG3 A;  2FOY A;  1HCA A;  4Q99 A;  4KNJ A;  4QJ0 A;  3DA2 A;  4XIW A;  1I8Z A;  1YO0 A;  5E2S A;  5L3O A;  4Z1N A;  3RZ1 B;  1HUH A;  3N0N A;  3CZV A;  3ML5 A;  3M2N A;  3UYQ A;  3MDZ A;  1AZM A;  3S77 B;  1CVC A;  3P5L A;  4L5W A;  3RJ7 A;  4YHA A;  5JG3 B;  1IF4 A;  5DSQ A;  3KKX A;  5SZ0 A;  4WUP A;  3DC9 A;  1IF6 A;  4BCW A;  4RIU A;  3HLJ A;  1FSN A;  3M5T A;  3QYK A;  3MZC A;  3K34 A;  3KOI A;  3NI5 A;  1CIL A;  4GL1 X;  1MOO A;  3MNJ A;  3PYK A;  5EKH A;  4Q90 A;  3RYV B;  5EHV A;  4FU5 A;  2AW1 A;  3MWO A;  1BNM A;  1J9W A;  3MNU A;  5CJF A;  1ZNC A;  4JSA A;  4Q81 A;  2NNV A;  4JSZ A;  3P5A A;  4ZWZ A;  5E5U A;  3T5Z A;  1DCA A;  5EIJ A;  4QSJ A;  3RYY A;  1I9Q A;  2NNG A;  3F4X A;  4QK1 A;  1Y7W A;  5E28 A;  4ZAO A;  4E3F A;  5SZ2 A;  1XEV A;  2FOV A;  3TVN X;  2NNS A;  3CAJ A;  1RJ5 A;  1UGE A;  1CZM A;  1CRA A;  3SBI A;  3RZ0 B;  3T85 A;  1LGD A;  4PXX A; 
#chains in the Genus database with same CATH homology
 4CAC A;  4Q08 A;  1KOQ A;  5JES B;  1CRM A;  1DCB A;  2WEG A;  4HT2 A;  2FMG A;  6CA2 A;  4KNM A;  4FIK A;  3DVD A;  3V7X A;  4WUQ A;  1G4O A;  4M2V A;  1TTM A;  3F7U A;  3R16 A;  1CIN A;  1I9L A;  3HS4 A;  4Q7W A;  3JXH C;  3SAX A;  3N3J A;  3HKN A;  2FOQ A;  1CAJ A;  3M67 A;  4YX4 A;  5BRW A;  5FNG A;  4QIZ A;  5E2R A;  4L5U A;  1HCB A;  3IAI A;  1CVA A;  4K1Q A;  3HFP A;  2NWZ A;  4Q7S A;  3RZ8 A;  1CCS A;  3M14 A;  2VVA X;  1CAO A;  1KWR A;  3M04 A;  3P4V A;  2VVB X;  3DCC A;  5CLU A;  4Q8X A;  4HEZ A;  4KNI A;  1YO2 A;  1HED A;  3S72 B;  1ZGE A;  1LG5 A;  5SZ3 A;  1BV3 A;  4PQ7 A;  4COQ A;  3KON A;  4JSS A;  5FNK A;  1FQN A;  2X7T A;  1DMX A;  1OKM A;  4PYX A;  4Q6E A;  3B4F A;  5EH8 A;  4Q87 A;  4Q9Y A;  4DZ9 A;  2EU3 A;  3MNK A;  4MLX A;  5J8Z A;  4E9O X;  5FNL A;  2NXS A;  1CNJ A;  4LU3 A;  4K13 A;  1KOP A;  4RH2 A;  5AMG A;  3SBH A;  1UGF A;  5DSN A;  4ZWI A;  3RYX B;  1LUG A;  2ILI A;  5FL5 A;  3ML2 A;  1BN1 A;  5SZ4 A;  4QIY A;  4ZWY A;  2O4Z A;  4E5Q A;  