1I9OA

Carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2,3,4-trifluorophenyl)methyl]-benzamide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE II
publication title Fluoroaromatic-fluoroaromatic interactions between inhibitors bound in the crystal lattice of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 73
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1i9oA00
4M2VA 4QTLA 1RZDA 3JXGA 4IDRX 3V3GB 1CVCA 1CNKA 4KAPA 2HFWA 2FNNA 4FIKA 1G53A 3M3XA 4Q7VA 3DD8A 4E5QA 1ZSBA 3FFPX 1CA2A 3BL0A 3MNKA 2WEGA 5E2RA 5E2SA 3HKTA 3M2ZA 3RYYA 2OSMA 4FRCA 4CNWA 3P58A 5DSKA 3CYUA 4HT0A 4CQ0A 3DA2A 3MMFA 1YDCA 2WD3A 3ML2A 5FNGA 4N16A 4FU5A 4ITOA 3S73B 4E3FA 4Q81A 1G4OA 4Q6DA 3TVNX 3K2FA 3M1WA 5EHWA 2QO8A 1CNYA 1DMYA 2HD6A 5AMLA 4QY3A 3T82A 3U45X 1CAIA 2CBAA 3S8XA 4RIUA 1I9NA 3M2NA 5FLRA 3RYZA 4KUVA 2AX2A 4XIWA 1I9QA 3CAJA 3M14A 1THKA 2WEOA 5G01A 4Q07A 4RFCA 1AZMA 4Q87A 4KUYA 3M5EA 3ML5A 1OKMA 3NI5A 1HVAA 4G7AA 2HOCA 3RYXB 3F8EA 4DZ9A 1CNGA 2NWZA 3MZCA 1CA3A 1HUHA 1DMXA 4QSBA 5EKJA 5DRSA 4CNVA 1UGDA 3IEOA 5C8IA 2EU2A 5A25A 2CBCA 2IT4A 4UOVA 1JV0A 4Q6EA 3D0NA 1XPZA 2ABEA 5EIJA 4Z1EA 3T83A 1RAYA 1CNCA 1JCZA 2CBDA 4WW8A 1CALA 3V3FA 5DSIA 1RZEA 5EKHA 3IBIA 5G0CA 4QJPA 3MWOA 1IF5A 1ZSAA 1TE3X 2NWPA 3MNIA 1YDBA 4Q8ZA 1RAZA 4YXUA 3JXFA 5SZ6A 3RZ7A 2NNOA 5BRVA 1BN3A 4PQ7A 4BF6A 1RZBA 1CVFA 1IF7A 4RUYA 4Q8YA 3RZ8A 1MUAA 4C3TA 5SZ4A 4KP5A 2NNVA 4Q49A 3MHOA 1OKLA 3TVOX 2FOVA 5LMDA 3M67A 4GL1X 4Z1KA 4E49A 1KOPA 1FLJA 1CANA 4QIYA 3OY0A 1I90A 4M2UA 1I9LA 4R59A 5G0BA 3T5ZA 1RJ6A 3D8WA 4QSJA 4YYTA 2WD2A 3JXHC 3DBUA 1CNBA 1Z97A 3KWAA 3BETA 3KOIA 3CA2A 3M2YA 3L14A 5EZTX 3RYJB 4ZX1A 2EU3A 3DCWA 1A42A 2CBEA 1ZGEA 1BNTA 3RLDA 4Z0QA 1OQ5A 5FL6A 4COQA 5FNMA 1G0FA 3P5LA 4PXXA 2VVAX 1CVBA 2CBBA 1TEQX 3K7KA 3HS4A 4ZWYA 1CRMA 2FNMA 5JEHB 4E3DA 4Z1JA 1DCBA 1TB0X 4PZHA 1G52A 5E2KA 4KNIA 2WEJA 2QOAA 1LZVA 3UYNA 1G48A 3IBUA 1HCAA 3M5SA 2X7UA 5CA2A 2NXTA 3UYQA 2FW4A 1YO1A 2AW1A 4IWZA 3S9TA 5JDVB 3LXEA 1UGCA 1BN4A 3RZ5A 4XZ5A 4K0SA 4YXIA 3DC3A 5FNHA 4TWLA 3SAXA 2POUA 3DD0A 3P44A 3P3HA 4RH2A 1IF8A 4RIVA 1Z9YA 8CA2A 3M1QA 1KOQA 5DVXA 4LHIA 3R16A 4L5UA 3OIMA 5CLUA 3RZ0B 3KKXA 1J9WA 4WUQA 3T5UA 1LGDA 2NXRA 4X5SA 3EFTA 2CA2A 4XFWA 4ZAOA 5SZ2A 1CNXA 1I9PA 1YO0A 2Q38A 4MLTA 3RG3A 4FPTA 1H9NA 1I9MA 3ZP9A 5EH7A 1FQLA 3DVDA 3F4XA 2WEHA 4CA2A 5EH5A 3PO6A 3S76A 1YDAA 5E5UA 2Q1BA 2ILIA 3HFPA 3NB5A 1IF6A 1G1DA 4Q06A 4WR7A 1BNMA 1JD0A 2W2JA 3MYQA 4BCWA 5DSJA 2FMGA 3FE4A 2FNKA 3RG4A 4XE1A 4Q9YA 3OKVA 4K13A 3DVBA 1TBTX 3B4FA 4L5WA 1G54A 2CABA 3D93A 5JESB 4HEZA 5IPZA 3MNJA 2NNGA 1ZGFA 2POVA 3FW3A 1CVAA 1CVEA 1FSRA 3MHLA 1CINA 5BRWA 1ZH9A 2HL4A 5FLSA 3B1BA 1F2WA 1Z93A 3SBHA 3DCCA 4QSIA 3HKUA 4RN4A 1UGAA 5DOGA 5J8ZA 4CNXA 4QK3A 1CAHA 1CCTA 4QJMA 3W6HA 2F14A 1BNNA 4K0ZA 3RGEA 1HEAA 3R17B 1CCSA 1CCUA 1FSQA 5G03A 3BL1A 1BNVA 4HEWA 2O4ZA 5A6HA 4KNMA 4CACA 3P3JA 3T85A 4JSAA 4HEYA 5EH8A 5JEGB 5L6KA 4ITPA 3M2XA 3GZ0A 1TG9A 5DSQA 4Q7SA 4KNJA 1H9QA 1KWQA 3CZVA 5FLPA 5BNLA 5FLQA 4RFDA 2X7SA 1EOUA 5JG3B 1CNHA 3HKNA 4MDLA 1CVHA 4M2WA 4YXOA 2FOSA 3MHCA 4MDMA 4XIXA 1I9OA 5FNLA 2HNCA 1XEVA 3U47A 3S77B 3S78B 3DVCA 1CAMA 3HLJA 5EOIA 5AMGA 2NN7A 4Q99A 2H15A 3QYKA 5SZ0A 3TMJA 2POWA 5EHEA 2H4NA 1KWRA 3NJ9A 2EZ7A 5FLTA 3V3HB 3KONA 2VVBX 5JGSB 5JEPB 3P4VA 3MNAA 3OIKA 3SBIA 1CAOA 4JSSA 4HBAA 1URTA 4LU3A 4YX4A 3KNEA 1BNQA 4Q90A 3MHMA 3K34A 4ILXA 1Y7WA 1CAYA 5FDCA 1CILA 2QP6A 2X7TA 1XEGA 4ETQC 1UGGA 1HEBA 2Q1QA 4HT2A 5DSNA 3T84A 5CJFA 1G4JA 5E2NA 1BN1A 3MDZA 3V7XA 3M5TA 4PYYA 1ZNCA 4YGNA 3SAPA 1OKNA 4JSWA 1IF4A 5FDIA 4Q8XA 5DSPA 3OILA 2NN1A 3M1JA 1CVDA 1TTMA 5DSMA 1FQMA 1IF9A 1ZE8A 2FOYA 4YGKA 4QJ0A 5JG5B 4FL7A 5JQ0A 1DCAA 1UGFA 2NWYA 4KNNA 4JSZA 5DOHA 5FL4A 5FL5A 4KV0A 5CACA 7CA2A 1V9IC 4QJOA 3F7BA 5FNIA 3V5GA 5AMDA 4N0XB 1XQ0A 4L5VA 4G0CA 1YDDA 1BZMA 5SZ1A 3IBLA 5SZ3A 4MTYA 5EHVA 3V3JA 2GD8A 1T9NA 4ZX0A 1G3ZA 1LUGA 12CAA 1UGBA 3D92A 1BNWA 1CNJA 3U3AX 3PYKA 4Q78A 4K1QA 4KP8A 4QK1A 5JQTA 4YWPA 4QK2A 3KOKA 1LG6A 4K0TA 4MO8A 3DV7A 1G45A 4YGFA 3S72B 1FQNA 5DSOA 4E3HA 1HEDA 2FMZA 2ZNCA 3EFIA 3N0NA 4ZWZA 3V3IB 1KEQA 3RJ7A 3M40A 4E3GA 3OYQA 1ZSCA 5E2MA 5BYIA 1CAKA 1YO2A 1HECA 3DC9A 1HCBA 1AVNA 4RUZA 4Q09A 4QEFA 1HUGA 1CAZA 1TH9A 5EKMA 1FQRA 4E9OX 1BNUA 4M2RA 3D9ZA 3Q31A 1UGEA 5JGTB 4FVNA 3OKUA 4YVYA 5E5RA 3KIGA 3S97A 1CRAA 1CZMA 5FNJA 5SZ5A 3M98A 4Q7WA 4Q08A 3W6IA 1CIMA 4QSAA 4MLXA 6CA2A 1CAJA 5SZ7A 3DCSA 4PYXA 1LG5A 4YGJA 4ZWXA 1BV3A 2FOQA 4R5BA 1FSNA 3MNUA 4KUWA 1G0EA 4R5AA 3N4BA 2NXSA 3N3JA 3P55A 5DSRA 1AM6A 5FLOA 4WL4A 3V2MA 5BRUA 3F7UA 4JS6A 1G46A 3IBNA 5E28A 3N2PA 2HKKA 4TWMA 4BF1A 1CNIA 1RZAA 3P5AA 1BICA 4DZ7A 3IGPA 3U7CA 4LP6A 3DAZA 4Q83A 2NWOA 2NMXA 3HKQA 3S75B 4Q7PA 4Y0JA 4YHAA 5DSLA 1FR7A 2OSFA 2NNSA 4HF3A 3KLDB 2FOUA 1CNWA 5FNKA 1FR4A 4Z1NA 4WUPA 3MHIA 3S74B 3RYVB 4HU1A 9CA2A 3RZ1B 1ZFQA 3M1KA 4E4AA 1RZCA 1H4NA 3KS3A 3V2JA 4QJWA 3M04A 3IAIA 4CNRA 1TEUX 5L3OA 4ZWIA 4MDGA 3S71B 1V9EA 3M96A 5HPJA 1TG3A 4YGLA 4Q0LA 1I8ZA 3VBDA 1MOOA 4QIZA 3MNHA 1RJ5A 3OYSA 3PJJA 3ZNCA 4QJXA 2GEHA 4WW6A 1BCDA 4FVOA 1G6VA 1ZFKA 3C7PA 1I91A 4RUXA
