2FNKA

Activation of human carbonic anhydrase ii by exogenous proton donors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGWAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Location of binding sites in small molecule rescue of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2fnkA00
4JSZA 4ZX0A 4YXOA 1CNWA 5G0BA 3HKQA 3T83A 3KS3A 3MNUA 4HT2A 3V2JA 3IAIA 1BN3A 3S74B 4JSWA 3P58A 3U3AX 4JSSA 4CNVA 1V9IC 1JV0A 2NXSA 1RZBA 3FFPX 3M98A 5JGTB 1CVAA 5DSMA 5SZ0A 3MHLA 5FNLA 4QSJA 1G53A 3OIMA 1CNBA 3W6IA 4UOVA 3P55A 1YO0A 3RYZA 4YXIA 2NWZA 1UGFA 3QYKA 4KAPA 1BNWA 1CNGA 3VBDA 4MTYA 2CBCA 3R17B 1HVAA 1BN1A 2NXRA 5BRUA 4M2RA 2HL4A 3SAXA 3M1WA 1XEVA 4K13A 1FR4A 4WW6A 4RUYA 4E5QA 4N16A 5EIJA 1ZE8A 5SZ1A 1YDAA 3IEOA 6CA2A 3M5SA 4QIYA 1UGCA 3KKXA 3KNEA 2ABEA 3DA2A 1HUHA 1ZFKA 3M2ZA 2W2JA 3D92A 3V7XA 1CANA 1OKMA 1FQRA 4KNJA 4GL1X 1CRMA 3DV7A 4Q7SA 4G7AA 4RFDA 1CNYA 4YHAA 5L6KA 3DAZA 4DZ7A 3P5AA 5JG5B 5L3OA 4DZ9A 3PO6A 5CA2A 2CA2A 3D0NA 4KUVA 5C8IA 1HCBA 5AMGA 5EZTX 3MHMA 4E3FA 1G46A 5EOIA 3IBNA 4YVYA 4Q49A 1BCDA 3IBIA 3M40A 1I91A 5G0CA 3KOIA 4E4AA 3F4XA 4FPTA 4Q7VA 4YGNA 1BNTA 1HCAA 4R5AA 4PQ7A 3M2YA 1YO2A 2FOUA 4RH2A 4CNRA 1ZSCA 4Q7WA 5JEHB 4ILXA 3DVDA 3OKVA 4RIUA 8CA2A 4QK3A 3DD8A 4LU3A 1LUGA 3ML2A 2WEHA 2WEOA 1EOUA 1I9PA 3OILA 3P3HA 4FVOA 1KEQA 4YX4A 4YGKA 2QO8A 4QSBA 1G0EA 4ETQC 3MMFA 4BF1A 3M3XA 3CZVA 4WL4A 3HS4A 4K0SA 4K0TA 1FQMA 2NWPA 3V3JA 1BZMA 2X7SA 2POVA 3RJ7A 5DSQA 5E28A 3MNIA 3RG4A 3K34A 4E3HA 1TG3A 4Q7PA 4QSIA 4BF6A 3ZP9A 3NB5A 3T85A 5CACA 1I90A 1RJ6A 3KOKA 4Q99A 4ZX1A 2VVBX 1YDBA 1CVFA 1BNVA 2HNCA 3RZ1B 3B1BA 4Z0QA 1IF8A 3F7UA 1CAMA 1CAOA 5G01A 1KWQA 4Q6DA 4KNIA 3KWAA 1I9MA 5FL5A 4CA2A 1H9QA 1RZDA 3M5TA 2FW4A 1Z93A 4Q0LA 2FOVA 4XIWA 4XZ5A 5FLOA 3M5EA 3N0NA 