1ZSAA

Carbonic anhydrase ii mutant e117q, apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAQLHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE II
publication title Reversal of the hydrogen bond to zinc ligand histidine-119 dramatically diminishes catalysis and enhances metal equilibration kinetics in carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase (oxo-acid)
total genus 70
structure length 257
sequence length 257
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1996-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1zsaA00
5DSOA 3CA2A 4RUZA 4HEWA 3HS4A 1KEQA 4MO8A 1YO2A 2CBBA 4KUWA 3TVNX 1ZFKA 1RZAA 1THKA 4QJWA 4RUXA 1I9LA 3RG4A 3V7XA 2FOSA 5EHVA 4L5VA 1Z9YA 5SZ5A 5A25A 4WW8A 3M67A 1G53A 4KAPA 5SZ1A 3OKVA 3F7BA 4KUVA 3DCSA 4Q08A 1CCTA 5FNGA 4Z1EA 3P5LA 3S73B 4E5QA 4QSJA 1TBTX 2AW1A 4YVYA 5E2KA 5IPZA 2FMZA 3M1KA 2AX2A 5SZ0A 1V9IC 1CA2A 1YDBA 4R5BA 3IBLA 2ZNCA 3P55A 4R59A 1I90A 3BETA 3CZVA 4WW6A 1RZDA 3KONA 3OY0A 1CNHA 2FOUA 4Z1KA 2NWPA 2NXSA 3M40A 3U47A 1JCZA 5E28A 3HKNA 3EFIA 1ZGEA 1TTMA 4FPTA 4Q6EA 3SBIA 4X5SA 4CNWA 2Q38A 4UOVA 5SZ4A 2WEHA 3RYYA 4E4AA 3MMFA 2FNNA 2O4ZA 3M98A 1CILA 4WUPA 5JESB 1BNVA 2WEGA 3ZNCA 5BRUA 5FLRA 3UYNA 2NXRA 3MYQA 1ZFQA 4RUYA 3M1JA 4FVOA 3V3IB 5JG5B 1CVHA 3F8EA 3TMJA 3S71B 4ETQC 1YDAA 4ZAOA 5AMLA 3MHCA 4GL1X 4Q09A 3IBUA 3MHIA 3KOKA 1G0FA 4XFWA 1UGFA 3BL1A 1RAZA 1CVBA 1FSNA 3W6IA 1OKLA 5DSNA 3NB5A 4HEYA 3IAIA 5EKMA 2FOQA 3IEOA 1DCBA 2CBAA 1BNMA 4K0TA 4FVNA 3M1QA 5EHWA 1KWQA 5FNIA 1BNNA 2NN1A 3K2FA 4QJPA 1Z97A 1LG5A 1XEVA 4QIYA 4QSBA 3CAJA 4YHAA 2HD6A 3K34A 4KUYA 2POUA 5BYIA 4K0SA 5A6HA 2WEOA 1I9QA 1IF8A 1FSQA 4M2RA 2WEJA 3SAPA 2QOAA 5FNJA 3T83A 4C3TA 4ILXA 2NMXA 3S76A 1CRMA 3D9ZA 3DC9A 3D93A 4QJXA 4M2UA 4E3FA 2QP6A 4E3HA 5DSLA 1LG6A 4QY3A 4ITOA 1IF4A 4QEFA 1YDDA 4YGNA 3DBUA 4ZX0A 1RZCA 3T85A 1I8ZA 1MOOA 2X7SA 3MHLA 2NNOA 3U3AX 2FNMA 4QK1A 1CALA 3OKUA 5JDVB 7CA2A 5FLTA 4RN4A 4QJOA 4HT2A 1G45A 1URTA 1CNIA 2CA2A 4RH2A 3OYQA 3T5ZA 1CANA 5DOGA 3RZ0B 4KNNA 3DV7A 5JG3B 3OILA 1XEGA 4LU3A 3RZ5A 1CAHA 1BZMA 1EOUA 2X7TA 4YXOA 1XPZA 3M1WA 3N0NA 5E2RA 1TEUX 9CA2A 5FNKA 1BCDA 1CVEA 3KLDB 4YYTA 5EIJA 5FLQA 3P3JA 1ZH9A 4PXXA 1DMYA 3EFTA 3NI5A 4BF6A 2HOCA 3DVCA 1BNWA 1DCAA 1XQ0A 3C7PA 1FLJA 2IT4A 3MZCA 3P3HA 4ZX1A 4YGKA 1CNBA 4XIWA 1CAZA 1G4JA 4KNMA 3S77B 4HF3A 1HEBA 2CBCA 3HKQA 3Q31A 5CLUA 1RJ5A 2HNCA 4QTLA 3TVOX 4E3DA 4TWMA 3K7KA 3UYQA 4M2VA 2ABEA 5AMGA 4ZWZA 3HFPA 2EU3A 3RYXB 5EOIA 4QIZA 4K0ZA 5G01A 1G46A 1RJ6A 1MUAA 4Q87A 5FLPA 2NNVA 1HCBA 2GEHA 4Z1JA 5SZ2A 3BL0A 1BNQA 1HUHA 1CNKA 2FMGA 4YWPA 3OIMA 4WL4A 5BRVA 2QO8A 4CA2A 3MHMA 4IDRX 4PZHA 4RIVA 4MTYA 1ZSAA 1FSRA 2HFWA 3MHOA 4RFDA 1RAYA 2CBEA 3MDZA 5E5UA 4XIXA 3R16A 4R5AA 1FQRA 1DMXA 3GZ0A 3MNJA 3ML2A 2NNSA 3D8WA 3L14A 4LP6A 2Q1BA 4JSWA 4PQ7A 3M2XA 5JEHB 2NWZA 3MNKA 1CRAA 4Q7VA 3SBHA 3RLDA 1YO0A 1YDCA 5DSRA 2HL4A 4ZWYA 5EKJA 3M5SA 3DA2A 3DC3A 1LGDA 1CIMA 4CACA 5JEPB 1G6VA 1BN1A 2X7UA 4QJ0A 3FW3A 4XE1A 4MDGA 4MLTA 3V2JA 3S8XA 2OSFA 3LXEA 4JSAA 3CYUA 1KWRA 4FL7A 1CINA 1UGGA 3N3JA 5BNLA 1CNJA 2CBDA 2FNKA 4L5UA 1G54A 2NN7A 1JV0A 1CNGA 1AVNA 4Z0QA 3RGEA 3ZP9A 3DD0A 5FNLA 2EZ7A 3P4VA 3MNIA 1AM6A 3VBDA 1KOPA 1CVCA 3T5UA 5C8IA 5JQTA 1I9MA 2OSMA 3T84A 3QYKA 5FL5A 1OKMA 3KS3A 1HECA 1CCUA 5G0CA 4WR7A 3F4XA 4COQA 8CA2A 1BNTA 4HEZA 4MLXA 1CNWA 4FIKA 4G7AA 4KNJA 3IBNA 4KP5A 3S74B 3V3GB 4YGFA 1BN4A 3RYVB 5DSIA 5G03A 1TEQX 2W2JA 3P58A 5EHEA 4PYXA 4Q81A 4PYYA 1CAOA 2VVAX 3KIGA 3FFPX 5EZTX 1CAYA 4CNVA 3PYKA 3RZ1B 3V3HB 5EH8A 3P44A 2WD2A 3RZ7A 4YGLA 3R17B 3D0NA 5FL4A 3S75B 4E9OX 1HEDA 3T82A 6CA2A 1IF9A 3M96A 1Z93A 2VVBX 1CAJA 4MDMA 3D92A 4QK2A 4QK3A 4DZ7A 4FU5A 5DSQA 1G48A 5CACA 4JS6A 4QSIA 2NNGA 3DD8A 4WUQA 5EKHA 2ILIA 4K13A 3RYJB 4Q9YA 2EU2A 2POWA 4MDLA 4YXIA 1G4OA 3IBIA 2F14A 4CQ0A 3MNHA 5E2SA 4E49A 5JQ0A 1FQLA 5E5RA 4ZWIA 4YGJA 3DAZA 3NJ9A 3V3FA 5DSPA 1CA3A 1V9EA 3M5TA 4Q7WA 3JXGA 1FQNA 5DRSA 2Q1QA 3KWAA 3M3XA 2POVA 4XZ5A 5DOHA 4M2WA 5EH7A 4QSAA 1BV3A 3S72B 1CNYA 1Y7WA 5E2NA 1FR4A 3HKTA 1JD0A 4RIUA 1CVFA 4KV0A 3B4FA 3V5GA 3M2YA 3F7UA 4Q99A 12CAA 4IWZA 1UGDA 1TG9A 4Q83A 5JGSB 3OYSA 1CNXA 1RZEA 5HPJA 1J9WA 1H9QA 4LHIA 3DVBA 1ZNCA 3N2PA 5DSMA 3MNAA 5SZ3A 4Q78A 2H15A 5FL6A 5L6KA 4Q8YA 2GD8A 3M04A 3P5AA 4CNXA 3FE4A 5CJFA 1AZMA 3B1BA 3M2NA 4ITPA 1I91A 1TB0X 3OIKA 1TG3A 4HBAA 3RJ7A 3V3JA 4E3GA 4FRCA 5AMDA 3PJJA 2WD3A 1I9OA 3JXHC 3KOIA 5SZ6A 1I9PA 3M5EA 3S97A 4BF1A 4N16A 1IF5A 1HEAA 3PO6A 1TH9A 5JEGB 1CAIA 4Q8ZA 5G0BA 5JGTB 2HKKA 3W6HA 