chains in the Genus database with same CATH superfamily
4M2VA 4QTLA 1RZDA 3JXGA 4IDRX 3V3GB 1CVCA 1CNKA 4KAPA 2HFWA 2FNNA 4FIKA 1G53A 3M3XA 4Q7VA 3DD8A 4E5QA 1ZSBA 3FFPX 1CA2A 3BL0A 3MNKA 2WEGA 5E2RA 5E2SA 3HKTA 3M2ZA 3RYYA 2OSMA 4FRCA 4CNWA 3P58A 5DSKA 3CYUA 4HT0A 4CQ0A 3DA2A 3MMFA 1YDCA 2WD3A 3ML2A 5FNGA 4N16A 4FU5A 4ITOA 3S73B 4E3FA 4Q81A 1G4OA 4Q6DA 3TVNX 3K2FA 3M1WA 5EHWA 2QO8A 1CNYA 1DMYA 2HD6A 5AMLA 4QY3A 3T82A 3U45X 1CAIA 2CBAA 3S8XA 4RIUA 1I9NA 3M2NA 5FLRA 3RYZA 4KUVA 2AX2A 4XIWA 1I9QA 3CAJA 3M14A 1THKA 2WEOA 5G01A 4Q07A 4RFCA 1AZMA 4Q87A 4KUYA 3M5EA 3ML5A 1OKMA 3NI5A 1HVAA 4G7AA 2HOCA 3RYXB 3F8EA 4DZ9A 1CNGA 2NWZA 3MZCA 1CA3A 1HUHA 1DMXA 4QSBA 5EKJA 5DRSA 4CNVA 1UGDA 3IEOA 5C8IA 2EU2A 5A25A 2CBCA 2IT4A 4UOVA 1JV0A 4Q6EA 3D0NA 1XPZA 2ABEA 5EIJA 4Z1EA 3T83A 1RAYA 1CNCA 1JCZA 2CBDA 4WW8A 1CALA 3V3FA 5DSIA 1RZEA 5EKHA 3IBIA 5G0CA 4QJPA 3MWOA 1IF5A 1ZSAA 1TE3X 2NWPA 3MNIA 1YDBA 4Q8ZA 1RAZA 4YXUA 3JXFA 5SZ6A 3RZ7A 2NNOA 5BRVA 1BN3A 4PQ7A 4BF6A 1RZBA 1CVFA 1IF7A 4RUYA 4Q8YA 3RZ8A 1MUAA 4C3TA 5SZ4A 4KP5A 2NNVA 4Q49A 3MHOA 1OKLA 3TVOX 2FOVA 5LMDA 3M67A 4GL1X 4Z1KA 4E49A 1KOPA 1FLJA 1CANA 4QIYA 3OY0A 1I90A 4M2UA 1I9LA 4R59A 5G0BA 3T5ZA 1RJ6A 3D8WA 4QSJA 4YYTA 2WD2A 3JXHC 3DBUA 1CNBA 1Z97A 3KWAA 3BETA 3KOIA 3CA2A 3M2YA 3L14A 5EZTX 3RYJB 4ZX1A 2EU3A 3DCWA 1A42A 2CBEA 1ZGEA 1BNTA 3RLDA 4Z0QA 1OQ5A 5FL6A 4COQA 5FNMA 1G0FA 3P5LA 4PXXA 2VVAX 1CVBA 2CBBA 1TEQX 3K7KA 3HS4A 4ZWYA 1CRMA 2FNMA 5JEHB 4E3DA 4Z1JA 1DCBA 1TB0X 4PZHA 1G52A 5E2KA 4KNIA 2WEJA 2QOAA 1LZVA 3UYNA 1G48A 3IBUA 1HCAA 3M5SA 2X7UA 5CA2A 2NXTA 3UYQA 2FW4A 1YO1A 2AW1A 4IWZA 3S9TA 5JDVB 3LXEA 1UGCA 1BN4A 3RZ5A 4XZ5A 4K0SA 4YXIA 3DC3A 5FNHA 4TWLA 3SAXA 2POUA 3DD0A 3P44A 3P3HA 4RH2A 1IF8A 4RIVA 1Z9YA 8CA2A 3M1QA 1KOQA 5DVXA 4LHIA 3R16A 4L5UA 3OIMA 5CLUA 3RZ0B 3KKXA 1J9WA 4WUQA 3T5UA 1LGDA 2NXRA 4X5SA 3EFTA 2CA2A 4XFWA 4ZAOA 5SZ2A 1CNXA 1I9PA 1YO0A 2Q38A 4MLTA 3RG3A 4FPTA 1H9NA 1I9MA 3ZP9A 5EH7A 1FQLA 3DVDA 3F4XA 2WEHA 4CA2A 5EH5A 3PO6A 3S76A 1YDAA 5E5UA 2Q1BA 2ILIA 3HFPA 3NB5A 1IF6A 1G1DA 4Q06A 4WR7A 1BNMA 1JD0A 2W2JA 3MYQA 4BCWA 5DSJA 2FMGA 3FE4A 2FNKA 3RG4A 4XE1A 4Q9YA 3OKVA 4K13A 3DVBA 1TBTX 3B4FA 4L5WA 1G54A 2CABA 3D93A 5JESB 4HEZA 5IPZA 3MNJA 2NNGA 1ZGFA 2POVA 3FW3A 1CVAA 1CVEA 1FSRA 3MHLA 1CINA 5BRWA 1ZH9A 2HL4A 5FLSA 3B1BA 1F2WA 1Z93A 3SBHA 3DCCA 4QSIA 3HKUA 4RN4A 1UGAA 5DOGA 5J8ZA 4CNXA 4QK3A 1CAHA 1CCTA 4QJMA 3W6HA 2F14A 1BNNA 4K0ZA 3RGEA 1HEAA 3R17B 1CCSA 1CCUA 1FSQA 5G03A 3BL1A 1BNVA 4HEWA 2O4ZA 5A6HA 4KNMA 4CACA 3P3JA 3T85A 4JSAA 4HEYA 5EH8A 5JEGB 5L6KA 4ITPA 3M2XA 3GZ0A 1TG9A 5DSQA 4Q7SA 4KNJA 1H9QA 1KWQA 3CZVA 5FLPA 5BNLA 5FLQA 4RFDA 2X7SA 1EOUA 5JG3B 1CNHA 3HKNA 4MDLA 1CVHA 4M2WA 4YXOA 2FOSA 3MHCA 4MDMA 4XIXA 1I9OA 5FNLA 2HNCA 1XEVA 3U47A 3S77B 3S78B 3DVCA 1CAMA 3HLJA 5EOIA 5AMGA 2NN7A 4Q99A 2H15A 3QYKA 5SZ0A 3TMJA 2POWA 5EHEA 2H4NA 1KWRA 3NJ9A 2EZ7A 5FLTA 3V3HB 3KONA 2VVBX 5JGSB 5JEPB 3P4VA 3MNAA 3OIKA 3SBIA 1CAOA 4JSSA 4HBAA 1URTA 4LU3A 4YX4A 3KNEA 1BNQA 4Q90A 3MHMA 3K34A 4ILXA 1Y7WA 1CAYA 5FDCA 1CILA 2QP6A 2X7TA 1XEGA 4ETQC 1UGGA 1HEBA 2Q1QA 4HT2A 5DSNA 3T84A 5CJFA 1G4JA 5E2NA 1BN1A 3MDZA 3V7XA 3M5TA 4PYYA 1ZNCA 4YGNA 3SAPA 1OKNA 4JSWA 1IF4A 5FDIA 4Q8XA 5DSPA 3OILA 2NN1A 3M1JA 1CVDA 1TTMA 5DSMA 1FQMA 1IF9A 1ZE8A 2FOYA 4YGKA 4QJ0A 5JG5B 4FL7A 5JQ0A 1DCAA 1UGFA 2NWYA 4KNNA 4JSZA 5DOHA 5FL4A 5FL5A 4KV0A 5CACA 7CA2A 1V9IC 4QJOA 3F7BA 5FNIA 3V5GA 5AMDA 4N0XB 1XQ0A 4L5VA 4G0CA 1YDDA 1BZMA 5SZ1A 3IBLA 5SZ3A 4MTYA 5EHVA 3V3JA 2GD8A 1T9NA 4ZX0A 1G3ZA 1LUGA 12CAA 1UGBA 3D92A 1BNWA 1CNJA 3U3AX 3PYKA 4Q78A 4K1QA 4KP8A 4QK1A 5JQTA 4YWPA 4QK2A 3KOKA 1LG6A 4K0TA 4MO8A 3DV7A 1G45A 4YGFA 3S72B 1FQNA 5DSOA 4E3HA 1HEDA 2FMZA 2ZNCA 3EFIA 3N0NA 4ZWZA 3V3IB 1KEQA 3RJ7A 3M40A 4E3GA 3OYQA 1ZSCA 5E2MA 5BYIA 1CAKA 1YO2A 1HECA 3DC9A 1HCBA 1AVNA 4RUZA 4Q09A 4QEFA 1HUGA 1CAZA 