4ZWX A;  4YGJ A;  4CNR A;  4E3H A;  3IBU A;  2NWY A;  4HT0 A;  1YDB A;  1I91 A;  4BF1 A;  5JG5 B;  9CA2 A;  3LXE A;  4Q09 A;  3K7K A;  5A25 A;  4YGL A;  4ILX A;  2HD6 A;  4Z1J A;  1DMY A;  1FLJ A;  1CNK A;  1TEU X;  2FW4 A;  4K0T A;  3W6H A;  3S73 B;  3T84 A;  3T83 A;  1HEC A;  3D92 A;  3DC3 A;  3V2J A;  4YWP A;  3M2Y A;  5JEG B;  1UGD A;  3M1J A;  3EFI A;  4MO8 A;  5SZ1 A;  4Y0J A;  3DD8 A;  1FQM A;  3M2X A;  1BN3 A;  4WW6 A;  1I9P A;  1IF8 A;  4E3D A;  4MDG A;  2CBD A;  4Z0Q A;  4Q7P A;  4YGK A;  3IEO A;  1YDA A;  3OYQ A;  5C8I A;  4Q06 A;  3DVB A;  3HKQ A;  3DCW A;  5CA2 A;  1LG6 A;  1BZM A;  4MTY A;  5FLO A;  1G46 A;  2NNO A;  5EH5 A;  1H9Q A;  3RLD A;  4QY3 A;  1ZSB A;  1TH9 A;  4YXI A;  3KNE A;  1IF7 A;  4G0C A;  4RUZ A;  4QK3 A;  1TEQ X;  1THK A;  4L5V A;  1BIC A;  1IF5 A;  5A6H A;  2FNM A;  2FNN A;  5EH7 A;  2AX2 A;  1ZFK A;  1BNQ A;  3UYN A;  3S9T A;  1BNU A;  3OIM A;  1HEA A;  5JGT B;  3P3J A;  4C3T A;  1RJ6 A;  3BL0 A;  2QP6 A;  3KS3 A;  2IT4 A;  3IGP A;  3B1B A;  3T5U A;  2ZNC A;  5FNJ A;  1CVH A;  1BCD A;  3RZ5 A;  5FDI A;  1G54 A;  1IF9 A;  1CNY A;  1ZSA A;  4IWZ A;  1G0F A;  3V5G A;  3S8X A;  4UOV A;  4Q7V A;  3OIK A;  3HKT A;  2X7S A;  3U47 A;  1FQL A;  3S74 B;  1OKN A;  1BNN A;  2X7U A;  3DVC A;  3NJ9 A;  4PZH A;  7CA2 A;  4E3G A;  5FLQ A;  3JXF A;  1CA3 A;  5EZT X;  3F8E A;  4YXU A;  1HUG A;  5JQT A;  3D93 A;  1JCZ A;  1XQ0 A;  2HOC A;  1H4N A;  3C7P A;  1BNT A;  4Q49 A;  4E49 A;  5IPZ A;  1CVB A;  4CNW A;  5DSK A;  5G03 A;  1CAL A;  2NN1 A;  12CA A;  1CAN A;  3MHM A;  1G45 A;  2Q1B A;  4RFD A;  1T9N A;  3M96 A;  5DSI A;  3MHC A;  2H4N A;  5DVX A;  1G6V A;  1OQ5 A;  3M1Q A;  1EOU A;  1Z93 A;  1I90 A;  3RGE A;  1Z97 A;  4FPT A;  3FFP X;  1FR7 A;  1AM6 A;  3RZ7 A;  1OKL A;  4LHI A;  4Q83 A;  4LP6 A;  3MHO A;  4FRC A;  3DAZ A;  2OSF A;  5JDV B;  4Q8Z A;  4QJP A;  3MMF A;  1RZA A;  4RUY A;  4KAP A;  1ZGF A;  1CVF A;  1UGG A;  3DD0 A;  3DCS A;  1ZH9 A;  3ZP9 A;  4YYT A;  4XFW