5LMDA 9CA2A 3BL1A 2F14A 4MDGA 3MHOA 1DMXA 1YDDA 2NN1A 1UGAA 3UYNA 5FNMA 3U45X 4XFWA 5DRSA 4Z1EA 4QJXA 4XIXA 5FNIA 1CVEA 1OKNA 1T9NA 5AMDA 1IF5A 1G45A 5FNGA 2NNGA 5FDCA 1CNIA 2CBBA 3OY0A 5SZ7A 1JD0A 3OYSA 4PXXA 3ML5A 2Q38A 4QJ0A 2NWYA 4E49A 1BNNA 2HD6A 1IF9A 4MO8A 5DSKA 2WEJA 4E3DA 4Q06A 4Q81A 2QOAA 1FQLA 5EHVA 3IBUA 1G6VA 1CAKA 5EKMA 2CBDA 3TVNX 4QJMA 4TWMA 1I9OA 3B4FA 3V3GB 1CIMA 3C7PA 1LGDA 3Q31A 2FOSA 1I9LA 4COQA 2FOYA 1BNMA 5CLUA 3NJ9A 2CBAA 1YO1A 4E9OX 3U7CA 2NNOA 3MHIA 4ZWIA 3W6HA 3K2FA 1RJ5A 1XPZA 1ZH9A 3DD0A 3KONA 3MWOA 4KNNA 4WUQA 2FNKA 2ILIA 4YWPA 1OQ5A 1ZGFA 4N0XB 3JXGA 4FU5A 4ITOA 5AMLA 1LG6A 1G3ZA 3MZCA 4YGLA 1CZMA 4Q87A 5E2KA 3MHCA 3DVCA 5E2RA 4R59A 3D9ZA 1FR7A 5FL4A 1CCSA 4FVNA 4HEZA 2FMZA 3RYJB 3RYXB 3DVBA 3UYQA 5JQTA 3HLJA 3IBLA 3PYKA 5SZ4A 5A25A 3S9TA 1HEDA 5FNJA 1THKA 3MNHA 1CNXA 3BETA 1H4NA 3S78B 2AW1A 4TWLA 3R16A 5SZ2A 5FLSA 4L5WA 1MUAA 1BV3A 4G0CA 5DVXA 3RGEA 3V3IB 4LP6A 3CYUA 3P5LA 4HBAA 1UGDA 4FRCA 4QK2A 5E2NA 2VVAX 2WD3A 5FLRA 4IWZA 5E2MA 2POUA 3D8WA 3M1KA 1V9EA 1CVHA 4HEWA 3T84A 1CNCA 3IGPA 4RUXA 4Z1KA 3S72B 5HPJA 1G0FA 4K0ZA 5FNHA 1OKLA 3OYQA 2Q1BA 4QIZA 1TB0X 1CNHA 1G4OA 1BN4A 1UGBA 3KIGA 2FMGA 1CAIA 3MNAA 2EU2A 3EFIA 3N4BA 4KUWA 4QK1A 2NNSA 2H15A 1A42A 4KP5A 3M96A 1ZGEA 3M14A 5DSIA 3DCWA 5EHEA 1URTA 5CJFA 1Y7WA 4Q83A 2POWA 3GZ0A 4QTLA 2Q1QA 2CABA 5DSOA 1G52A 3HKNA 3DC9A 5JEGB 1FQNA 3BL0A 4QJOA 3T5UA 2X7UA 1TTMA 3SAPA 1HUGA 1YDCA 5SZ3A 5FDIA 3D93A 1TE3X 5SZ5A 2OSMA 2FNNA 5FNKA 5J8ZA 3V3HB 1HECA 2HFWA 3S71B 5EH5A 4QSAA 3ZNCA 3PJJA 5E5UA 1AVNA 3EFTA 4HU1A 3S73B 1KOPA 4Q8XA 1BICA 4YXUA 2NNVA 3M04A 4FL7A 5JDVB 5DSRA 4CNXA 3MYQA 1UGGA 1CINA 3RZ8A 5E5RA 4BCWA 1CAJA 2WD2A 4Q09A 2FOQA 5EH7A 4ZAOA 3T5ZA 3DCSA 1G48A 5DSPA 5FL6A 1MOOA 2O4ZA 1IF6A 5FLTA 