1TH9A 5EKMA 1FQRA 4E9OX 1BNUA 4M2RA 3D9ZA 3Q31A 1UGEA 5JGTB 4FVNA 3OKUA 4YVYA 5E5RA 3KIGA 3S97A 1CRAA 1CZMA 5FNJA 5SZ5A 3M98A 4Q7WA 4Q08A 3W6IA 1CIMA 4QSAA 4MLXA 6CA2A 1CAJA 5SZ7A 3DCSA 4PYXA 1LG5A 4YGJA 4ZWXA 1BV3A 2FOQA 4R5BA 1FSNA 3MNUA 4KUWA 1G0EA 4R5AA 3N4BA 2NXSA 3N3JA 3P55A 5DSRA 1AM6A 5FLOA 4WL4A 3V2MA 5BRUA 3F7UA 4JS6A 1G46A 3IBNA 5E28A 3N2PA 2HKKA 4TWMA 4BF1A 1CNIA 1RZAA 3P5AA 1BICA 4DZ7A 3IGPA 3U7CA 4LP6A 3DAZA 4Q83A 2NWOA 2NMXA 3HKQA 3S75B 4Q7PA 4Y0JA 4YHAA 5DSLA 1FR7A 2OSFA 2NNSA 4HF3A 3KLDB 2FOUA 1CNWA 5FNKA 1FR4A 4Z1NA 4WUPA 3MHIA 3S74B 3RYVB 4HU1A 9CA2A 3RZ1B 1ZFQA 3M1KA 4E4AA 1RZCA 1H4NA 3KS3A 3V2JA 4QJWA 3M04A 3IAIA 4CNRA 1TEUX 5L3OA 4ZWIA 4MDGA 3S71B 1V9EA 3M96A 5HPJA 1TG3A 4YGLA 4Q0LA 1I8ZA 3VBDA 1MOOA 4QIZA 3MNHA 1RJ5A 3OYSA 3PJJA 3ZNCA 4QJXA 2GEHA 4WW6A 1BCDA 4FVOA 1G6VA 1ZFKA 3C7PA 1I91A 4RUXA
chains in the Genus database with same CATH topology
4M2VA 4QTLA 1RZDA 3JXGA 4IDRX 3V3GB 1CVCA 1CNKA 4KAPA 2HFWA 2FNNA 4FIKA 1G53A 3M3XA 4Q7VA 3DD8A 4E5QA 1ZSBA 3FFPX 1CA2A 3BL0A 3MNKA 2WEGA 5E2RA 5E2SA 3HKTA 3M2ZA 3RYYA 2OSMA 4FRCA 4CNWA 3P58A 5DSKA 3CYUA 4HT0A 4CQ0A 3DA2A 3MMFA 1YDCA 2WD3A 3ML2A 5FNGA 4N16A 4FU5A 4ITOA 3S73B 4E3FA 4Q81A 1G4OA 4Q6DA 3TVNX 3K2FA 3M1WA 5EHWA 2QO8A 1CNYA 1DMYA 2HD6A 5AMLA 4QY3A 3T82A 3U45X 1CAIA 2CBAA 3S8XA 4RIUA 1I9NA 3M2NA 5FLRA 3RYZA 4KUVA 2AX2A 4XIWA 1I9QA 3CAJA 3M14A 1THKA 2WEOA 5G01A 4Q07A 4RFCA 1AZMA 4Q87A 4KUYA 3M5EA 3ML5A 1OKMA 3NI5A 1HVAA 4G7AA 2HOCA 3RYXB 3F8EA 4DZ9A 1CNGA 2NWZA 3MZCA 1CA3A 1HUHA 1DMXA 4QSBA 5EKJA 5DRSA 4CNVA 1UGDA 3IEOA 5C8IA 2EU2A 5A25A 2CBCA 2IT4A 4UOVA 1JV0A 4Q6EA 3D0NA 1XPZA 2ABEA 5EIJA 4Z1EA 3T83A 1RAYA 1CNCA 1JCZA 2CBDA 4WW8A 1CALA 3V3FA 5DSIA 1RZEA 5EKHA 3IBIA 5G0CA 4QJPA 3MWOA 1IF5A 1ZSAA 1TE3X 2NWPA 3MNIA 1YDBA 4Q8ZA 1RAZA 4YXUA 3JXFA 5SZ6A 3RZ7A 2NNOA 5BRVA 1BN3A 4PQ7A 4BF6A 1RZBA 1CVFA 1IF7A 4RUYA 4Q8YA 3RZ8A 1MUAA 4C3TA 5SZ4A 4KP5A 2NNVA 4Q49A 3MHOA 1OKLA 3TVOX 2FOVA 5LMDA 3M67A 4GL1X 4Z1KA 4E49A 1KOPA 1FLJA 1CANA 4QIYA 3OY0A 1I90A 4M2UA 1I9LA 4R59A 5G0BA 3T5ZA 1RJ6A 3D8WA 4QSJA 4YYTA 2WD2A 3JXHC 3DBUA 1CNBA 1Z97A 3KWAA 3BETA 3KOIA 3CA2A 3M2YA 3L14A 5EZTX 3RYJB 4ZX1A 2EU3A 3DCWA 1A42A 2CBEA 1ZGEA 1BNTA 3RLDA 4Z0QA 1OQ5A 5FL6A 4COQA 5FNMA 1G0FA 3P5LA 4PXXA 2VVAX 1CVBA 2CBBA 1TEQX 3K7KA 3HS4A 4ZWYA 1CRMA 2FNMA 5JEHB 4E3DA 4Z1JA 1DCBA 1TB0X 4PZHA 1G52A 5E2KA 4KNIA 2WEJA 2QOAA 1LZVA 3UYNA 1G48A 3IBUA 1HCAA 3M5SA 2X7UA 5CA2A 2NXTA 3UYQA 2FW4A 1YO1A 2AW1A 4IWZA 3S9TA 5JDVB 3LXEA 1UGCA 1BN4A 3RZ5A 4XZ5A 4K0SA 4YXIA 3DC3A 5FNHA 4TWLA 3SAXA 2POUA 3DD0A 3P44A 3P3HA 4RH2A 1IF8A 4RIVA 1Z9YA 8CA2A 3M1QA 1KOQA 5DVXA 4LHIA 3R16A 4L5UA 3OIMA 5CLUA 3RZ0B 3KKXA 1J9WA 4WUQA 3T5UA 1LGDA 2NXRA 4X5SA 3EFTA 2CA2A 4XFWA 4ZAOA 5SZ2A 1CNXA 1I9PA 1YO0A 2Q38A 4MLTA 3RG3A 4FPTA 1H9NA 1I9MA 3ZP9A 5EH7A 1FQLA 3DVDA 3F4XA 2WEHA 4CA2A 5EH5A 3PO6A 3S76A 1YDAA 5E5UA 2Q1BA 2ILIA 3HFPA 3NB5A 1IF6A 1G1DA 4Q06A 4WR7A 1BNMA 1JD0A 2W2JA 3MYQA 4BCWA 5DSJA 2FMGA 3FE4A 2FNKA 3RG4A 4XE1A 4Q9YA 3OKVA 4K13A 3DVBA 1TBTX 3B4FA 4L5WA 1G54A 2CABA 3D93A 5JESB 4HEZA 5IPZA 3MNJA 2NNGA 1ZGFA 2POVA 3FW3A 1CVAA 1CVEA 1FSRA 3MHLA 1CINA 5BRWA 1ZH9A 2HL4A 5FLSA 3B1BA 1F2WA 1Z93A 3SBHA 3DCCA 4QSIA 3HKUA 4RN4A 1UGAA 5DOGA 5J8ZA 4CNXA 4QK3A 1CAHA 1CCTA 4QJMA 3W6HA 2F14A 1BNNA 4K0ZA 3RGEA 1HEAA 3R17B 1CCSA 1CCUA 1FSQA 5G03A 3BL1A 1BNVA 4HEWA 2O4ZA 5A6HA 4KNMA 4CACA 3P3JA 3T85A 4JSAA 4HEYA 5EH8A 5JEGB 5L6KA 4ITPA 3M2XA 3GZ0A 1TG9A 5DSQA 4Q7SA 4KNJA 1H9QA 1KWQA 3CZVA 5FLPA 5BNLA 5FLQA 4RFDA 2X7SA 1EOUA 5JG3B 1CNHA 3HKNA 4MDLA 1CVHA 4M2WA 4YXOA 2FOSA 3MHCA 4MDMA 4XIXA 1I9OA 5FNLA 2HNCA 1XEVA 3U47A 3S77B 3S78B 3DVCA 1CAMA 3HLJA 5EOIA 5AMGA 2NN7A 4Q99A 2H15A 3QYKA 5SZ0A 3TMJA 2POWA 5EHEA 2H4NA 1KWRA 3NJ9A 2EZ7A 5FLTA 3V3HB 3KONA 2VVBX 5JGSB 5JEPB 3P4VA 3MNAA 3OIKA 3SBIA 1CAOA 4JSSA 4HBAA 1URTA 4LU3A 4YX4A 3KNEA 1BNQA 4Q90A 3MHMA 3K34A 4ILXA 1Y7WA 1CAYA 5FDCA 1CILA 2QP6A 2X7TA 1XEGA 4ETQC 1UGGA 1HEBA 2Q1QA 4HT2A 5DSNA 3T84A 5CJFA 1G4JA 5E2NA 1BN1A 3MDZA 3V7XA 3M5TA 4PYYA 1ZNCA 4YGNA 3SAPA 1OKNA 4JSWA 1IF4A 5FDIA 4Q8XA 5DSPA 3OILA 2NN1A 3M1JA 1CVDA 1TTMA 5DSMA 1FQMA 1IF9A 1ZE8A 2FOYA 4YGKA 4QJ0A 5JG5B 4FL7A 5JQ0A 1DCAA 1UGFA 2NWYA 4KNNA 4JSZA 5DOHA 5FL4A 5FL5A 4KV0A 5CACA 7CA2A 1V9IC 4QJOA 3F7BA 5FNIA 3V5GA 5AMDA 4N0XB 1XQ0A 4L5VA 4G0CA 1YDDA 1BZMA 5SZ1A 3IBLA 5SZ3A 4MTYA 5EHVA 3V3JA 2GD8A 1T9NA 4ZX0A 1G3ZA 1LUGA 12CAA 1UGBA 3D92A 1BNWA 1CNJA 3U3AX 3PYKA 4Q78A 4K1QA 4KP8A 4QK1A 