A;  1YDD A;  3PO6 A;  4QJM A;  1BNV A;  1JD0 A;  4HU1 A;  3L14 A;  5DSL A;  5LMD A;  3DV7 A;  5BRV A;  3V3F A;  2HL4 A;  1FR4 A;  3U7C A;  5HPJ A;  4RN4 A;  1A42 A;  5CAC A;  4TWL A;  3W6I A;  2HKK A;  2HFW A;  2POW A;  4RFC A;  3RYZ A;  1XEG A;  4WW8 A;  5AML A;  2CBB A;  3BL1 A;  3R17 B;  3GZ0 A;  3M1W A;  5EOI A;  4QEF A;  5G0B A;  3IBI A;  4XIX A;  3P3H A;  1HVA A;  5EHE A;  2CAB A;  2GD8 A;  4IDR X;  3DBU A;  3MNI A;  3M5S A;  4MDL A;  1XPZ A;  2EZ7 A;  3V3H B;  1LZV A;  1CAK A;  3KIG A;  5BNL A;  5DSO A;  1CAM A;  2Q38 A;  4Q07 A;  4TWM A;  8CA2 A;  1YDC A;  5FLR A;  1CNW A;  3JXG A;  3T82 A;  3TVO X;  4YGF A;  1JV0 A;  5L6K A;  2NXR A;  2QOA A;  5DSJ A;  5E2M A;  2HNC A;  3MNH A;  2FOS A;  1KWQ A;  1CA2 A;  4CNX A;  5FNH A;  2FOU A;  1TBT X;  3S97 A;  5FLT A;  3M5E A;  4CQ0 A;  2NWP A;  3KOK A;  4QK2 A;  5DSR A;  2F14 A;  1FSQ A;  2EU2 A;  1CCU A;  1FQR A;  4HEY A;  4ZX1 A;  5E5R A;  3U45 X;  1I9M A;  3P58 A;  4N16 A;  1RAY A;  1ZSC A;  5G0C A;  4CNV A;  4M2W A;  4Q6D A;  4MDM A;  2WEH A;  4HF3 A;  1V9E A;  3FE4 A;  1CIM A;  2H15 A;  3S75 B;  3TMJ A;  1UGA A;  3F7B A;  5SZ5 A;  5DSP A;  4ETQ C;  1RZB A;  1UGC A;  3D9Z A;  4Q8Y A;  1RZC A;  5DOG A;  1TE3 X;  4K0Z A;  3VBD A;  3OKU A;  1ZFQ A;  4QSB A;  5SZ7 A;  2NXT A;  4PYY A;  2CBA A;  3V3J A;  4Z1K A;  1G48 A;  4QTL A;  4KUY A;  4YVY A;  4BF6 A;  1CNH A;  3V3G B;  2GEH A;  1Z9Y A;  3N4B A;  2QO8 A;  5FLP A;  4RIV A;  3IBN A;  3MHL A;  1CAZ A;  1UGB A;  3EFT A;  3IBL A;  4JS6 A;  4QJW A;  4N0X B;  4Q0L A;  5EHW A;  4CA2 A;  3V3I B;  3PJJ A;  4RUX A;  5FL6 A;  1CCT A;  5E2N A;  3M1K A;  3OIL A;  1KEQ A;  1G1D A;  1I9N A;  5FL4 A;  3P44 A;  3HKU A;  1CVD A;  1RZE A;  2FMZ A;  2Q1Q A;  1CAY A;  3Q31 A;  2FNK A;  4M2U A;  5DRS A;  2WD2 A;  1CNB A;  2WD3 A;  4QSI A;  3P55 A;  5SZ6 A;  2CA2 A;  2CBC A;  1V9I C;  3ZNC A;  4YGN A;  1ZE8 A;  4Q78 A;  1G52 A;  4KP8 A;  4KV0 A;  3S71 B;  3U3A X;  1CNG A;  5G01 A;  1AVN A;  5BYI A;  4QJO