5E2MA 3JXFA 3DCCA 5LMDA 1HVAA 1T9NA 4Q7PA 5J8ZA 1KOQA 3RYZA 4L5WA 1HCAA 1F2WA 1CAMA 5DVXA 5SZ7A 3ML5A 1UGEA 1UGCA 3M14A 1UGAA 1ZE8A 4YXUA 3U7CA 1ZGFA 2FOYA 2FOVA 3M2ZA 4Q6DA 4HU1A 4BCWA 3HKUA 1RZBA 1CAKA 5FLOA 1I9NA 5DSKA 4YX4A 1CVDA 1H9NA 4ZWXA 3RZ8A 4Q07A 4DZ9A 1A42A 4RFCA 4Q0LA 1IF6A 1G3ZA 4Q8XA 1LZVA 4Q7SA 3U45X 1CCSA 1FR7A 4Y0JA 5CA2A 4TWLA 1ZSBA 3DCWA 3S9TA 5FDCA 5FNHA 1OQ5A 3KKXA 1H4NA 4Z1NA 4Q90A 5BRWA 1G52A 4KP8A 1G1DA 3KNEA 2NWYA 4HT0A 4Q06A 5FNMA 2NXTA 4JSSA 5L3OA 1OKNA 4K1QA 1BNUA 1HUGA 1BICA 2FW4A 3MWOA 3IGPA 3S78B 5FLSA 3RG3A 4G0CA 3N4BA 1LUGA 4CNRA 3DVDA 3SAXA 4QJMA 2NWOA 5EH5A 1TE3X 1CNCA 1CZMA 2CABA 1CVAA 1G0EA 1UGBA 5DSJA 1ZSCA 3HLJA 3MNUA 4KNIA 5FDIA 4N0XB 4Q49A 1YO1A 3V2MA 1BN3A 1IF7A 4JSZA 2H4NA 1FQMA
chains in the Genus database with same CATH superfamily
5DSOA 3CA2A 4RUZA 4HEWA 3HS4A 1KEQA 4MO8A 1YO2A 2CBBA 4KUWA 3TVNX 1ZFKA 1RZAA 1THKA 4QJWA 4RUXA 1I9LA 3RG4A 3V7XA 2FOSA 5EHVA 4L5VA 1Z9YA 5SZ5A 5A25A 4WW8A 3M67A 1G53A 4KAPA 5SZ1A 3OKVA 3F7BA 4KUVA 3DCSA 4Q08A 1CCTA 5FNGA 4Z1EA 3P5LA 3S73B 4E5QA 4QSJA 1TBTX 2AW1A 4YVYA 5E2KA 5IPZA 2FMZA 3M1KA 2AX2A 5SZ0A 1V9IC 1CA2A 1YDBA 4R5BA 3IBLA 2ZNCA 3P55A 4R59A 1I90A 3BETA 3CZVA 4WW6A 1RZDA 3KONA 3OY0A 1CNHA 2FOUA 4Z1KA 2NWPA 2NXSA 3M40A 3U47A 1JCZA 5E28A 3HKNA 3EFIA 1ZGEA 1TTMA 4FPTA 4Q6EA 3SBIA 4X5SA 4CNWA 2Q38A 4UOVA 5SZ4A 2WEHA 3RYYA 4E4AA 3MMFA 2FNNA 2O4ZA 3M98A 1CILA 4WUPA 5JESB 1BNVA 2WEGA 3ZNCA 5BRUA 5FLRA 3UYNA 2NXRA 3MYQA 1ZFQA 4RUYA 3M1JA 4FVOA 3V3IB 5JG5B 1CVHA 3F8EA 3TMJA 3S71B 4ETQC 1YDAA 4ZAOA 5AMLA 3MHCA 4GL1X 4Q09A 3IBUA 3MHIA 3KOKA 1G0FA 4XFWA 1UGFA 3BL1A 1RAZA 1CVBA 1FSNA 3W6IA 1OKLA 5DSNA 3NB5A 4HEYA 3IAIA 5EKMA 2FOQA 3IEOA 1DCBA 2CBAA 1BNMA 4K0TA 4FVNA 3M1QA 5EHWA 1KWQA 5FNIA 1BNNA 2NN1A 3K2FA 4QJPA 1Z97A 1LG5A 1XEVA 4QIYA 4QSBA 3CAJA 4YHAA 2HD6A 3K34A 4KUYA 2POUA 5BYIA 4K0SA 5A6HA 2WEOA 1I9QA 1IF8A 1FSQA 4M2RA 2WEJA 3SAPA 2QOAA 5FNJA 3T83A 4C3TA 4ILXA 2NMXA 3S76A 1CRMA 3D9ZA 3DC9A 3D93A 4QJXA 4M2UA 4E3FA 2QP6A 4E3HA 5DSLA 1LG6A 4QY3A 4ITOA 1IF4A 4QEFA 1YDDA 4YGNA 3DBUA 4ZX0A 1RZCA 3T85A 1I8ZA 1MOOA 2X7SA 3MHLA 2NNOA 3U3AX 2FNMA 4QK1A 1CALA 3OKUA 5JDVB 7CA2A 5FLTA 4RN4A 4QJOA 4HT2A 1G45A 1URTA 1CNIA 2CA2A 4RH2A 3OYQA 3T5ZA 1CANA 5DOGA 3RZ0B 4KNNA 3DV7A 5JG3B 3OILA 1XEGA 4LU3A 3RZ5A 1CAHA 1BZMA 1EOUA 2X7TA 4YXOA 1XPZA 3M1WA 3N0NA 5E2RA 1TEUX 9CA2A 5FNKA 1BCDA 1CVEA 3KLDB 4YYTA 5EIJA 5FLQA 3P3JA 1ZH9A 4PXXA 1DMYA 3EFTA 3NI5A 4BF6A 2HOCA 3DVCA 1BNWA 1DCAA 1XQ0A 3C7PA 1FLJA 2IT4A 3MZCA 3P3HA 4ZX1A 4YGKA 1CNBA 4XIWA 1CAZA 1G4JA 4KNMA 3S77B 4HF3A 1HEBA 2CBCA 3HKQA 3Q31A 5CLUA 1RJ5A 2HNCA 4QTLA 3TVOX 4E3DA 4TWMA 3K7KA 3UYQA 4M2VA 2ABEA 5AMGA 4ZWZA 3HFPA 2EU3A 3RYXB 5EOIA 4QIZA 4K0ZA 5G01A 1G46A 1RJ6A 1MUAA 4Q87A 5FLPA 2NNVA 1HCBA 2GEHA 4Z1JA 5SZ2A 3BL0A 1BNQA 1HUHA 1CNKA 2FMGA 4YWPA 3OIMA 4WL4A 5BRVA 2QO8A 4CA2A 3MHMA 4IDRX 4PZHA 4RIVA 4MTYA 1ZSAA 1FSRA 2HFWA 3MHOA 4RFDA 1RAYA 2CBEA 3MDZA 5E5UA 4XIXA 3R16A 4R5AA 1FQRA 1DMXA 3GZ0A 3MNJA 3ML2A 2NNSA 3D8WA 3L14A 4LP6A 2Q1BA 4JSWA 4PQ7A 3M2XA 5JEHB 2NWZA 3MNKA 1CRAA 4Q7VA 3SBHA 3RLDA 1YO0A 1YDCA 5DSRA 2HL4A 4ZWYA 5EKJA 3M5SA 3DA2A 3DC3A 1LGDA 1CIMA 4CACA 5JEPB 1G6VA 1BN1A 2X7UA 4QJ0A 3FW3A 4XE1A 4MDGA 4MLTA 3V2JA 3S8XA 2OSFA 3LXEA 4JSAA 3CYUA 1KWRA 4FL7A 1CINA 1UGGA 3N3JA 5BNLA 1CNJA 2CBDA 2FNKA 4L5UA 1G54A 2NN7A 1JV0A 1CNGA 1AVNA 4Z0QA 3RGEA 3ZP9A 3DD0A 5FNLA 2EZ7A 3P4VA 3MNIA 1AM6A 3VBDA 1KOPA 1CVCA 3T5UA 5C8IA 5JQTA 1I9MA 2OSMA 3T84A 3QYKA 5FL5A 1OKMA 3KS3A 1HECA 1CCUA 5G0CA 4WR7A 3F4XA 4COQA 8CA2A 1BNTA 4HEZA 4MLXA 1CNWA 4FIKA 4G7AA 4KNJA 3IBNA 4KP5A 3S74B 3V3GB 4YGFA 1BN4A 3RYVB 5DSIA 5G03A 1TEQX 2W2JA 3P58A 5EHEA 4PYXA 4Q81A 4PYYA 1CAOA 2VVAX 3KIGA 3FFPX 5EZTX 1CAYA 4CNVA 3PYKA 3RZ1B 3V3HB 5EH8A 3P44A 2WD2A 3RZ7A 4YGLA 3R17B 3D0NA 5FL4A 3S75B 4E9OX 1HEDA 3T82A 6CA2A 1IF9A 3M96A 1Z93A 2VVBX 1CAJA 4MDMA 3D92A 4QK2A 4QK3A 4DZ7A 4FU5A 5DSQA 1G48A 5CACA 4JS6A 4QSIA 2NNGA 3DD8A 4WUQA 5EKHA 2ILIA 4K13A 3RYJB 4Q9YA 2EU2A 2POWA 4MDLA 4YXIA 1G4OA 3IBIA 2F14A 4CQ0A 3MNHA 5E2SA 4E49A 5JQ0A 1FQLA 5E5RA 4ZWIA 4YGJA 3DAZA 3NJ9A 3V3FA 5DSPA 1CA3A 1V9EA 3M5TA 4Q7WA 3JXGA 1FQNA 5DRSA 2Q1QA 3KWAA 3M3XA 2POVA 4XZ5A 5DOHA 4M2WA 5EH7A 4QSAA 1BV3A 3S72B 1CNYA 1Y7WA 5E2NA 1FR4A 3HKTA 1JD0A 4RIUA 1CVFA 4KV0A 3B4FA 3V5GA 3M2YA 3F7UA 4Q99A 12CAA 4IWZA 1UGDA 1TG9A 4Q83A 5JGSB 3OYSA 1CNXA 1RZEA 5HPJA 1J9WA 1H9QA 4LHIA 3DVBA 1ZNCA 3N2PA 5DSMA 3MNAA 5SZ3A 4Q78A 2H15A 5FL6A 5L6KA 4Q8YA 2GD8A 3M04A 3P5AA 4CNXA 3FE4A 