5JQTA 4YWPA 4QK2A 3KOKA 1LG6A 4K0TA 4MO8A 3DV7A 1G45A 4YGFA 3S72B 1FQNA 5DSOA 4E3HA 1HEDA 2FMZA 2ZNCA 3EFIA 3N0NA 4ZWZA 3V3IB 1KEQA 3RJ7A 3M40A 4E3GA 3OYQA 1ZSCA 5E2MA 5BYIA 1CAKA 1YO2A 1HECA 3DC9A 1HCBA 1AVNA 4RUZA 4Q09A 4QEFA 1HUGA 1CAZA 1TH9A 5EKMA 1FQRA 4E9OX 1BNUA 4M2RA 3D9ZA 3Q31A 1UGEA 5JGTB 4FVNA 3OKUA 4YVYA 5E5RA 3KIGA 3S97A 1CRAA 1CZMA 5FNJA 5SZ5A 3M98A 4Q7WA 4Q08A 3W6IA 1CIMA 4QSAA 4MLXA 6CA2A 1CAJA 5SZ7A 3DCSA 4PYXA 1LG5A 4YGJA 4ZWXA 1BV3A 2FOQA 4R5BA 1FSNA 3MNUA 4KUWA 1G0EA 4R5AA 3N4BA 2NXSA 3N3JA 3P55A 5DSRA 1AM6A 5FLOA 4WL4A 3V2MA 5BRUA 3F7UA 4JS6A 1G46A 3IBNA 5E28A 3N2PA 2HKKA 4TWMA 4BF1A 1CNIA 1RZAA 3P5AA 1BICA 4DZ7A 3IGPA 3U7CA 4LP6A 3DAZA 4Q83A 2NWOA 2NMXA 3HKQA 3S75B 4Q7PA 4Y0JA 4YHAA 5DSLA 1FR7A 2OSFA 2NNSA 4HF3A 3KLDB 2FOUA 1CNWA 5FNKA 1FR4A 4Z1NA 4WUPA 3MHIA 3S74B 3RYVB 4HU1A 9CA2A 3RZ1B 1ZFQA 3M1KA 4E4AA 1RZCA 1H4NA 3KS3A 3V2JA 4QJWA 3M04A 3IAIA 4CNRA 1TEUX 5L3OA 4ZWIA 4MDGA 3S71B 1V9EA 3M96A 5HPJA 1TG3A 4YGLA 4Q0LA 1I8ZA 3VBDA 1MOOA 4QIZA 3MNHA 1RJ5A 3OYSA 3PJJA 3ZNCA 4QJXA 2GEHA 4WW6A 1BCDA 4FVOA 1G6VA 1ZFKA 3C7PA 1I91A 4RUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2V A;  4QTL A;  1RZD A;  3JXG A;  4IDR X;  3V3G B;  1CVC A;  1CNK A;  4KAP A;  2HFW A;  2FNN A;  4FIK A;  1G53 A;  3M3X A;  4Q7V A;  3DD8 A;  4E5Q A;  1ZSB A;  3FFP X;  1CA2 A;  3BL0 A;  3MNK A;  2WEG A;  5E2R A;  5E2S A;  3HKT A;  3M2Z A;  3RYY A;  2OSM A;  4FRC A;  4CNW A;  3P58 A;  5DSK A;  3CYU A;  4HT0 A;  4CQ0 A;  3DA2 A;  3MMF A;  1YDC A;  2WD3 A;  3ML2 A;  5FNG A;  4N16 A;  4FU5 A;  4ITO A;  3S73 B;  4E3F A;  4Q81 A;  1G4O A;  4Q6D A;  3TVN X;  3K2F A;  3M1W A;  5EHW A;  2QO8 A;  1CNY A;  1DMY A;  2HD6 A;  5AML A;  4QY3 A;  3T82 A;  3U45 X;  1CAI A;  2CBA A;  3S8X A;  4RIU A;  1I9N A;  3M2N A;  5FLR A;  3RYZ A;  4KUV A;  2AX2 A;  4XIW A;  1I9Q A;  3CAJ A;  3M14 A;  1THK A;  2WEO A;  5G01 A;  4Q07 A;  4RFC A;  1AZM A;  4Q87 A;  4KUY A;  3M5E A;  3ML5 A;  1OKM A;  3NI5 A;  1HVA A;  4G7A A;  2HOC A;  3RYX B;  3F8E A;  4DZ9 A;  1CNG A;  2NWZ A;  3MZC A;  1CA3 A;  1HUH A;  1DMX A;  4QSB A;  5EKJ A;  5DRS A;  4CNV A;  1UGD A;  3IEO A;  5C8I A;  2EU2 A;  5A25 A;  2CBC A;  2IT4 A;  4UOV A;  1JV0 A;  4Q6E A;  3D0N A;  1XPZ A;  2ABE A;  5EIJ A;  4Z1E A;  3T83 A;  1RAY A;  1CNC A;  1JCZ A;  2CBD A;  4WW8 A;  1CAL A;  3V3F A;  5DSI A;  1RZE A;  5EKH A;  3IBI A;  5G0C A;  4QJP A;  3MWO A;  1IF5 A;  1ZSA A;  1TE3 X;  2NWP A;  3MNI A;  1YDB A;  4Q8Z A;  1RAZ A;  4YXU A;  3JXF A;  5SZ6 A;  3RZ7 A;  2NNO A;  5BRV A;  1BN3 A;  4PQ7 A;  4BF6 A;  1RZB A;  1CVF A;  1IF7 A;  4RUY A;  4Q8Y A;  3RZ8 A;  1MUA A;  4C3T A;  5SZ4 A;  4KP5 A;  2NNV A;  4Q49 A;  3MHO A;  1OKL A;  3TVO X;  2FOV A;  5LMD A;  3M67 A;  4GL1 X;  4Z1K A;  4E49 A;  1KOP A;  1FLJ A;  1CAN A;  4QIY A;  3OY0 A;  1I90 A;  4M2U A;  1I9L A;  4R59 A;  5G0B A;  3T5Z A;  1RJ6 A;  3D8W A;  4QSJ A;  4YYT A;  2WD2 A;  3JXH C;  3DBU A;  1CNB A;  1Z97 A;  3KWA A;  3BET A;  3KOI A;  3CA2 A;  3M2Y A;  3L14 A;  5EZT X;  3RYJ B;  4ZX1 A;  2EU3 A;  3DCW A;  1A42 A;  2CBE A;  1ZGE A;  1BNT A;  3RLD A;  4Z0Q A;  1OQ5 A;  5FL6 A;  4COQ A;  5FNM A;  1G0F A;  3P5L A;  4PXX A;  2VVA X;  1CVB A;  2CBB A;  1TEQ X;  3K7K A;  3HS4 A;  4ZWY A;  1CRM A;  2FNM A;  5JEH B;  4E3D A;  4Z1J A;  1DCB A;  1TB0 X;  4PZH A;  1G52 A;  5E2K A;  4KNI A;  2WEJ A;  2QOA A;  1LZV A;  3UYN A;  1G48 A;  3IBU A;  1HCA A;  3M5S A;  2X7U A;  5CA2 A;  2NXT A;  3UYQ A;  2FW4 A;  1YO1 A;  2AW1 A;  4IWZ A;  3S9T A;  5JDV B;  3LXE A;  1UGC A;  1BN4 A;  3RZ5 A;  4XZ5 A;  4K0S A;  4YXI A;  3DC3 A;  5FNH A;  4TWL A;  3SAX A;  2POU A;  3DD0 A;  3P44 A;  3P3H A;  4RH2 A;  1IF8 A;  4RIV A;  1Z9Y A;  8CA2 A;  3M1Q A;  1KOQ A;  5DVX A;  4LHI A;  3R16 A;  4L5U A;  3OIM A;  5CLU A;  3RZ0 B;  3KKX A;  1J9W A;  4WUQ A;  3T5U A;  1LGD A;  2NXR A;  4X5S A;  3EFT A;  2CA2 A;  4XFW A;  4ZAO A;  5SZ2 A;  1CNX A;  1I9P A;  1YO0 A;  2Q38 A;  4MLT A;  3RG3 A;  4FPT A;  1H9N A;  1I9M A;  3ZP9 A;  5EH7 A;  1FQL A;  3DVD A;  3F4X A;  2WEH A;  4CA2 A;  5EH5 A;  3PO6 A;  3S76 A;  1YDA A;  5E5U A;  2Q1B A;  2ILI A;  3HFP A;  3NB5 A;  1IF6 A;  1G1D A;  4Q06 A;  4WR7 A;  1BNM A;  1JD0 A;  2W2J A;  3MYQ A;  4BCW A;  5DSJ A;  2FMG A;  3FE4 A;  2FNK A;  3RG4 A;  4XE1 A;  4Q9Y A;  3OKV A;  4K13 A;  3DVB A;  1TBT X;  3B4F A;  4L5W A;  1G54 A;  2CAB A;  3D93 A;  5JES B;  4HEZ A;  5IPZ A;  3MNJ A;  2NNG A;  1ZGF A;  2POV A;  