3RZ7A 4HEYA 4WR7A 3P3JA 3FE4A 1KWRA 4JS6A 3S77B 3V2MA 5EH8A 1JCZA 2WEGA 3RG3A 4L5VA 3OIKA 3V5GA 2AX2A 4HF3A 3M67A 4WUPA 4K1QA 2X7TA 2NXTA 1ZSAA 4QEFA 1FSNA 5DSNA 1HEAA 4MLTA 4Q90A 5DSLA 3S75B 1CA2A 3MNKA 1RAZA 3K7KA 3T82A 1CCUA 1ZNCA 2IT4A 4PYYA 12CAA 4RN4A 1DMYA 4YGJA 1G54A 3RYVB 3SBIA 2QP6A 4YGFA 1KOQA 1DCBA 4YYTA 1DCAA 5JG3B 2EZ7A 1CVDA 4C3TA 4Q6EA 1TEUX 3M2XA 1FLJA 1RAYA 3HFPA 4X5SA 1TEQX 5DSJA 2H4NA 1H9NA 2NWOA 3DC3A 4ZWXA 5DOHA 4PYXA 4QY3A 4E3GA 1J9WA 3HKUA 4MDMA 4LHIA 5E2SA 3P44A 3RZ5A 3M1JA 4ITPA 4FIKA 1CNJA 5G03A 1TG9A 3L14A 1G4JA 4QJPA 4M2WA 3CA2A 5EKHA 5BRVA 4CACA 5EHWA 5BNLA 1AZMA 5EKJA 3S97A 1BNUA 3TMJA 4KUYA 1CA3A 4R5BA 1IF4A 3TVOX 5JEPB 3RLDA 1I9NA 5JGSB 4Q07A 4PZHA 4Q9YA 5DOGA 5IPZA 1CCTA 1LZVA 2HKKA 3N3JA 3OKUA 1UGEA 1TBTX 4Z1NA 1F2WA 3FW3A 4L5UA 3M1QA 1FSRA 3DBUA 3V3FA 4CNWA 3F7BA 1CVBA 1G1DA 3LXEA 3RYYA 1ZSBA 3SBHA 4Q8ZA 3N2PA 4MLXA 1IF7A 2NMXA 2CBEA 1Z97A 4HT0A 4RFCA 1BNQA 5BRWA 4XE1A 5A6HA 1CAHA 2FNMA 3JXFA 1I8ZA 5FLQA 5JQ0A 1HEBA 3DCCA 1LG5A 4JSAA 1XEGA 1RZEA 3NI5A 1CAYA 4KNMA 5BYIA 4Q8YA 2ZNCA 7CA2A 1CRAA 2GD8A 4Y0JA 1TH9A 3JXHC 4QJWA 4Z1JA 3RZ0B 3S76A 1Z9YA 3MNJA 1CAZA 1CVCA 3S8XA 2OSFA 4KV0A 4RIVA 4MDLA 4M2UA 4IDRX 5SZ6A 5JESB 4Q08A 1AM6A 3CAJA 3U47A 3P4VA 5FLPA 2NN7A 4CQ0A 1I9QA 3M2NA 3HKTA 1CILA 1CNKA 1ZFQA 2GEHA 4ZWZA 4M2VA 4WW8A 4KP8A 2HOCA 1CALA 1RZAA 4Q78A 1XQ0A 1FSQA 4ZWYA 2EU3A 3KLDB 4RUZA 3F8EA 3MDZA 1RZCA
chains in the Genus database with same CATH superfamily
4JSZA 4ZX0A 4YXOA 1CNWA 5G0BA 3HKQA 3T83A 3KS3A 3MNUA 4HT2A 3V2JA 3IAIA 1BN3A 3S74B 4JSWA 3P58A 3U3AX 4JSSA 4CNVA 1V9IC 1JV0A 2NXSA 1RZBA 3FFPX 3M98A 5JGTB 1CVAA 5DSMA 5SZ0A 3MHLA 5FNLA 4QSJA 1G53A 3OIMA 1CNBA 3W6IA 4UOVA 3P55A 1YO0A 3RYZA 4YXIA 2NWZA 1UGFA 3QYKA 4KAPA 1BNWA 