5CJFA 1AZMA 3B1BA 3M2NA 4ITPA 1I91A 1TB0X 3OIKA 1TG3A 4HBAA 3RJ7A 3V3JA 4E3GA 4FRCA 5AMDA 3PJJA 2WD3A 1I9OA 3JXHC 3KOIA 5SZ6A 1I9PA 3M5EA 3S97A 4BF1A 4N16A 1IF5A 1HEAA 3PO6A 1TH9A 5JEGB 1CAIA 4Q8ZA 5G0BA 5JGTB 2HKKA 3W6HA 5E2MA 3JXFA 3DCCA 5LMDA 1HVAA 1T9NA 4Q7PA 5J8ZA 1KOQA 3RYZA 4L5WA 1HCAA 1F2WA 1CAMA 5DVXA 5SZ7A 3ML5A 1UGEA 1UGCA 3M14A 1UGAA 1ZE8A 4YXUA 3U7CA 1ZGFA 2FOYA 2FOVA 3M2ZA 4Q6DA 4HU1A 4BCWA 3HKUA 1RZBA 1CAKA 5FLOA 1I9NA 5DSKA 4YX4A 1CVDA 1H9NA 4ZWXA 3RZ8A 4Q07A 4DZ9A 1A42A 4RFCA 4Q0LA 1IF6A 1G3ZA 4Q8XA 1LZVA 4Q7SA 3U45X 1CCSA 1FR7A 4Y0JA 5CA2A 4TWLA 1ZSBA 3DCWA 3S9TA 5FDCA 5FNHA 1OQ5A 3KKXA 1H4NA 4Z1NA 4Q90A 5BRWA 1G52A 4KP8A 1G1DA 3KNEA 2NWYA 4HT0A 4Q06A 5FNMA 2NXTA 4JSSA 5L3OA 1OKNA 4K1QA 1BNUA 1HUGA 1BICA 2FW4A 3MWOA 3IGPA 3S78B 5FLSA 3RG3A 4G0CA 3N4BA 1LUGA 4CNRA 3DVDA 3SAXA 4QJMA 2NWOA 5EH5A 1TE3X 1CNCA 1CZMA 2CABA 1CVAA 1G0EA 1UGBA 5DSJA 1ZSCA 3HLJA 3MNUA 4KNIA 5FDIA 4N0XB 4Q49A 1YO1A 3V2MA 1BN3A 1IF7A 4JSZA 2H4NA 1FQMA
chains in the Genus database with same CATH topology
5DSOA 3CA2A 4RUZA 4HEWA 3HS4A 1KEQA 4MO8A 1YO2A 2CBBA 4KUWA 3TVNX 1ZFKA 1RZAA 1THKA 4QJWA 4RUXA 1I9LA 3RG4A 3V7XA 2FOSA 5EHVA 4L5VA 1Z9YA 5SZ5A 5A25A 4WW8A 3M67A 1G53A 4KAPA 5SZ1A 3OKVA 3F7BA 4KUVA 3DCSA 4Q08A 1CCTA 5FNGA 4Z1EA 3P5LA 3S73B 4E5QA 4QSJA 1TBTX 2AW1A 4YVYA 5E2KA 5IPZA 2FMZA 3M1KA 2AX2A 5SZ0A 1V9IC 1CA2A 1YDBA 4R5BA 3IBLA 2ZNCA 3P55A 4R59A 1I90A 3BETA 3CZVA 4WW6A 1RZDA 3KONA 3OY0A 1CNHA 2FOUA 4Z1KA 2NWPA 2NXSA 3M40A 3U47A 1JCZA 5E28A 3HKNA 3EFIA 1ZGEA 1TTMA 4FPTA 4Q6EA 3SBIA 4X5SA 4CNWA 2Q38A 4UOVA 5SZ4A 2WEHA 3RYYA 4E4AA 3MMFA 2FNNA 2O4ZA 3M98A 1CILA 4WUPA 5JESB 1BNVA 2WEGA 3ZNCA 5BRUA 5FLRA 3UYNA 2NXRA 3MYQA 1ZFQA 4RUYA 3M1JA 4FVOA 3V3IB 5JG5B 1CVHA 3F8EA 3TMJA 3S71B 4ETQC 1YDAA 4ZAOA 5AMLA 3MHCA 4GL1X 4Q09A 3IBUA 3MHIA 3KOKA 1G0FA 4XFWA 1UGFA 3BL1A 1RAZA 1CVBA 1FSNA 3W6IA 1OKLA 5DSNA 3NB5A 4HEYA 3IAIA 5EKMA 2FOQA 3IEOA 1DCBA 2CBAA 1BNMA 4K0TA 4FVNA 3M1QA 5EHWA 1KWQA 5FNIA 1BNNA 2NN1A 3K2FA 4QJPA 1Z97A 1LG5A 1XEVA 4QIYA 4QSBA 3CAJA 4YHAA 2HD6A 3K34A 4KUYA 2POUA 5BYIA 4K0SA 5A6HA 2WEOA 1I9QA 1IF8A 1FSQA 4M2RA 2WEJA 3SAPA 2QOAA 5FNJA 3T83A 4C3TA 4ILXA 2NMXA 3S76A 1CRMA 3D9ZA 3DC9A 3D93A 4QJXA 4M2UA 4E3FA 2QP6A 4E3HA 5DSLA 1LG6A 4QY3A 4ITOA 1IF4A 4QEFA 1YDDA 4YGNA 3DBUA 4ZX0A 1RZCA 3T85A 1I8ZA 1MOOA 2X7SA 3MHLA 2NNOA 3U3AX 2FNMA 4QK1A 1CALA 3OKUA 5JDVB 7CA2A 5FLTA 4RN4A 4QJOA 4HT2A 1G45A 1URTA 1CNIA 2CA2A 4RH2A 3OYQA 3T5ZA 1CANA 5DOGA 3RZ0B 4KNNA 3DV7A 5JG3B 3OILA 1XEGA 4LU3A 3RZ5A 1CAHA 1BZMA 1EOUA 2X7TA 4YXOA 1XPZA 3M1WA 3N0NA 5E2RA 1TEUX 9CA2A 5FNKA 1BCDA 1CVEA 3KLDB 4YYTA 5EIJA 5FLQA 3P3JA 1ZH9A 4PXXA 1DMYA 3EFTA 3NI5A 4BF6A 2HOCA 3DVCA 1BNWA 1DCAA 1XQ0A 3C7PA 1FLJA 2IT4A 3MZCA 3P3HA 4ZX1A 4YGKA 1CNBA 4XIWA 1CAZA 1G4JA 4KNMA 3S77B 4HF3A 1HEBA 2CBCA 3HKQA 3Q31A 5CLUA 1RJ5A 2HNCA 4QTLA 3TVOX 4E3DA 4TWMA 3K7KA 3UYQA 4M2VA 2ABEA 5AMGA 4ZWZA 3HFPA 2EU3A 3RYXB 5EOIA 4QIZA 4K0ZA 5G01A 1G46A 1RJ6A 1MUAA 4Q87A 5FLPA 2NNVA 1HCBA 2GEHA 4Z1JA 5SZ2A 3BL0A 1BNQA 1HUHA 1CNKA 2FMGA 4YWPA 3OIMA 4WL4A 5BRVA 2QO8A 4CA2A 3MHMA 4IDRX 4PZHA 4RIVA 4MTYA 1ZSAA 1FSRA 2HFWA 3MHOA 4RFDA 1RAYA 2CBEA 3MDZA 5E5UA 4XIXA 3R16A 4R5AA 1FQRA 1DMXA 3GZ0A 3MNJA 3ML2A 2NNSA 3D8WA 3L14A 4LP6A 2Q1BA 4JSWA 4PQ7A 3M2XA 5JEHB 2NWZA 3MNKA 1CRAA 4Q7VA 3SBHA 3RLDA 1YO0A 1YDCA 5DSRA 2HL4A 4ZWYA 5EKJA 3M5SA 3DA2A 3DC3A 1LGDA 1CIMA 4CACA 5JEPB 1G6VA 1BN1A 2X7UA 4QJ0A 3FW3A 4XE1A 4MDGA 4MLTA 3V2JA 3S8XA 2OSFA 3LXEA 4JSAA 3CYUA 1KWRA 4FL7A 1CINA 1UGGA 3N3JA 5BNLA 1CNJA 2CBDA 2FNKA 4L5UA 1G54A 2NN7A 1JV0A 1CNGA 1AVNA 4Z0QA 3RGEA 3ZP9A 3DD0A 5FNLA 2EZ7A 3P4VA 3MNIA 1AM6A 3VBDA 1KOPA 1CVCA 3T5UA 5C8IA 5JQTA 1I9MA 2OSMA 3T84A 3QYKA 5FL5A 1OKMA 3KS3A 1HECA 1CCUA 5G0CA 4WR7A 3F4XA 4COQA 8CA2A 1BNTA 4HEZA 4MLXA 1CNWA 4FIKA 4G7AA 4KNJA 3IBNA 4KP5A 3S74B 3V3GB 4YGFA 1BN4A 3RYVB 5DSIA 5G03A 1TEQX 2W2JA 3P58A 5EHEA 4PYXA 4Q81A 4PYYA 1CAOA 2VVAX 3KIGA 3FFPX 5EZTX 1CAYA 4CNVA 3PYKA 3RZ1B 3V3HB 5EH8A 3P44A 2WD2A 3RZ7A 4YGLA 3R17B 3D0NA 5FL4A 3S75B 4E9OX 1HEDA 3T82A 6CA2A 1IF9A 3M96A 1Z93A 2VVBX 1CAJA 4MDMA 3D92A 4QK2A 4QK3A 4DZ7A 4FU5A 5DSQA 1G48A 5CACA 4JS6A 4QSIA 2NNGA 3DD8A 4WUQA 5EKHA 2ILIA 4K13A 3RYJB 4Q9YA 2EU2A 2POWA 4MDLA 4YXIA 1G4OA 3IBIA 2F14A 4CQ0A 3MNHA 5E2SA 4E49A 5JQ0A 1FQLA 5E5RA 4ZWIA 4YGJA 3DAZA 3NJ9A 3V3FA 5DSPA 1CA3A 1V9EA 3M5TA 4Q7WA 3JXGA 1FQNA 5DRSA 2Q1QA 3KWAA 3M3XA 2POVA 4XZ5A 5DOHA 4M2WA 5EH7A 4QSAA 1BV3A 3S72B 1CNYA 1Y7WA 5E2NA 1FR4A 3HKTA 1JD0A 