3FW3 A;  1CVA A;  1CVE A;  1FSR A;  3MHL A;  1CIN A;  5BRW A;  1ZH9 A;  2HL4 A;  5FLS A;  3B1B A;  1F2W A;  1Z93 A;  3SBH A;  3DCC A;  4QSI A;  3HKU A;  4RN4 A;  1UGA A;  5DOG A;  5J8Z A;  4CNX A;  4QK3 A;  1CAH A;  1CCT A;  4QJM A;  3W6H A;  2F14 A;  1BNN A;  4K0Z A;  3RGE A;  1HEA A;  3R17 B;  1CCS A;  1CCU A;  1FSQ A;  5G03 A;  3BL1 A;  1BNV A;  4HEW A;  2O4Z A;  5A6H A;  4KNM A;  4CAC A;  3P3J A;  3T85 A;  4JSA A;  4HEY A;  5EH8 A;  5JEG B;  5L6K A;  4ITP A;  3M2X A;  3GZ0 A;  1TG9 A;  5DSQ A;  4Q7S A;  4KNJ A;  1H9Q A;  1KWQ A;  3CZV A;  5FLP A;  5BNL A;  5FLQ A;  4RFD A;  2X7S A;  1EOU A;  5JG3 B;  1CNH A;  3HKN A;  4MDL A;  1CVH A;  4M2W A;  4YXO A;  2FOS A;  3MHC A;  4MDM A;  4XIX A;  1I9O A;  5FNL A;  2HNC A;  1XEV A;  3U47 A;  3S77 B;  3S78 B;  3DVC A;  1CAM A;  3HLJ A;  5EOI A;  5AMG A;  2NN7 A;  4Q99 A;  2H15 A;  3QYK A;  5SZ0 A;  3TMJ A;  2POW A;  5EHE A;  2H4N A;  1KWR A;  3NJ9 A;  2EZ7 A;  5FLT A;  3V3H B;  3KON A;  2VVB X;  5JGS B;  5JEP B;  3P4V A;  3MNA A;  3OIK A;  3SBI A;  1CAO A;  4JSS A;  4HBA A;  1URT A;  4LU3 A;  4YX4 A;  3KNE A;  1BNQ A;  4Q90 A;  3MHM A;  3K34 A;  4ILX A;  1Y7W A;  1CAY A;  5FDC A;  1CIL A;  2QP6 A;  2X7T A;  1XEG A;  4ETQ C;  1UGG A;  1HEB A;  2Q1Q A;  4HT2 A;  5DSN A;  3T84 A;  5CJF A;  1G4J A;  5E2N A;  1BN1 A;  3MDZ A;  3V7X A;  3M5T A;  4PYY A;  1ZNC A;  4YGN A;  3SAP A;  1OKN A;  4JSW A;  1IF4 A;  5FDI A;  4Q8X A;  5DSP A;  3OIL A;  2NN1 A;  3M1J A;  1CVD A;  1TTM A;  5DSM A;  1FQM A;  1IF9 A;  1ZE8 A;  2FOY A;  4YGK A;  4QJ0 A;  5JG5 B;  4FL7 A;  5JQ0 A;  1DCA A;  1UGF A;  2NWY A;  4KNN A;  4JSZ A;  5DOH A;  5FL4 A;  5FL5 A;  4KV0 A;  5CAC A;  7CA2 A;  1V9I C;  4QJO A;  3F7B A;  5FNI A;  3V5G A;  5AMD A;  4N0X B;  1XQ0 A;  4L5V A;  4G0C A;  1YDD A;  1BZM A;  5SZ1 A;  3IBL A;  5SZ3 A;  4MTY A;  5EHV A;  3V3J A;  2GD8 A;  1T9N A;  4ZX0 A;  1G3Z A;  1LUG A;  12CA A;  1UGB A;  3D92 A;  1BNW A;  1CNJ A;  3U3A X;  3PYK A;  4Q78 A;  4K1Q A;  4KP8 A;  4QK1 A;  5JQT A;  4YWP A;  4QK2 A;  3KOK A;  1LG6 A;  4K0T A;  4MO8 A;  3DV7 A;  1G45 A;  4YGF A;  3S72 B;  1FQN A;  5DSO A;  4E3H A;  1HED A;  2FMZ A;  2ZNC A;  3EFI A;  3N0N A;  4ZWZ A;  3V3I B;  1KEQ A;  3RJ7 A;  3M40 A;  4E3G A;  3OYQ A;  1ZSC A;  5E2M A;  5BYI A;  1CAK A;  1YO2 A;  1HEC A;  3DC9 A;  1HCB A;  1AVN A;  4RUZ A;  4Q09 A;  4QEF A;  1HUG A;  1CAZ A;  1TH9 A;  5EKM A;  1FQR A;  4E9O X;  1BNU A;  4M2R A;  3D9Z A;  3Q31 A;  1UGE A;  5JGT B;  4FVN A;  3OKU A;  4YVY A;  5E5R A;  3KIG A;  3S97 A;  1CRA A;  1CZM A;  5FNJ A;  5SZ5 A;  3M98 A;  4Q7W A;  4Q08 A;  3W6I A;  1CIM A;  4QSA A;  4MLX A;  6CA2 A;  1CAJ A;  5SZ7 A;  3DCS A;  4PYX A;  1LG5 A;  4YGJ A;  4ZWX A;  1BV3 A;  2FOQ A;  4R5B A;  1FSN A;  3MNU A;  4KUW A;  1G0E A;  4R5A A;  3N4B A;  2NXS A;  3N3J A;  3P55 A;  5DSR A;  1AM6 A;  5FLO A;  4WL4 A;  3V2M A;  5BRU A;  3F7U A;  4JS6 A;  1G46 A;  3IBN A;  5E28 A;  3N2P A;  2HKK A;  4TWM A;  4BF1 A;  1CNI A;  1RZA A;  3P5A A;  1BIC A;  4DZ7 A;  3IGP A;  3U7C A;  4LP6 A;  3DAZ A;  4Q83 A;  2NWO A;  2NMX A;  3HKQ A;  3S75 B;  4Q7P A;  4Y0J A;  4YHA A;  5DSL A;  1FR7 A;  2OSF A;  2NNS A;  4HF3 A;  3KLD B;  2FOU A;  1CNW A;  5FNK A;  1FR4 A;  4Z1N A;  4WUP A;  3MHI A;  3S74 B;  3RYV B;  4HU1 A;  9CA2 A;  3RZ1 B;  1ZFQ A;  3M1K A;  4E4A A;  1RZC A;  1H4N A;  3KS3 A;  3V2J A;  4QJW A;  3M04 A;  3IAI A;  4CNR A;  1TEU X;  5L3O A;  4ZWI A;  4MDG A;  3S71 B;  1V9E A;  3M96 A;  5HPJ A;  1TG3 A;  4YGL A;  4Q0L A;  1I8Z A;  3VBD A;  1MOO A;  4QIZ A;  3MNH A;  1RJ5 A;  3OYS A;  3PJJ A;  3ZNC A;  4QJX A;  2GEH A;  4WW6 A;  1BCD A;  4FVO A;  1G6V A;  1ZFK A;  3C7P A;  1I91 A;  4RUX A; 
#chains in the Genus database with same CATH topology
 4M2V A;  4QTL A;  1RZD A;  3JXG A;  4IDR X;  3V3G B;  1CVC A;  1CNK A;  4KAP A;  2HFW A;  2FNN A;  4FIK A;  1G53 A;  3M3X A;  4Q7V A;  3DD8 A;  4E5Q A;  1ZSB A;  3FFP X;  1CA2 A;  3BL0 A;  3MNK A;  2WEG A;  5E2R A;  5E2S A;  3HKT A;  3M2Z A;  3RYY A;  2OSM A;  4FRC A;  4CNW A;  3P58 A;  5DSK A;  3CYU A;  4HT0 A;  4CQ0 A;  3DA2 A;  3MMF A;  1YDC A;  2WD3 A;  3ML2 A;  5FNG A;  4N16 A;  4FU5 A;  4ITO A;  3S73 B;  4E3F A;  4Q81 A;  1G4O A;  4Q6D A;  3TVN X;  3K2F A;  3M1W A;  5EHW A;  2QO8 A;  1CNY A;  1DMY A;  2HD6 A;  5AML A;  4QY3 A;  3T82 A;  3U45 X;  1CAI A;  2CBA A;  3S8X A;  4RIU A;  1I9N A;  3M2N A;  5FLR A;  3RYZ A;  4KUV A;  2AX2 A;  4XIW A;  1I9Q A;  3CAJ A;  