A;  4ZX0 A;  4DZ7 A;  1G0E A;  3OYS A;  1RAZ A;  2POV A;  2ABE A;  3BET A;  5DSM A;  5FNI A;  2NMX A;  4KNN A;  5FLS A;  3S78 B;  3D8W A;  4XZ5 A;  2WEO A;  1FSR A;  4ITO A;  3CA2 A;  1CNC A;  1MUA A;  2NN7 A;  1F2W A;  1RZD A;  4FVN A;  4R5A A;  1CNX A;  4QJX A;  4KUV A;  2NWO A;  1HEB A;  1CAH A;  3M2Z A;  1CNI A;  4WR7 A;  1BNW A;  3S76 A;  1G3Z A;  3RG3 A;  3SAP A;  4M2R A;  3RG4 A;  5BRU A;  1H9N A;  3V2M A;  5FDC A;  2W2J A;  4FL7 A;  4JSW A;  4FVO A;  3RYJ B;  5EKM A;  5JGS B;  4KUW A;  5DOH A;  5FNM A;  2POU A;  3MYQ A;  4K0S A;  5EKJ A;  4X5S A;  3N2P A;  1URT A;  5E2K A;  2WEJ A;  4KP5 A;  5JEP B;  3NB5 A;  1I9O A;  4MLT A;  5JEH B;  4ITP A;  1G4J A;  3MNA A;  4R59 A;  1TG9 A;  4WL4 A;  4G7A A;  3KLD B;  1TB0 X;  4R5B A;  2OSM A;  3M40 A;  4XE1 A;  4QSA A;  1CVE A;  3FW3 A;  1BN4 A;  3M98 A;  4HBA A;  4Z1E A;  5AMD A;  4E4A A;  3CYU A;  3D0N A;  3KWA A;  1G53 A;  5JQ0 A;  3OY0 A;  4YXO A;  4HEW A;  1YO1 A;  3OKV A;  2CBE A;  1CAI A;  3K2F A;  3MHI A;  3M3X A;  1TG3 A;  2FOY A;  1HCA A;  4Q99 A;  4KNJ A;  4QJ0 A;  3DA2 A;  4XIW A;  1I8Z A;  1YO0 A;  5E2S A;  5L3O A;  4Z1N A;  3RZ1 B;  1HUH A;  3N0N A;  3CZV A;  3ML5 A;  3M2N A;  3UYQ A;  3MDZ A;  1AZM A;  3S77 B;  1CVC A;  3P5L A;  4L5W A;  3RJ7 A;  4YHA A;  5JG3 B;  1IF4 A;  5DSQ A;  3KKX A;  5SZ0 A;  4WUP A;  3DC9 A;  1IF6 A;  4BCW A;  4RIU A;  3HLJ A;  1FSN A;  3M5T A;  3QYK A;  3MZC A;  3K34 A;  3KOI A;  3NI5 A;  1CIL A;  4GL1 X;  1MOO A;  3MNJ A;  3PYK A;  5EKH A;  4Q90 A;  3RYV B;  5EHV A;  4FU5 A;  2AW1 A;  3MWO A;  1BNM A;  1J9W A;  3MNU A;  5CJF A;  1ZNC A;  4JSA A;  4Q81 A;  2NNV A;  4JSZ A;  3P5A A;  4ZWZ A;  5E5U A;  3T5Z A;  1DCA A;  5EIJ A;  4QSJ A;  3RYY A;  1I9Q A;  2NNG A;  3F4X A;  4QK1 A;  1Y7W A;  5E28 A;  4ZAO A;  4E3F A;  5SZ2 A;  1XEV A;  2FOV A;  3TVN X;  2NNS A;  3CAJ A;  1RJ5 A;  1UGE A;  1CZM A;  1CRA A;  3SBI A;  3RZ0 B;  3T85 A;  1LGD A;  4PXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...