4RIUA 1CVFA 4KV0A 3B4FA 3V5GA 3M2YA 3F7UA 4Q99A 12CAA 4IWZA 1UGDA 1TG9A 4Q83A 5JGSB 3OYSA 1CNXA 1RZEA 5HPJA 1J9WA 1H9QA 4LHIA 3DVBA 1ZNCA 3N2PA 5DSMA 3MNAA 5SZ3A 4Q78A 2H15A 5FL6A 5L6KA 4Q8YA 2GD8A 3M04A 3P5AA 4CNXA 3FE4A 5CJFA 1AZMA 3B1BA 3M2NA 4ITPA 1I91A 1TB0X 3OIKA 1TG3A 4HBAA 3RJ7A 3V3JA 4E3GA 4FRCA 5AMDA 3PJJA 2WD3A 1I9OA 3JXHC 3KOIA 5SZ6A 1I9PA 3M5EA 3S97A 4BF1A 4N16A 1IF5A 1HEAA 3PO6A 1TH9A 5JEGB 1CAIA 4Q8ZA 5G0BA 5JGTB 2HKKA 3W6HA 5E2MA 3JXFA 3DCCA 5LMDA 1HVAA 1T9NA 4Q7PA 5J8ZA 1KOQA 3RYZA 4L5WA 1HCAA 1F2WA 1CAMA 5DVXA 5SZ7A 3ML5A 1UGEA 1UGCA 3M14A 1UGAA 1ZE8A 4YXUA 3U7CA 1ZGFA 2FOYA 2FOVA 3M2ZA 4Q6DA 4HU1A 4BCWA 3HKUA 1RZBA 1CAKA 5FLOA 1I9NA 5DSKA 4YX4A 1CVDA 1H9NA 4ZWXA 3RZ8A 4Q07A 4DZ9A 1A42A 4RFCA 4Q0LA 1IF6A 1G3ZA 4Q8XA 1LZVA 4Q7SA 3U45X 1CCSA 1FR7A 4Y0JA 5CA2A 4TWLA 1ZSBA 3DCWA 3S9TA 5FDCA 5FNHA 1OQ5A 3KKXA 1H4NA 4Z1NA 4Q90A 5BRWA 1G52A 4KP8A 1G1DA 3KNEA 2NWYA 4HT0A 4Q06A 5FNMA 2NXTA 4JSSA 5L3OA 1OKNA 4K1QA 1BNUA 1HUGA 1BICA 2FW4A 3MWOA 3IGPA 3S78B 5FLSA 3RG3A 4G0CA 3N4BA 1LUGA 4CNRA 3DVDA 3SAXA 4QJMA 2NWOA 5EH5A 1TE3X 1CNCA 1CZMA 2CABA 1CVAA 1G0EA 1UGBA 5DSJA 1ZSCA 3HLJA 3MNUA 4KNIA 5FDIA 4N0XB 4Q49A 1YO1A 3V2MA 1BN3A 1IF7A 4JSZA 2H4NA 1FQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DSO A;  3CA2 A;  4RUZ A;  4HEW A;  3HS4 A;  1KEQ A;  4MO8 A;  1YO2 A;  2CBB A;  4KUW A;  3TVN X;  1ZFK A;  1RZA A;  1THK A;  4QJW A;  4RUX A;  1I9L A;  3RG4 A;  3V7X A;  2FOS A;  5EHV A;  4L5V A;  1Z9Y A;  5SZ5 A;  5A25 A;  4WW8 A;  3M67 A;  1G53 A;  4KAP A;  5SZ1 A;  3OKV A;  3F7B A;  4KUV A;  3DCS A;  4Q08 A;  1CCT A;  5FNG A;  4Z1E A;  3P5L A;  3S73 B;  4E5Q A;  4QSJ A;  1TBT X;  2AW1 A;  4YVY A;  5E2K A;  5IPZ A;  2FMZ A;  3M1K A;  2AX2 A;  5SZ0 A;  1V9I C;  1CA2 A;  1YDB A;  4R5B A;  3IBL A;  2ZNC A;  3P55 A;  4R59 A;  1I90 A;  3BET A;  3CZV A;  4WW6 A;  1RZD A;  3KON A;  3OY0 A;  1CNH A;  2FOU A;  4Z1K A;  2NWP A;  2NXS A;  3M40 A;  3U47 A;  1JCZ A;  5E28 A;  3HKN A;  3EFI A;  1ZGE A;  1TTM A;  4FPT A;  4Q6E A;  3SBI A;  4X5S A;  4CNW A;  2Q38 A;  4UOV A;  5SZ4 A;  2WEH A;  3RYY A;  4E4A A;  3MMF A;  2FNN A;  2O4Z A;  3M98 A;  1CIL A;  4WUP A;  5JES B;  1BNV A;  2WEG A;  3ZNC A;  5BRU A;  5FLR A;  3UYN A;  2NXR A;  3MYQ A;  1ZFQ A;  4RUY A;  3M1J A;  4FVO A;  3V3I B;  5JG5 B;  1CVH A;  3F8E A;  3TMJ A;  3S71 B;  4ETQ C;  1YDA A;  4ZAO A;  5AML A;  3MHC A;  4GL1 X;  4Q09 A;  3IBU A;  3MHI A;  3KOK A;  1G0F A;  4XFW A;  1UGF A;  3BL1 A;  1RAZ A;  1CVB A;  1FSN A;  3W6I A;  1OKL A;  5DSN A;  3NB5 A;  4HEY A;  3IAI A;  5EKM A;  2FOQ A;  3IEO A;  1DCB A;  2CBA A;  1BNM A;  4K0T A;  4FVN A;  3M1Q A;  5EHW A;  1KWQ A;  5FNI A;  1BNN A;  2NN1 A;  3K2F A;  4QJP A;  1Z97 A;  1LG5 A;  1XEV A;  4QIY A;  4QSB A;  3CAJ A;  4YHA A;  2HD6 A;  3K34 A;  4KUY A;  2POU A;  5BYI A;  4K0S A;  5A6H A;  2WEO A;  1I9Q A;  1IF8 A;  1FSQ A;  4M2R A;  2WEJ A;  3SAP A;  2QOA A;  5FNJ A;  3T83 A;  4C3T A;  4ILX A;  2NMX A;  3S76 A;  1CRM A;  3D9Z A;  3DC9 A;  3D93 A;  4QJX A;  4M2U A;  4E3F A;  2QP6 A;  4E3H A;  5DSL A;  1LG6 A;  4QY3 A;  4ITO A;  1IF4 A;  4QEF A;  1YDD A;  4YGN A;  3DBU A;  4ZX0 A;  1RZC A;  3T85 A;  1I8Z A;  1MOO A;  2X7S A;  3MHL A;  2NNO A;  3U3A X;  2FNM A;  4QK1 A;  1CAL A;  3OKU A;  5JDV B;  7CA2 A;  5FLT A;  4RN4 A;  4QJO A;  4HT2 A;  1G45 A;  1URT A;  1CNI A;  2CA2 A;  4RH2 A;  3OYQ A;  3T5Z A;  1CAN A;  5DOG A;  3RZ0 B;  4KNN A;  3DV7 A;  5JG3 B;  3OIL A;  1XEG A;  4LU3 A;  3RZ5 A;  1CAH A;  1BZM A;  1EOU A;  2X7T A;  4YXO A;  1XPZ A;  3M1W A;  3N0N A;  5E2R A;  1TEU X;  9CA2 A;  5FNK A;  1BCD A;  1CVE A;  3KLD B;  4YYT A;  5EIJ A;  5FLQ A;  3P3J A;  1ZH9 A;  4PXX A;  1DMY A;  3EFT A;  3NI5 A;  4BF6 A;  2HOC A;  3DVC A;  1BNW A;  1DCA A;  1XQ0 A;  3C7P A;  1FLJ A;  2IT4 A;  3MZC A;  3P3H A;  4ZX1 A;  4YGK A;  1CNB A;  4XIW A;  1CAZ A;  1G4J A;  4KNM A;  3S77 B;  4HF3 A;  1HEB A;  2CBC A;  3HKQ A;  3Q31 A;  5CLU A;  1RJ5 A;  2HNC A;  4QTL A;  3TVO X;  4E3D A;  4TWM A;  3K7K A;  3UYQ A;  4M2V A;  2ABE A;  5AMG A;  4ZWZ A;  3HFP A;  2EU3 A;  3RYX B;  5EOI A;  4QIZ A;  4K0Z A;  5G01 A;  1G46 A;  1RJ6 A;  1MUA A;  4Q87 A;  5FLP A;  2NNV A;  1HCB A;  2GEH A;  4Z1J A;  5SZ2 A;  3BL0 A;  1BNQ A;  1HUH A;  1CNK A;  2FMG A;  4YWP A;  3OIM A;  4WL4 A;  5BRV A;  2QO8 A;  4CA2 A;  3MHM A;  4IDR X;  4PZH A;  4RIV A;  4MTY A;  1ZSA A;  1FSR A;  2HFW A;  3MHO A;  4RFD A;  1RAY A;  2CBE A;  3MDZ A;  5E5U A;  4XIX A;  3R16 