3M14 A;  1THK A;  2WEO A;  5G01 A;  4Q07 A;  4RFC A;  1AZM A;  4Q87 A;  4KUY A;  3M5E A;  3ML5 A;  1OKM A;  3NI5 A;  1HVA A;  4G7A A;  2HOC A;  3RYX B;  3F8E A;  4DZ9 A;  1CNG A;  2NWZ A;  3MZC A;  1CA3 A;  1HUH A;  1DMX A;  4QSB A;  5EKJ A;  5DRS A;  4CNV A;  1UGD A;  3IEO A;  5C8I A;  2EU2 A;  5A25 A;  2CBC A;  2IT4 A;  4UOV A;  1JV0 A;  4Q6E A;  3D0N A;  1XPZ A;  2ABE A;  5EIJ A;  4Z1E A;  3T83 A;  1RAY A;  1CNC A;  1JCZ A;  2CBD A;  4WW8 A;  1CAL A;  3V3F A;  5DSI A;  1RZE A;  5EKH A;  3IBI A;  5G0C A;  4QJP A;  3MWO A;  1IF5 A;  1ZSA A;  1TE3 X;  2NWP A;  3MNI A;  1YDB A;  4Q8Z A;  1RAZ A;  4YXU A;  3JXF A;  5SZ6 A;  3RZ7 A;  2NNO A;  5BRV A;  1BN3 A;  4PQ7 A;  4BF6 A;  1RZB A;  1CVF A;  1IF7 A;  4RUY A;  4Q8Y A;  3RZ8 A;  1MUA A;  4C3T A;  5SZ4 A;  4KP5 A;  2NNV A;  4Q49 A;  3MHO A;  1OKL A;  3TVO X;  2FOV A;  5LMD A;  3M67 A;  4GL1 X;  4Z1K A;  4E49 A;  1KOP A;  1FLJ A;  1CAN A;  4QIY A;  3OY0 A;  1I90 A;  4M2U A;  1I9L A;  4R59 A;  5G0B A;  3T5Z A;  1RJ6 A;  3D8W A;  4QSJ A;  4YYT A;  2WD2 A;  3JXH C;  3DBU A;  1CNB A;  1Z97 A;  3KWA A;  3BET A;  3KOI A;  3CA2 A;  3M2Y A;  3L14 A;  5EZT X;  3RYJ B;  4ZX1 A;  2EU3 A;  3DCW A;  1A42 A;  2CBE A;  1ZGE A;  1BNT A;  3RLD A;  4Z0Q A;  1OQ5 A;  5FL6 A;  4COQ A;  5FNM A;  1G0F A;  3P5L A;  4PXX A;  2VVA X;  1CVB A;  2CBB A;  1TEQ X;  3K7K A;  3HS4 A;  4ZWY A;  1CRM A;  2FNM A;  5JEH B;  4E3D A;  4Z1J A;  1DCB A;  1TB0 X;  4PZH A;  1G52 A;  5E2K A;  4KNI A;  2WEJ A;  2QOA A;  1LZV A;  3UYN A;  1G48 A;  3IBU A;  1HCA A;  3M5S A;  2X7U A;  5CA2 A;  2NXT A;  3UYQ A;  2FW4 A;  1YO1 A;  2AW1 A;  4IWZ A;  3S9T A;  5JDV B;  3LXE A;  1UGC A;  1BN4 A;  3RZ5 A;  4XZ5 A;  4K0S A;  4YXI A;  3DC3 A;  5FNH A;  4TWL A;  3SAX A;  2POU A;  3DD0 A;  3P44 A;  3P3H A;  4RH2 A;  1IF8 A;  4RIV A;  1Z9Y A;  8CA2 A;  3M1Q A;  1KOQ A;  5DVX A;  4LHI A;  3R16 A;  4L5U A;  3OIM A;  5CLU A;  3RZ0 B;  3KKX A;  1J9W A;  4WUQ A;  3T5U A;  1LGD A;  2NXR A;  4X5S A;  3EFT A;  2CA2 A;  4XFW A;  4ZAO A;  5SZ2 A;  1CNX A;  1I9P A;  1YO0 A;  2Q38 A;  4MLT A;  3RG3 A;  4FPT A;  1H9N A;  1I9M A;  3ZP9 A;  5EH7 A;  1FQL A;  3DVD A;  3F4X A;  2WEH A;  4CA2 A;  5EH5 A;  3PO6 A;  3S76 A;  1YDA A;  5E5U A;  2Q1B A;  2ILI A;  3HFP A;  3NB5 A;  1IF6 A;  1G1D A;  4Q06 A;  4WR7 A;  1BNM A;  1JD0 A;  2W2J A;  3MYQ A;  4BCW A;  5DSJ A;  2FMG A;  3FE4 A;  2FNK A;  3RG4 A;  4XE1 A;  4Q9Y A;  3OKV A;  4K13 A;  3DVB A;  1TBT X;  3B4F A;  4L5W A;  1G54 A;  2CAB A;  3D93 A;  5JES B;  4HEZ A;  5IPZ A;  3MNJ A;  2NNG A;  1ZGF A;  2POV A;  3FW3 A;  1CVA A;  1CVE A;  1FSR A;  3MHL A;  1CIN A;  5BRW A;  1ZH9 A;  2HL4 A;  5FLS A;  3B1B A;  1F2W A;  1Z93 A;  3SBH A;  3DCC A;  4QSI A;  3HKU A;  4RN4 A;  1UGA A;  5DOG A;  5J8Z A;  4CNX A;  4QK3 A;  1CAH A;  1CCT A;  4QJM A;  3W6H A;  2F14 A;  1BNN A;  4K0Z A;  3RGE A;  1HEA A;  3R17 B;  1CCS A;  1CCU A;  1FSQ A;  5G03 A;  3BL1 A;  1BNV A;  4HEW A;  2O4Z A;  5A6H A;  4KNM A;  4CAC A;  3P3J A;  3T85 A;  4JSA A;  4HEY A;  5EH8 A;  5JEG B;  5L6K A;  4ITP A;  3M2X A;  3GZ0 A;  1TG9 A;  5DSQ A;  4Q7S A;  4KNJ A;  1H9Q A;  1KWQ A;  3CZV A;  5FLP A;  5BNL A;  5FLQ A;  4RFD A;  2X7S A;  1EOU A;  5JG3 B;  1CNH A;  3HKN A;  4MDL A;  1CVH A;  4M2W A;  4YXO A;  2FOS A;  3MHC A;  4MDM A;  4XIX A;  1I9O A;  5FNL A;  2HNC A;  1XEV A;  3U47 A;  3S77 B;  3S78 B;  3DVC A;  1CAM A;  3HLJ A;  5EOI A;  5AMG A;  2NN7 A;  4Q99 A;  2H15 A;  3QYK A;  5SZ0 A;  3TMJ A;  2POW A;  5EHE A;  2H4N A;  1KWR A;  3NJ9 A;  2EZ7 A;  5FLT A;  3V3H B;  3KON A;  2VVB X;  5JGS B;  5JEP B;  3P4V A;  3MNA A;  3OIK A;  3SBI A;  1CAO A;  4JSS A;  4HBA A;  1URT A;  4LU3 A;  4YX4 A;  3KNE A;  1BNQ A;  4Q90 A;  3MHM A;  3K34 A;  4ILX A;  1Y7W A;  1CAY A;  5FDC A;  1CIL A;  2QP6 A;  2X7T A;  1XEG A;  4ETQ C;  1UGG A;  1HEB A;  2Q1Q A;  4HT2 A;  5DSN A;  3T84 A;  5CJF A;  1G4J A;  5E2N A;  1BN1 A;  3MDZ A;  3V7X A;  3M5T A;  4PYY A;  1ZNC A;  4YGN A;  3SAP A;  1OKN A;  4JSW A;  1IF4 A;  5FDI A;  4Q8X A;  5DSP A;  3OIL A;  2NN1 A;  3M1J A;  1CVD A;  1TTM A;  5DSM A;  1FQM A;  1IF9 A;  1ZE8 A;  2FOY A;  4YGK A;  4QJ0 A;  5JG5 B;  4FL7 A;  5JQ0 A;  1DCA A;  1UGF A;  2NWY A;  4KNN A;  4JSZ A;  5DOH A;  5FL4 A;  5FL5 A;  4KV0 A;  5CAC A;  7CA2 A;  1V9I C;  4QJO A;  3F7B A;  5FNI A;  3V5G A;  5AMD A;  4N0X B;  1XQ0 A;  4L5V A;  4G0C A;  1YDD A;  1BZM A;  5SZ1 A;  3IBL A;  5SZ3 A;  4MTY A;  5EHV A;  3V3J A;  2GD8 