1CNGA 3VBDA 4MTYA 2CBCA 3R17B 1HVAA 1BN1A 2NXRA 5BRUA 4M2RA 2HL4A 3SAXA 3M1WA 1XEVA 4K13A 1FR4A 4WW6A 4RUYA 4E5QA 4N16A 5EIJA 1ZE8A 5SZ1A 1YDAA 3IEOA 6CA2A 3M5SA 4QIYA 1UGCA 3KKXA 3KNEA 2ABEA 3DA2A 1HUHA 1ZFKA 3M2ZA 2W2JA 3D92A 3V7XA 1CANA 1OKMA 1FQRA 4KNJA 4GL1X 1CRMA 3DV7A 4Q7SA 4G7AA 4RFDA 1CNYA 4YHAA 5L6KA 3DAZA 4DZ7A 3P5AA 5JG5B 5L3OA 4DZ9A 3PO6A 5CA2A 2CA2A 3D0NA 4KUVA 5C8IA 1HCBA 5AMGA 5EZTX 3MHMA 4E3FA 1G46A 5EOIA 3IBNA 4YVYA 4Q49A 1BCDA 3IBIA 3M40A 1I91A 5G0CA 3KOIA 4E4AA 3F4XA 4FPTA 4Q7VA 4YGNA 1BNTA 1HCAA 4R5AA 4PQ7A 3M2YA 1YO2A 2FOUA 4RH2A 4CNRA 1ZSCA 4Q7WA 5JEHB 4ILXA 3DVDA 3OKVA 4RIUA 8CA2A 4QK3A 3DD8A 4LU3A 1LUGA 3ML2A 2WEHA 2WEOA 1EOUA 1I9PA 3OILA 3P3HA 4FVOA 1KEQA 4YX4A 4YGKA 2QO8A 4QSBA 1G0EA 4ETQC 3MMFA 4BF1A 3M3XA 3CZVA 4WL4A 3HS4A 4K0SA 4K0TA 1FQMA 2NWPA 3V3JA 1BZMA 2X7SA 2POVA 3RJ7A 5DSQA 5E28A 3MNIA 3RG4A 3K34A 4E3HA 1TG3A 4Q7PA 4QSIA 4BF6A 3ZP9A 3NB5A 3T85A 5CACA 1I90A 1RJ6A 3KOKA 4Q99A 4ZX1A 2VVBX 1YDBA 1CVFA 1BNVA 2HNCA 3RZ1B 3B1BA 4Z0QA 1IF8A 3F7UA 1CAMA 1CAOA 5G01A 1KWQA 4Q6DA 4KNIA 3KWAA 1I9MA 5FL5A 4CA2A 1H9QA 1RZDA 3M5TA 2FW4A 1Z93A 4Q0LA 2FOVA 4XIWA 4XZ5A 5FLOA 3M5EA 3N0NA 5LMDA 9CA2A 3BL1A 2F14A 4MDGA 3MHOA 1DMXA 1YDDA 2NN1A 1UGAA 3UYNA 5FNMA 3U45X 4XFWA 5DRSA 4Z1EA 4QJXA 4XIXA 5FNIA 1CVEA 1OKNA 1T9NA 5AMDA 1IF5A 1G45A 5FNGA 2NNGA 5FDCA 1CNIA 2CBBA 3OY0A 5SZ7A 1JD0A 3OYSA 4PXXA 3ML5A 2Q38A 4QJ0A 2NWYA 4E49A 1BNNA 2HD6A 1IF9A 4MO8A 5DSKA 2WEJA 4E3DA 4Q06A 4Q81A 2QOAA 1FQLA 5EHVA 3IBUA 1G6VA 1CAKA 5EKMA 2CBDA 3TVNX 4QJMA 4TWMA 1I9OA 3B4FA 3V3GB 1CIMA 3C7PA 1LGDA 3Q31A 2FOSA 1I9LA 4COQA 2FOYA 1BNMA 5CLUA 3NJ9A 2CBAA 1YO1A 4E9OX 3U7CA 2NNOA 3MHIA 4ZWIA 3W6HA 3K2FA 1RJ5A 1XPZA 1ZH9A 3DD0A 3KONA 3MWOA 4KNNA 4WUQA 2FNKA 2ILIA 4YWPA 1OQ5A 1ZGFA 