A;  4R5A A;  1FQR A;  1DMX A;  3GZ0 A;  3MNJ A;  3ML2 A;  2NNS A;  3D8W A;  3L14 A;  4LP6 A;  2Q1B A;  4JSW A;  4PQ7 A;  3M2X A;  5JEH B;  2NWZ A;  3MNK A;  1CRA A;  4Q7V A;  3SBH A;  3RLD A;  1YO0 A;  1YDC A;  5DSR A;  2HL4 A;  4ZWY A;  5EKJ A;  3M5S A;  3DA2 A;  3DC3 A;  1LGD A;  1CIM A;  4CAC A;  5JEP B;  1G6V A;  1BN1 A;  2X7U A;  4QJ0 A;  3FW3 A;  4XE1 A;  4MDG A;  4MLT A;  3V2J A;  3S8X A;  2OSF A;  3LXE A;  4JSA A;  3CYU A;  1KWR A;  4FL7 A;  1CIN A;  1UGG A;  3N3J A;  5BNL A;  1CNJ A;  2CBD A;  2FNK A;  4L5U A;  1G54 A;  2NN7 A;  1JV0 A;  1CNG A;  1AVN A;  4Z0Q A;  3RGE A;  3ZP9 A;  3DD0 A;  5FNL A;  2EZ7 A;  3P4V A;  3MNI A;  1AM6 A;  3VBD A;  1KOP A;  1CVC A;  3T5U A;  5C8I A;  5JQT A;  1I9M A;  2OSM A;  3T84 A;  3QYK A;  5FL5 A;  1OKM A;  3KS3 A;  1HEC A;  1CCU A;  5G0C A;  4WR7 A;  3F4X A;  4COQ A;  8CA2 A;  1BNT A;  4HEZ A;  4MLX A;  1CNW A;  4FIK A;  4G7A A;  4KNJ A;  3IBN A;  4KP5 A;  3S74 B;  3V3G B;  4YGF A;  1BN4 A;  3RYV B;  5DSI A;  5G03 A;  1TEQ X;  2W2J A;  3P58 A;  5EHE A;  4PYX A;  4Q81 A;  4PYY A;  1CAO A;  2VVA X;  3KIG A;  3FFP X;  5EZT X;  1CAY A;  4CNV A;  3PYK A;  3RZ1 B;  3V3H B;  5EH8 A;  3P44 A;  2WD2 A;  3RZ7 A;  4YGL A;  3R17 B;  3D0N A;  5FL4 A;  3S75 B;  4E9O X;  1HED A;  3T82 A;  6CA2 A;  1IF9 A;  3M96 A;  1Z93 A;  2VVB X;  1CAJ A;  4MDM A;  3D92 A;  4QK2 A;  4QK3 A;  4DZ7 A;  4FU5 A;  5DSQ A;  1G48 A;  5CAC A;  4JS6 A;  4QSI A;  2NNG A;  3DD8 A;  4WUQ A;  5EKH A;  2ILI A;  4K13 A;  3RYJ B;  4Q9Y A;  2EU2 A;  2POW A;  4MDL A;  4YXI A;  1G4O A;  3IBI A;  2F14 A;  4CQ0 A;  3MNH A;  5E2S A;  4E49 A;  5JQ0 A;  1FQL A;  5E5R A;  4ZWI A;  4YGJ A;  3DAZ A;  3NJ9 A;  3V3F A;  5DSP A;  1CA3 A;  1V9E A;  3M5T A;  4Q7W A;  3JXG A;  1FQN A;  5DRS A;  2Q1Q A;  3KWA A;  3M3X A;  2POV A;  4XZ5 A;  5DOH A;  4M2W A;  5EH7 A;  4QSA A;  1BV3 A;  3S72 B;  1CNY A;  1Y7W A;  5E2N A;  1FR4 A;  3HKT A;  1JD0 A;  4RIU A;  1CVF A;  4KV0 A;  3B4F A;  3V5G A;  3M2Y A;  3F7U A;  4Q99 A;  12CA A;  4IWZ A;  1UGD A;  1TG9 A;  4Q83 A;  5JGS B;  3OYS A;  1CNX A;  1RZE A;  5HPJ A;  1J9W A;  1H9Q A;  4LHI A;  3DVB A;  1ZNC A;  3N2P A;  5DSM A;  3MNA A;  5SZ3 A;  4Q78 A;  2H15 A;  5FL6 A;  5L6K A;  4Q8Y A;  2GD8 A;  3M04 A;  3P5A A;  4CNX A;  3FE4 A;  5CJF A;  1AZM A;  3B1B A;  3M2N A;  4ITP A;  1I91 A;  1TB0 X;  3OIK A;  1TG3 A;  4HBA A;  3RJ7 A;  3V3J A;  4E3G A;  4FRC A;  5AMD A;  3PJJ A;  2WD3 A;  1I9O A;  3JXH C;  3KOI A;  5SZ6 A;  1I9P A;  3M5E A;  3S97 A;  4BF1 A;  4N16 A;  1IF5 A;  1HEA A;  3PO6 A;  1TH9 A;  5JEG B;  1CAI A;  4Q8Z A;  5G0B A;  5JGT B;  2HKK A;  3W6H A;  5E2M A;  3JXF A;  3DCC A;  5LMD A;  1HVA A;  1T9N A;  4Q7P A;  5J8Z A;  1KOQ A;  3RYZ A;  4L5W A;  1HCA A;  1F2W A;  1CAM A;  5DVX A;  5SZ7 A;  3ML5 A;  1UGE A;  1UGC A;  3M14 A;  1UGA A;  1ZE8 A;  4YXU A;  3U7C A;  1ZGF A;  2FOY A;  2FOV A;  3M2Z A;  4Q6D A;  4HU1 A;  4BCW A;  3HKU A;  1RZB A;  1CAK A;  5FLO A;  1I9N A;  5DSK A;  4YX4 A;  1CVD A;  1H9N A;  4ZWX A;  3RZ8 A;  4Q07 A;  4DZ9 A;  1A42 A;  4RFC A;  4Q0L A;  1IF6 A;  1G3Z A;  4Q8X A;  1LZV A;  4Q7S A;  3U45 X;  1CCS A;  1FR7 A;  4Y0J A;  5CA2 A;  4TWL A;  1ZSB A;  3DCW A;  3S9T A;  5FDC A;  5FNH A;  1OQ5 A;  3KKX A;  1H4N A;  4Z1N A;  4Q90 A;  5BRW A;  1G52 A;  4KP8 A;  1G1D A;  3KNE A;  2NWY A;  4HT0 A;  4Q06 A;  5FNM A;  2NXT A;  4JSS A;  5L3O A;  1OKN A;  4K1Q A;  1BNU A;  1HUG A;  1BIC A;  2FW4 A;  3MWO A;  3IGP A;  3S78 B;  5FLS A;  3RG3 A;  4G0C A;  3N4B A;  1LUG A;  4CNR A;  3DVD A;  3SAX A;  4QJM A;  2NWO A;  5EH5 A;  1TE3 X;  1CNC A;  1CZM A;  2CAB A;  1CVA A;  1G0E A;  1UGB A;  5DSJ A;  1ZSC A;  3HLJ A;  3MNU A;  4KNI A;  5FDI A;  4N0X B;  4Q49 A;  1YO1 A;  3V2M A;  1BN3 A;  1IF7 A;  4JSZ A;  2H4N A;  1FQM A; 
#chains in the Genus database with same CATH topology