A;  1T9N A;  4ZX0 A;  1G3Z A;  1LUG A;  12CA A;  1UGB A;  3D92 A;  1BNW A;  1CNJ A;  3U3A X;  3PYK A;  4Q78 A;  4K1Q A;  4KP8 A;  4QK1 A;  5JQT A;  4YWP A;  4QK2 A;  3KOK A;  1LG6 A;  4K0T A;  4MO8 A;  3DV7 A;  1G45 A;  4YGF A;  3S72 B;  1FQN A;  5DSO A;  4E3H A;  1HED A;  2FMZ A;  2ZNC A;  3EFI A;  3N0N A;  4ZWZ A;  3V3I B;  1KEQ A;  3RJ7 A;  3M40 A;  4E3G A;  3OYQ A;  1ZSC A;  5E2M A;  5BYI A;  1CAK A;  1YO2 A;  1HEC A;  3DC9 A;  1HCB A;  1AVN A;  4RUZ A;  4Q09 A;  4QEF A;  1HUG A;  1CAZ A;  1TH9 A;  5EKM A;  1FQR A;  4E9O X;  1BNU A;  4M2R A;  3D9Z A;  3Q31 A;  1UGE A;  5JGT B;  4FVN A;  3OKU A;  4YVY A;  5E5R A;  3KIG A;  3S97 A;  1CRA A;  1CZM A;  5FNJ A;  5SZ5 A;  3M98 A;  4Q7W A;  4Q08 A;  3W6I A;  1CIM A;  4QSA A;  4MLX A;  6CA2 A;  1CAJ A;  5SZ7 A;  3DCS A;  4PYX A;  1LG5 A;  4YGJ A;  4ZWX A;  1BV3 A;  2FOQ A;  4R5B A;  1FSN A;  3MNU A;  4KUW A;  1G0E A;  4R5A A;  3N4B A;  2NXS A;  3N3J A;  3P55 A;  5DSR A;  1AM6 A;  5FLO A;  4WL4 A;  3V2M A;  5BRU A;  3F7U A;  4JS6 A;  1G46 A;  3IBN A;  5E28 A;  3N2P A;  2HKK A;  4TWM A;  4BF1 A;  1CNI A;  1RZA A;  3P5A A;  1BIC A;  4DZ7 A;  3IGP A;  3U7C A;  4LP6 A;  3DAZ A;  4Q83 A;  2NWO A;  2NMX A;  3HKQ A;  3S75 B;  4Q7P A;  4Y0J A;  4YHA A;  5DSL A;  1FR7 A;  2OSF A;  2NNS A;  4HF3 A;  3KLD B;  2FOU A;  1CNW A;  5FNK A;  1FR4 A;  4Z1N A;  4WUP A;  3MHI A;  3S74 B;  3RYV B;  4HU1 A;  9CA2 A;  3RZ1 B;  1ZFQ A;  3M1K A;  4E4A A;  1RZC A;  1H4N A;  3KS3 A;  3V2J A;  4QJW A;  3M04 A;  3IAI A;  4CNR A;  1TEU X;  5L3O A;  4ZWI A;  4MDG A;  3S71 B;  1V9E A;  3M96 A;  5HPJ A;  1TG3 A;  4YGL A;  4Q0L A;  1I8Z A;  3VBD A;  1MOO A;  4QIZ A;  3MNH A;  1RJ5 A;  3OYS A;  3PJJ A;  3ZNC A;  4QJX A;  2GEH A;  4WW6 A;  1BCD A;  4FVO A;  1G6V A;  1ZFK A;  3C7P A;  1I91 A;  4RUX A; 
#chains in the Genus database with same CATH homology
 4M2V A;  4QTL A;  1RZD A;  3JXG A;  4IDR X;  3V3G B;  1CVC A;  1CNK A;  4KAP A;  2HFW A;  2FNN A;  4FIK A;  1G53 A;  3M3X A;  4Q7V A;  3DD8 A;  4E5Q A;  1ZSB A;  3FFP X;  1CA2 A;  3BL0 A;  3MNK A;  2WEG A;  5E2R A;  5E2S A;  3HKT A;  3M2Z A;  3RYY A;  2OSM A;  4FRC A;  4CNW A;  3P58 A;  5DSK A;  3CYU A;  4HT0 A;  4CQ0 A;  3DA2 A;  3MMF A;  1YDC A;  2WD3 A;  3ML2 A;  5FNG A;  4N16 A;  4FU5 A;  4ITO A;  3S73 B;  4E3F A;  4Q81 A;  1G4O A;  4Q6D A;  3TVN X;  3K2F A;  3M1W A;  5EHW A;  2QO8 A;  1CNY A;  1DMY A;  2HD6 A;  5AML A;  4QY3 A;  3T82 A;  3U45 X;  1CAI A;  2CBA A;  3S8X A;  4RIU A;  1I9N A;  3M2N A;  5FLR A;  3RYZ A;  4KUV A;  2AX2 A;  4XIW A;  1I9Q A;  3CAJ A;  3M14 A;  1THK A;  2WEO A;  5G01 A;  4Q07 A;  4RFC A;  1AZM A;  4Q87 A;  4KUY A;  3M5E A;  3ML5 A;  1OKM A;  3NI5 A;  1HVA A;  4G7A A;  2HOC A;  3RYX B;  3F8E A;  4DZ9 A;  1CNG A;  2NWZ A;  3MZC A;  1CA3 A;  1HUH A;  1DMX A;  4QSB A;  5EKJ A;  5DRS A;  4CNV A;  1UGD A;  3IEO A;  5C8I A;  2EU2 A;  5A25 A;  2CBC A;  2IT4 A;  4UOV A;  1JV0 A;  4Q6E A;  3D0N A;  1XPZ A;  2ABE A;  5EIJ A;  4Z1E A;  3T83 A;  1RAY A;  1CNC A;  1JCZ A;  2CBD A;  4WW8 A;  1CAL A;  3V3F A;  5DSI A;  1RZE A;  5EKH A;  3IBI A;  5G0C A;  4QJP A;  3MWO A;  1IF5 A;  1ZSA A;  1TE3 X;  2NWP A;  3MNI A;  1YDB A;  4Q8Z A;  1RAZ A;  4YXU A;  3JXF A;  5SZ6 A;  3RZ7 A;  2NNO A;  5BRV A;  1BN3 A;  4PQ7 A;  4BF6 A;  1RZB A;  1CVF A;  1IF7 A;  4RUY A;  4Q8Y A;  3RZ8 A;  1MUA A;  4C3T A;  5SZ4 A;  4KP5 A;  2NNV A;  4Q49 A;  3MHO A;  1OKL A;  3TVO X;  2FOV A;  5LMD A;  3M67 A;  4GL1 X;  4Z1K A;  4E49 A;  1KOP A;  1FLJ A;  1CAN A;  4QIY A;  3OY0 A;  1I90 A;  4M2U A;  1I9L A;  4R59 A;  5G0B A;  3T5Z A;  1RJ6 A;  3D8W A;  4QSJ A;  4YYT A;  2WD2 A;  3JXH C;  3DBU A;  1CNB A;  1Z97 A;  3KWA A;  3BET A;  3KOI A;  3CA2 A;  3M2Y A;  3L14 A;  5EZT X;  3RYJ B;  4ZX1 A;  2EU3 A;  3DCW A;  1A42 A;  2CBE A;  1ZGE A;  1BNT A;  3RLD A;  4Z0Q A;  1OQ5 A;  5FL6 A;  4COQ A;  5FNM A;  1G0F A;  3P5L A;  4PXX A;  2VVA X;  1CVB A;  2CBB A;  1TEQ X;  3K7K A;  3HS4 A;  4ZWY A;  1CRM A;  2FNM A;  5JEH B;  4E3D A;  4Z1J A;  1DCB A;  1TB0 X;  4PZH A;  1G52 A;  5E2K A;  4KNI A;  2WEJ A;  2QOA A;  1LZV A;  3UYN A;  1G48 A;  3IBU A;  1HCA A;  3M5S A;  2X7U A;  5CA2 A;  2NXT A;  3UYQ A;  2FW4 A;  1YO1 A;  2AW1 A;  4IWZ A;  3S9T A;  5JDV B;  3LXE A;  1UGC A;  1BN4 A;  3RZ5 A;  4XZ5 A;  4K0S A;  4YXI A;  3DC3 A;  5FNH A;  4TWL A;  3SAX A;  2POU A;  3DD0 A;  3P44 A;  3P3H A;  4RH2 A;  1IF8 A;  4RIV A;  1Z9Y A;  8CA2 A;  3M1Q A;  1KOQ A;  5DVX