 5DSO A;  3CA2 A;  4RUZ A;  4HEW A;  3HS4 A;  1KEQ A;  4MO8 A;  1YO2 A;  2CBB A;  4KUW A;  3TVN X;  1ZFK A;  1RZA A;  1THK A;  4QJW A;  4RUX A;  1I9L A;  3RG4 A;  3V7X A;  2FOS A;  5EHV A;  4L5V A;  1Z9Y A;  5SZ5 A;  5A25 A;  4WW8 A;  3M67 A;  1G53 A;  4KAP A;  5SZ1 A;  3OKV A;  3F7B A;  4KUV A;  3DCS A;  4Q08 A;  1CCT A;  5FNG A;  4Z1E A;  3P5L A;  3S73 B;  4E5Q A;  4QSJ A;  1TBT X;  2AW1 A;  4YVY A;  5E2K A;  5IPZ A;  2FMZ A;  3M1K A;  2AX2 A;  5SZ0 A;  1V9I C;  1CA2 A;  1YDB A;  4R5B A;  3IBL A;  2ZNC A;  3P55 A;  4R59 A;  1I90 A;  3BET A;  3CZV A;  4WW6 A;  1RZD A;  3KON A;  3OY0 A;  1CNH A;  2FOU A;  4Z1K A;  2NWP A;  2NXS A;  3M40 A;  3U47 A;  1JCZ A;  5E28 A;  3HKN A;  3EFI A;  1ZGE A;  1TTM A;  4FPT A;  4Q6E A;  3SBI A;  4X5S A;  4CNW A;  2Q38 A;  4UOV A;  5SZ4 A;  2WEH A;  3RYY A;  4E4A A;  3MMF A;  2FNN A;  2O4Z A;  3M98 A;  1CIL A;  4WUP A;  5JES B;  1BNV A;  2WEG A;  3ZNC A;  5BRU A;  5FLR A;  3UYN A;  2NXR A;  3MYQ A;  1ZFQ A;  4RUY A;  3M1J A;  4FVO A;  3V3I B;  5JG5 B;  1CVH A;  3F8E A;  3TMJ A;  3S71 B;  4ETQ C;  1YDA A;  4ZAO A;  5AML A;  3MHC A;  4GL1 X;  4Q09 A;  3IBU A;  3MHI A;  3KOK A;  1G0F A;  4XFW A;  1UGF A;  3BL1 A;  1RAZ A;  1CVB A;  1FSN A;  3W6I A;  1OKL A;  5DSN A;  3NB5 A;  4HEY A;  3IAI A;  5EKM A;  2FOQ A;  3IEO A;  1DCB A;  2CBA A;  1BNM A;  4K0T A;  4FVN A;  3M1Q A;  5EHW A;  1KWQ A;  5FNI A;  1BNN A;  2NN1 A;  3K2F A;  4QJP A;  1Z97 A;  1LG5 A;  1XEV A;  4QIY A;  4QSB A;  3CAJ A;  4YHA A;  2HD6 A;  3K34 A;  4KUY A;  2POU A;  5BYI A;  4K0S A;  5A6H A;  2WEO A;  1I9Q A;  1IF8 A;  1FSQ A;  4M2R A;  2WEJ A;  3SAP A;  2QOA A;  5FNJ A;  3T83 A;  4C3T A;  4ILX A;  2NMX A;  3S76 A;  1CRM A;  3D9Z A;  3DC9 A;  3D93 A;  4QJX A;  4M2U A;  4E3F A;  2QP6 A;  4E3H A;  5DSL A;  1LG6 A;  4QY3 A;  4ITO A;  1IF4 A;  4QEF A;  1YDD A;  4YGN A;  3DBU A;  4ZX0 A;  1RZC A;  3T85 A;  1I8Z A;  1MOO A;  2X7S A;  3MHL A;  2NNO A;  3U3A X;  2FNM A;  4QK1 A;  1CAL A;  3OKU A;  5JDV B;  7CA2 A;  5FLT A;  4RN4 A;  4QJO A;  4HT2 A;  1G45 A;  1URT A;  1CNI A;  2CA2 A;  4RH2 A;  3OYQ A;  3T5Z A;  1CAN A;  5DOG A;  3RZ0 B;  4KNN A;  3DV7 A;  5JG3 B;  3OIL A;  1XEG A;  4LU3 A;  3RZ5 A;  1CAH A;  1BZM A;  1EOU A;  2X7T A;  4YXO A;  1XPZ A;  3M1W A;  3N0N A;  5E2R A;  1TEU X;  9CA2 A;  5FNK A;  1BCD A;  1CVE A;  3KLD B;  4YYT A;  5EIJ A;  5FLQ A;  3P3J A;  1ZH9 A;  4PXX A;  1DMY A;  3EFT A;  3NI5 A;  4BF6 A;  2HOC A;  3DVC A;  1BNW A;  1DCA A;  1XQ0 A;  3C7P A;  1FLJ A;  2IT4 A;  3MZC A;  3P3H A;  4ZX1 A;  4YGK A;  1CNB A;  4XIW A;  1CAZ A;  1G4J A;  4KNM A;  3S77 B;  4HF3 A;  1HEB A;  2CBC A;  3HKQ A;  3Q31 A;  5CLU A;  1RJ5 A;  2HNC A;  4QTL A;  3TVO X;  4E3D A;  4TWM A;  3K7K A;  3UYQ A;  4M2V A;  2ABE A;  5AMG A;  4ZWZ A;  3HFP A;  2EU3 A;  3RYX B;  5EOI A;  4QIZ A;  4K0Z A;  5G01 A;  1G46 A;  1RJ6 A;  1MUA A;  4Q87 A;  5FLP A;  2NNV A;  1HCB A;  2GEH A;  4Z1J A;  5SZ2 A;  3BL0 A;  1BNQ A;  1HUH A;  1CNK A;  2FMG A;  4YWP A;  3OIM A;  4WL4 A;  5BRV A;  2QO8 A;  4CA2 A;  3MHM A;  4IDR X;  4PZH A;  4RIV A;  4MTY A;  1ZSA A;  1FSR A;  2HFW A;  3MHO A;  4RFD A;  1RAY A;  2CBE A;  3MDZ A;  5E5U A;  4XIX A;  3R16 A;  4R5A A;  1FQR A;  1DMX A;  3GZ0 A;  3MNJ A;  3ML2 A;  2NNS A;  3D8W A;  3L14 A;  4LP6 A;  2Q1B A;  4JSW A;  4PQ7 A;  3M2X A;  5JEH B;  2NWZ A;  3MNK A;  1CRA A;  4Q7V A;  3SBH A;  3RLD A;  1YO0 A;  1YDC A;  5DSR A;  2HL4 A;  4ZWY A;  5EKJ A;  3M5S A;  3DA2 A;  3DC3 A;  1LGD A;  1CIM A;  4CAC A;  5JEP B;  1G6V A;  1BN1 A;  2X7U A;  4QJ0 A;  3FW3 A;  4XE1 A;  4MDG A;  4MLT A;  3V2J A;  3S8X A;  2OSF A;  3LXE A;  4JSA A;  3CYU A;  1KWR A;  4FL7 A;  1CIN A;  1UGG A;  3N3J A;  5BNL A;  1CNJ A;  2CBD A;  2FNK A;  4L5U A;  1G54 A;  2NN7 A;  1JV0 A;  1CNG A;  1AVN A;  4Z0Q A;  3RGE A;  3ZP9 A;  3DD0 A;  5FNL A;  2EZ7 A;  3P4V A;  3MNI A;  1AM6 A;  3VBD A;  1KOP A;  1CVC A;  3T5U A;  5C8I A;  5JQT A;  1I9M A;  2OSM A;  3T84 A;  3QYK A;  5FL5 A;  1OKM A;  3KS3 A;  1HEC A;  1CCU A;  5G0C A;  4WR7 A;  3F4X A;  4COQ A;  8CA2 A;  1BNT A;  4HEZ A;  4MLX A;  1CNW A;  4FIK A;  4G7A A;  4KNJ A;  3IBN A;  4KP5 A;  3S74 B;  3V3G B;  4YGF A;  1BN4 A;  3RYV B;  5DSI A;  5G03 A;  1TEQ X;  2W2J A;  3P58 A;  5EHE A;  4PYX A;  4Q81 A;  4PYY A;  1CAO A;  2VVA X;  3KIG A;  3FFP X;  5EZT X;  1CAY A;  4CNV A;  3PYK A;  3RZ1 B;  3V3H B;  5EH8 A;  3P44 A;  2WD2 A;  3RZ7 A;  4YGL A;  3R17 B;  3D0N A;  5FL4 A;  3S75 B;  4E9O X;  1HED A;  3T82 A;  6CA2 A;  1IF9 A;  3M96 A;  1Z93 A;  2VVB X;  1CAJ A;  4MDM A;  3D92 A;  4QK2 A;  4QK3 A;  4DZ7 A;  4FU5 A;  5DSQ A;  1G48 A;  5CAC A;  4JS6 A;  4QSI A;  2NNG A;  3DD8 A;  4WUQ A;  5EKH A;  2ILI A;  4K13 A;  3RYJ B;  4Q9Y A;  2EU2 A;  2POW A;  4MDL A;  4YXI A;  1G4O A;  3IBI A;  2F14 A;  4CQ0 A;  3MNH A;  5E2S A;  4E49 A;  5JQ0 A;  1FQL A;  5E5R A;  4ZWI A;  4YGJ A;  3DAZ A;  3NJ9 A;  3V3F A;  5DSP A;  1CA3 A;  1V9E A;  3M5T A;  4Q7W A;  3JXG A;  1FQN A;  5DRS A;  2Q1Q A;  3KWA A;  3M3X A;  2POV A;  4XZ5 A;  5DOH A;  4M2W A;  5EH7 A;  4QSA A;  1BV3 A;  3S72 B;  1CNY A;  1Y7W A;  5E2N A;  1FR4 