A;  4LHI A;  3R16 A;  4L5U A;  3OIM A;  5CLU A;  3RZ0 B;  3KKX A;  1J9W A;  4WUQ A;  3T5U A;  1LGD A;  2NXR A;  4X5S A;  3EFT A;  2CA2 A;  4XFW A;  4ZAO A;  5SZ2 A;  1CNX A;  1I9P A;  1YO0 A;  2Q38 A;  4MLT A;  3RG3 A;  4FPT A;  1H9N A;  1I9M A;  3ZP9 A;  5EH7 A;  1FQL A;  3DVD A;  3F4X A;  2WEH A;  4CA2 A;  5EH5 A;  3PO6 A;  3S76 A;  1YDA A;  5E5U A;  2Q1B A;  2ILI A;  3HFP A;  3NB5 A;  1IF6 A;  1G1D A;  4Q06 A;  4WR7 A;  1BNM A;  1JD0 A;  2W2J A;  3MYQ A;  4BCW A;  5DSJ A;  2FMG A;  3FE4 A;  2FNK A;  3RG4 A;  4XE1 A;  4Q9Y A;  3OKV A;  4K13 A;  3DVB A;  1TBT X;  3B4F A;  4L5W A;  1G54 A;  2CAB A;  3D93 A;  5JES B;  4HEZ A;  5IPZ A;  3MNJ A;  2NNG A;  1ZGF A;  2POV A;  3FW3 A;  1CVA A;  1CVE A;  1FSR A;  3MHL A;  1CIN A;  5BRW A;  1ZH9 A;  2HL4 A;  5FLS A;  3B1B A;  1F2W A;  1Z93 A;  3SBH A;  3DCC A;  4QSI A;  3HKU A;  4RN4 A;  1UGA A;  5DOG A;  5J8Z A;  4CNX A;  4QK3 A;  1CAH A;  1CCT A;  4QJM A;  3W6H A;  2F14 A;  1BNN A;  4K0Z A;  3RGE A;  1HEA A;  3R17 B;  1CCS A;  1CCU A;  1FSQ A;  5G03 A;  3BL1 A;  1BNV A;  4HEW A;  2O4Z A;  5A6H A;  4KNM A;  4CAC A;  3P3J A;  3T85 A;  4JSA A;  4HEY A;  5EH8 A;  5JEG B;  5L6K A;  4ITP A;  3M2X A;  3GZ0 A;  1TG9 A;  5DSQ A;  4Q7S A;  4KNJ A;  1H9Q A;  1KWQ A;  3CZV A;  5FLP A;  5BNL A;  5FLQ A;  4RFD A;  2X7S A;  1EOU A;  5JG3 B;  1CNH A;  3HKN A;  4MDL A;  1CVH A;  4M2W A;  4YXO A;  2FOS A;  3MHC A;  4MDM A;  4XIX A;  1I9O A;  5FNL A;  2HNC A;  1XEV A;  3U47 A;  3S77 B;  3S78 B;  3DVC A;  1CAM A;  3HLJ A;  5EOI A;  5AMG A;  2NN7 A;  4Q99 A;  2H15 A;  3QYK A;  5SZ0 A;  3TMJ A;  2POW A;  5EHE A;  2H4N A;  1KWR A;  3NJ9 A;  2EZ7 A;  5FLT A;  3V3H B;  3KON A;  2VVB X;  5JGS B;  5JEP B;  3P4V A;  3MNA A;  3OIK A;  3SBI A;  1CAO A;  4JSS A;  4HBA A;  1URT A;  4LU3 A;  4YX4 A;  3KNE A;  1BNQ A;  4Q90 A;  3MHM A;  3K34 A;  4ILX A;  1Y7W A;  1CAY A;  5FDC A;  1CIL A;  2QP6 A;  2X7T A;  1XEG A;  4ETQ C;  1UGG A;  1HEB A;  2Q1Q A;  4HT2 A;  5DSN A;  3T84 A;  5CJF A;  1G4J A;  5E2N A;  1BN1 A;  3MDZ A;  3V7X A;  3M5T A;  4PYY A;  1ZNC A;  4YGN A;  3SAP A;  1OKN A;  4JSW A;  1IF4 A;  5FDI A;  4Q8X A;  5DSP A;  3OIL A;  2NN1 A;  3M1J A;  1CVD A;  1TTM A;  5DSM A;  1FQM A;  1IF9 A;  1ZE8 A;  2FOY A;  4YGK A;  4QJ0 A;  5JG5 B;  4FL7 A;  5JQ0 A;  1DCA A;  1UGF A;  2NWY A;  4KNN A;  4JSZ A;  5DOH A;  5FL4 A;  5FL5 A;  4KV0 A;  5CAC A;  7CA2 A;  1V9I C;  4QJO A;  3F7B A;  5FNI A;  3V5G A;  5AMD A;  4N0X B;  1XQ0 A;  4L5V A;  4G0C A;  1YDD A;  1BZM A;  5SZ1 A;  3IBL A;  5SZ3 A;  4MTY A;  5EHV A;  3V3J A;  2GD8 A;  1T9N A;  4ZX0 A;  1G3Z A;  1LUG A;  12CA A;  1UGB A;  3D92 A;  1BNW A;  1CNJ A;  3U3A X;  3PYK A;  4Q78 A;  4K1Q A;  4KP8 A;  4QK1 A;  5JQT A;  4YWP A;  4QK2 A;  3KOK A;  1LG6 A;  4K0T A;  4MO8 A;  3DV7 A;  1G45 A;  4YGF A;  3S72 B;  1FQN A;  5DSO A;  4E3H A;  1HED A;  2FMZ A;  2ZNC A;  3EFI A;  3N0N A;  4ZWZ A;  3V3I B;  1KEQ A;  3RJ7 A;  3M40 A;  4E3G A;  3OYQ A;  1ZSC A;  5E2M A;  5BYI A;  1CAK A;  1YO2 A;  1HEC A;  3DC9 A;  1HCB A;  1AVN A;  4RUZ A;  4Q09 A;  4QEF A;  1HUG A;  1CAZ A;  1TH9 A;  5EKM A;  1FQR A;  4E9O X;  1BNU A;  4M2R A;  3D9Z A;  3Q31 A;  1UGE A;  5JGT B;  4FVN A;  3OKU A;  4YVY A;  5E5R A;  3KIG A;  3S97 A;  1CRA A;  1CZM A;  5FNJ A;  5SZ5 A;  3M98 A;  4Q7W A;  4Q08 A;  3W6I A;  1CIM A;  4QSA A;  4MLX A;  6CA2 A;  1CAJ A;  5SZ7 A;  3DCS A;  4PYX A;  1LG5 A;  4YGJ A;  4ZWX A;  1BV3 A;  2FOQ A;  4R5B A;  1FSN A;  3MNU A;  4KUW A;  1G0E A;  4R5A A;  3N4B A;  2NXS A;  3N3J A;  3P55 A;  5DSR A;  1AM6 A;  5FLO A;  4WL4 A;  3V2M A;  5BRU A;  3F7U A;  4JS6 A;  1G46 A;  3IBN A;  5E28 A;  3N2P A;  2HKK A;  4TWM A;  4BF1 A;  1CNI A;  1RZA A;  3P5A A;  1BIC A;  4DZ7 A;  3IGP A;  3U7C A;  4LP6 A;  3DAZ A;  4Q83 A;  2NWO A;  2NMX A;  3HKQ A;  3S75 B;  4Q7P A;  4Y0J A;  4YHA A;  5DSL A;  1FR7 A;  2OSF A;  2NNS A;  4HF3 A;  3KLD B;  2FOU A;  1CNW A;  5FNK A;  1FR4 A;  4Z1N A;  4WUP A;  3MHI A;  3S74 B;  3RYV B;  4HU1 A;  9CA2 A;  3RZ1 B;  1ZFQ A;  3M1K A;  4E4A A;  1RZC A;  1H4N A;  3KS3 A;  3V2J A;  4QJW A;  3M04 A;  3IAI A;  4CNR A;  1TEU X;  5L3O A;  4ZWI A;  4MDG A;  3S71 B;  1V9E A;  3M96 A;  5HPJ A;  1TG3 A;  4YGL A;  4Q0L A;  1I8Z A;  3VBD A;  1MOO A;  4QIZ A;  3MNH A;  1RJ5 A;  3OYS A;  3PJJ A;  3ZNC A;  4QJX A;  2GEH A;  4WW6 A;  1BCD A;  4FVO A;  1G6V A;  1ZFK A;  3C7P A;  1I91 A;  4RUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...