A;  3HKT A;  1JD0 A;  4RIU A;  1CVF A;  4KV0 A;  3B4F A;  3V5G A;  3M2Y A;  3F7U A;  4Q99 A;  12CA A;  4IWZ A;  1UGD A;  1TG9 A;  4Q83 A;  5JGS B;  3OYS A;  1CNX A;  1RZE A;  5HPJ A;  1J9W A;  1H9Q A;  4LHI A;  3DVB A;  1ZNC A;  3N2P A;  5DSM A;  3MNA A;  5SZ3 A;  4Q78 A;  2H15 A;  5FL6 A;  5L6K A;  4Q8Y A;  2GD8 A;  3M04 A;  3P5A A;  4CNX A;  3FE4 A;  5CJF A;  1AZM A;  3B1B A;  3M2N A;  4ITP A;  1I91 A;  1TB0 X;  3OIK A;  1TG3 A;  4HBA A;  3RJ7 A;  3V3J A;  4E3G A;  4FRC A;  5AMD A;  3PJJ A;  2WD3 A;  1I9O A;  3JXH C;  3KOI A;  5SZ6 A;  1I9P A;  3M5E A;  3S97 A;  4BF1 A;  4N16 A;  1IF5 A;  1HEA A;  3PO6 A;  1TH9 A;  5JEG B;  1CAI A;  4Q8Z A;  5G0B A;  5JGT B;  2HKK A;  3W6H A;  5E2M A;  3JXF A;  3DCC A;  5LMD A;  1HVA A;  1T9N A;  4Q7P A;  5J8Z A;  1KOQ A;  3RYZ A;  4L5W A;  1HCA A;  1F2W A;  1CAM A;  5DVX A;  5SZ7 A;  3ML5 A;  1UGE A;  1UGC A;  3M14 A;  1UGA A;  1ZE8 A;  4YXU A;  3U7C A;  1ZGF A;  2FOY A;  2FOV A;  3M2Z A;  4Q6D A;  4HU1 A;  4BCW A;  3HKU A;  1RZB A;  1CAK A;  5FLO A;  1I9N A;  5DSK A;  4YX4 A;  1CVD A;  1H9N A;  4ZWX A;  3RZ8 A;  4Q07 A;  4DZ9 A;  1A42 A;  4RFC A;  4Q0L A;  1IF6 A;  1G3Z A;  4Q8X A;  1LZV A;  4Q7S A;  3U45 X;  1CCS A;  1FR7 A;  4Y0J A;  5CA2 A;  4TWL A;  1ZSB A;  3DCW A;  3S9T A;  5FDC A;  5FNH A;  1OQ5 A;  3KKX A;  1H4N A;  4Z1N A;  4Q90 A;  5BRW A;  1G52 A;  4KP8 A;  1G1D A;  3KNE A;  2NWY A;  4HT0 A;  4Q06 A;  5FNM A;  2NXT A;  4JSS A;  5L3O A;  1OKN A;  4K1Q A;  1BNU A;  1HUG A;  1BIC A;  2FW4 A;  3MWO A;  3IGP A;  3S78 B;  5FLS A;  3RG3 A;  4G0C A;  3N4B A;  1LUG A;  4CNR A;  3DVD A;  3SAX A;  4QJM A;  2NWO A;  5EH5 A;  1TE3 X;  1CNC A;  1CZM A;  2CAB A;  1CVA A;  1G0E A;  1UGB A;  5DSJ A;  1ZSC A;  3HLJ A;  3MNU A;  4KNI A;  5FDI A;  4N0X B;  4Q49 A;  1YO1 A;  3V2M A;  1BN3 A;  1IF7 A;  4JSZ A;  2H4N A;  1FQM A; 
#chains in the Genus database with same CATH homology
 5DSO A;  3CA2 A;  4RUZ A;  4HEW A;  3HS4 A;  1KEQ A;  4MO8 A;  1YO2 A;  2CBB A;  4KUW A;  3TVN X;  1ZFK A;  1RZA A;  1THK A;  4QJW A;  4RUX A;  1I9L A;  3RG4 A;  3V7X A;  2FOS A;  5EHV A;  4L5V A;  1Z9Y A;  5SZ5 A;  5A25 A;  4WW8 A;  3M67 A;  1G53 A;  4KAP A;  5SZ1 A;  3OKV A;  3F7B A;  4KUV A;  3DCS A;  4Q08 A;  1CCT A;  5FNG A;  4Z1E A;  3P5L A;  3S73 B;  4E5Q A;  4QSJ A;  1TBT X;  2AW1 A;  4YVY A;  5E2K A;  5IPZ A;  2FMZ A;  3M1K A;  2AX2 A;  5SZ0 A;  1V9I C;  1CA2 A;  1YDB A;  4R5B A;  3IBL A;  2ZNC A;  3P55 A;  4R59 A;  1I90 A;  3BET A;  3CZV A;  4WW6 A;  1RZD A;  3KON A;  3OY0 A;  1CNH A;  2FOU A;  4Z1K A;  2NWP A;  2NXS A;  3M40 A;  3U47 A;  1JCZ A;  5E28 A;  3HKN A;  3EFI A;  1ZGE A;  1TTM A;  4FPT A;  4Q6E A;  3SBI A;  4X5S A;  4CNW A;  2Q38 A;  4UOV A;  5SZ4 A;  2WEH A;  3RYY A;  4E4A A;  3MMF A;  2FNN A;  2O4Z A;  3M98 A;  1CIL A;  4WUP A;  5JES B;  1BNV A;  2WEG A;  3ZNC A;  5BRU A;  5FLR A;  3UYN A;  2NXR A;  3MYQ A;  1ZFQ A;  4RUY A;  3M1J A;  4FVO A;  3V3I B;  5JG5 B;  1CVH A;  3F8E A;  3TMJ A;  3S71 B;  4ETQ C;  1YDA A;  4ZAO A;  5AML A;  3MHC A;  4GL1 X;  4Q09 A;  3IBU A;  3MHI A;  3KOK A;  1G0F A;  4XFW A;  1UGF A;  3BL1 A;  1RAZ A;  1CVB A;  1FSN A;  3W6I A;  1OKL A;  5DSN A;  3NB5 A;  4HEY A;  3IAI A;  5EKM A;  2FOQ A;  3IEO A;  1DCB A;  2CBA A;  1BNM A;  4K0T A;  4FVN A;  3M1Q A;  5EHW A;  1KWQ A;  5FNI A;  1BNN A;  2NN1 A;  3K2F A;  4QJP A;  1Z97 A;  1LG5 A;  1XEV A;  4QIY A;  4QSB A;  3CAJ A;  4YHA A;  2HD6 A;  3K34 A;  4KUY A;  2POU A;  5BYI A;  4K0S A;  5A6H A;  2WEO A;  1I9Q A;  1IF8 A;  1FSQ A;  4M2R A;  2WEJ A;  3SAP A;  2QOA A;  5FNJ A;  3T83 A;  4C3T A;  4ILX A;  2NMX A;  3S76 A;  1CRM A;  3D9Z A;  3DC9 A;  3D93 A;  4QJX A;  4M2U A;  4E3F A;  2QP6 A;  4E3H A;  5DSL A;  1LG6 A;  4QY3 A;  4ITO A;  1IF4 A;  4QEF A;  1YDD A;  4YGN A;  3DBU A;  4ZX0 A;  1RZC A;  3T85 A;  1I8Z A;  1MOO A;  2X7S A;  3MHL A;  2NNO A;  3U3A X;  2FNM A;  4QK1 A;  1CAL A;  3OKU A;  5JDV B;  7CA2 A;  5FLT A;  4RN4 A;  4QJO A;  4HT2 A;  1G45 A;  1URT A;  1CNI A;  2CA2 A;  4RH2 A;  3OYQ A;  3T5Z A;  1CAN A;  5DOG A;  3RZ0 B;  4KNN A;  3DV7 A;  5JG3 B;  3OIL A;  1XEG A;  4LU3 A;  3RZ5 A;  1CAH A;  1BZM A;  1EOU A;  2X7T A;  4YXO A;  1XPZ A;  3M1W A;  3N0N A;  5E2R A;  1TEU X;  9CA2 A;  5FNK A;  1BCD A;  1CVE A;  3KLD B;  4YYT A;  5EIJ A;  5FLQ A;  3P3J A;  1ZH9 A;  4PXX A;  1DMY A;  3EFT A;  3NI5 A;  4BF6 A;  2HOC A;  3DVC A;  1BNW A;  1DCA A;  1XQ0 A;  3C7P A;  1FLJ A;  2IT4 A;  3MZC A;  3P3H A;  4ZX1 A;  4YGK A;  1CNB A;  4XIW A;  1CAZ A;  1G4J A;  4KNM A;  3S77 B;  4HF3 A;  1HEB A;  2CBC A;  3HKQ A;  3Q31 A;  5CLU A;  1RJ5 A;  2HNC A;  4QTL A;  3TVO X;  4E3D A;  4TWM A;  3K7K A;  3UYQ A;  4M2V A;  2ABE A;  5AMG A;  4ZWZ A;  3HFP A;  2EU3 A;  3RYX B;  5EOI A;  4QIZ A;  4K0Z A;  5G01 A;  1G46 A;  1RJ6 A;  1MUA A;  4Q87 A;  5FLP A;  2NNV A;  1HCB A;  2GEH A;  4Z1J A;  5SZ2 A;  3BL0 A;  1BNQ A;  1HUH A;  1CNK A;  2FMG A;  4YWP A;  3OIM A;  4WL4 A;  5BRV A;  2QO8 A;  4CA2 A;  3MHM A;  4IDR X;  4PZH A;  4RIV A;  4MTY A;  1ZSA A;  1FSR A;  2HFW A;  3MHO A;  4RFD A;  1RAY A;  2CBE A;  3MDZ A;  5E5U A;  4XIX A;  3R16 A;  4R5A A;  1FQR A;  1DMX A;  3GZ0 A;  3MNJ A;  3ML2 A;  2NNS A;  3D8W A;  3L14 A;  4LP6 A;  2Q1B A;  4JSW A;  4PQ7 A;  3M2X A;  5JEH B;  2NWZ A;  3MNK A;  1CRA A;  4Q7V A;  3SBH A;  3RLD A;  1YO0 A;  1YDC A;  5DSR A;  2HL4 A;  4ZWY A;  5EKJ A;  3M5S A;  3DA2 A;  3DC3 A;  1LGD A;  1CIM A;  4CAC A;  5JEP B;  1G6V A;  1BN1 A;  2X7U A;  4QJ0 A;  3FW3 A;  4XE1 A;  4MDG A;  4MLT A;  3V2J A;  3S8X A;  2OSF A;  3LXE A;  4JSA A;  3CYU A;  1KWR A;  4FL7 A;  1CIN A;  1UGG A;  3N3J A;  5BNL A;  1CNJ A;  2CBD A;  2FNK A;  4L5U A;  1G54 A;  2NN7 A;  1JV0 A;  1CNG A;  1AVN A;  4Z0Q A;  3RGE A;  3ZP9 A;  3DD0 A;  5FNL A;  2EZ7 A;  3P4V A;  3MNI A;  1AM6 A;  3VBD A;  1KOP A;  1CVC A;  3T5U A;  5C8I A;  5JQT A;  1I9M A;  2OSM A;  3T84 A;  3QYK A;  5FL5 A;  1OKM A;  3KS3 A;  1HEC A;  1CCU A;  5G0C A;  4WR7 A;  3F4X A;  4COQ A;  8CA2 A;  1BNT A;  4HEZ A;  4MLX A;  1CNW A;  4FIK A;  4G7A A;  4KNJ A;  3IBN A;  4KP5 A;  3S74 B;  3V3G B;  4YGF A;  1BN4 A;  3RYV B;  5DSI A;  5G03 A;  1TEQ X;  2W2J A;  3P58 A;  5EHE A;  4PYX A;  4Q81 A;  4PYY A;  1CAO A;  2VVA X;  3KIG A;  3FFP X;  5EZT X;  1CAY A;  4CNV A;  3PYK A;  3RZ1 B;  3V3H B;  5EH8 A;  3P44 A;  2WD2 A;  3RZ7 A;  4YGL A;  3R17 B;  3D0N A;  5FL4 A;  3S75 B;  4E9O X;  1HED A;  3T82 A;  6CA2 A;  1IF9 A;  3M96 A;  1Z93 A;  2VVB X;  1CAJ A;  4MDM A;  3D92 A;  4QK2 A;  4QK3 A;  4DZ7 A;  4FU5 A;  5DSQ A;  1G48 A;  5CAC A;  4JS6 A;  4QSI A;  2NNG A;  3DD8 A;  4WUQ A;  5EKH A;  2ILI A;  4K13 A;  3RYJ B;  4Q9Y A;  2EU2 A;  2POW A;  4MDL A;  4YXI A;  1G4O A;  3IBI A;  2F14 A;  4CQ0 A;  3MNH A;  5E2S A;  4E49 A;  5JQ0 A;  1FQL A;  5E5R A;  4ZWI A;  4YGJ A;  3DAZ A;  3NJ9 A;  3V3F A;  5DSP A;  1CA3 A;  1V9E A;  3M5T A;  4Q7W A;  3JXG A;  1FQN A;  5DRS A;  2Q1Q A;  3KWA A;  3M3X A;  2POV A;  4XZ5 A;  5DOH A;  4M2W A;  5EH7 A;  4QSA A;  1BV3 A;  3S72 B;  1CNY A;  1Y7W A;  5E2N A;  1FR4 A;  3HKT A;  1JD0 A;  4RIU A;  1CVF A;  4KV0 A;  3B4F A;  3V5G A;  3M2Y A;  3F7U A;  4Q99 A;  12CA A;  4IWZ A;  1UGD A;  1TG9 A;  4Q83 A;  5JGS B;  3OYS A;  1CNX A;  1RZE A;  5HPJ A;  1J9W A;  1H9Q A;  4LHI A;  3DVB A;  1ZNC A;  3N2P A;  5DSM A;  3MNA A;  5SZ3 A;  4Q78 A;  2H15 A;  5FL6 A;  5L6K A;  4Q8Y A;  2GD8 A;  3M04 A;  3P5A A;  4CNX A;  3FE4 A;  5CJF A;  1AZM A;  3B1B A;  3M2N A;  4ITP A;  1I91 A;  1TB0 X;  3OIK A;  1TG3 A;  4HBA A;  3RJ7 A;  3V3J A;  4E3G A;  4FRC A;  5AMD A;  3PJJ A;  2WD3 A;  1I9O A;  3JXH C;  3KOI A;  5SZ6 A;  1I9P A;  3M5E A;  3S97 A;  4BF1 A;  4N16 A;  1IF5 A;  1HEA A;  3PO6 A;  1TH9 A;  5JEG B;  1CAI A;  4Q8Z A;  5G0B A;  5JGT B;  2HKK A;  3W6H A;  5E2M A;  3JXF A;  3DCC A;  5LMD A;  1HVA A;  1T9N A;  4Q7P A;  5J8Z A;  1KOQ A;  3RYZ A;  4L5W A;  1HCA A;  1F2W A;  1CAM A;  5DVX A;  5SZ7 A;  3ML5 A;  1UGE A;  1UGC A;  3M14 A;  1UGA A;  1ZE8 A;  4YXU A;  3U7C A;  1ZGF A;  2FOY A;  2FOV A;  3M2Z A;  4Q6D A;  4HU1 A;  4BCW A;  3HKU A;  1RZB A;  1CAK A;  5FLO A;  1I9N A;  5DSK A;  4YX4 A;  1CVD A;  1H9N A;  4ZWX A;  3RZ8 A;  4Q07 A;  4DZ9 A;  1A42 A;  4RFC A;  4Q0L A;  1IF6 A;  1G3Z A;  4Q8X A;  1LZV A;  4Q7S A;  3U45 X;  1CCS A;  1FR7 A;  4Y0J A;  5CA2 A;  4TWL A;  1ZSB A;  3DCW A;  3S9T A;  5FDC A;  5FNH A;  1OQ5 A;  3KKX A;  1H4N A;  4Z1N A;  4Q90 A;  5BRW A;  1G52 A;  4KP8 A;  1G1D A;  3KNE A;  2NWY A;  4HT0 A;  4Q06 A;  5FNM A;  2NXT A;  4JSS A;  5L3O A;  1OKN A;  4K1Q A;  1BNU A;  1HUG A;  1BIC A;  2FW4 A;  3MWO A;  3IGP A;  3S78 B;  5FLS A;  3RG3 A;  4G0C A;  3N4B A;  1LUG A;  4CNR A;  3DVD A;  3SAX A;  4QJM A;  2NWO A;  5EH5 A;  1TE3 X;  1CNC A;  1CZM A;  2CAB A;  1CVA A;  1G0E A;  1UGB A;  5DSJ A;  1ZSC A;  3HLJ A;  3MNU A;  4KNI A;  5FDI A;  4N0X B;  4Q49 A;  1YO1 A;  3V2M A;  1BN3 A;  1IF7 A;  4JSZ A;  2H4N A;  1FQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...