4N0XB 3JXGA 4FU5A 4ITOA 5AMLA 1LG6A 1G3ZA 3MZCA 4YGLA 1CZMA 4Q87A 5E2KA 3MHCA 3DVCA 5E2RA 4R59A 3D9ZA 1FR7A 5FL4A 1CCSA 4FVNA 4HEZA 2FMZA 3RYJB 3RYXB 3DVBA 3UYQA 5JQTA 3HLJA 3IBLA 3PYKA 5SZ4A 5A25A 3S9TA 1HEDA 5FNJA 1THKA 3MNHA 1CNXA 3BETA 1H4NA 3S78B 2AW1A 4TWLA 3R16A 5SZ2A 5FLSA 4L5WA 1MUAA 1BV3A 4G0CA 5DVXA 3RGEA 3V3IB 4LP6A 3CYUA 3P5LA 4HBAA 1UGDA 4FRCA 4QK2A 5E2NA 2VVAX 2WD3A 5FLRA 4IWZA 5E2MA 2POUA 3D8WA 3M1KA 1V9EA 1CVHA 4HEWA 3T84A 1CNCA 3IGPA 4RUXA 4Z1KA 3S72B 5HPJA 1G0FA 4K0ZA 5FNHA 1OKLA 3OYQA 2Q1BA 4QIZA 1TB0X 1CNHA 1G4OA 1BN4A 1UGBA 3KIGA 2FMGA 1CAIA 3MNAA 2EU2A 3EFIA 3N4BA 4KUWA 4QK1A 2NNSA 2H15A 1A42A 4KP5A 3M96A 1ZGEA 3M14A 5DSIA 3DCWA 5EHEA 1URTA 5CJFA 1Y7WA 4Q83A 2POWA 3GZ0A 4QTLA 2Q1QA 2CABA 5DSOA 1G52A 3HKNA 3DC9A 5JEGB 1FQNA 3BL0A 4QJOA 3T5UA 2X7UA 1TTMA 3SAPA 1HUGA 1YDCA 5SZ3A 5FDIA 3D93A 1TE3X 5SZ5A 2OSMA 2FNNA 5FNKA 5J8ZA 3V3HB 1HECA 2HFWA 3S71B 5EH5A 4QSAA 3ZNCA 3PJJA 5E5UA 1AVNA 3EFTA 4HU1A 3S73B 1KOPA 4Q8XA 1BICA 4YXUA 2NNVA 3M04A 4FL7A 5JDVB 5DSRA 4CNXA 3MYQA 1UGGA 1CINA 3RZ8A 5E5RA 4BCWA 1CAJA 2WD2A 4Q09A 2FOQA 5EH7A 4ZAOA 3T5ZA 3DCSA 1G48A 5DSPA 5FL6A 1MOOA 2O4ZA 1IF6A 5FLTA 3RZ7A 4HEYA 4WR7A 3P3JA 3FE4A 1KWRA 4JS6A 3S77B 3V2MA 5EH8A 1JCZA 2WEGA 3RG3A 4L5VA 3OIKA 3V5GA 2AX2A 4HF3A 3M67A 4WUPA 4K1QA 2X7TA 2NXTA 1ZSAA 4QEFA 1FSNA 5DSNA 1HEAA 4MLTA 4Q90A 5DSLA 3S75B 1CA2A 3MNKA 1RAZA 3K7KA 3T82A 1CCUA 1ZNCA 2IT4A 4PYYA 12CAA 4RN4A 1DMYA 4YGJA 1G54A 3RYVB 3SBIA 2QP6A 4YGFA 1KOQA 1DCBA 4YYTA 1DCAA 5JG3B 2EZ7A 1CVDA 4C3TA 4Q6EA 1TEUX 3M2XA 1FLJA 1RAYA 3HFPA 4X5SA 1TEQX 5DSJA 2H4NA 1H9NA 2NWOA 3DC3A 4ZWXA 5DOHA 4PYXA 4QY3A 4E3GA 1J9WA 3HKUA 4MDMA 4LHIA 5E2SA 3P44A 3RZ5A 3M1JA 4ITPA 4FIKA 1CNJA 5G03A 1TG9A 3L14A 1G4JA 4QJPA 4M2WA 3CA2A 5EKHA 5BRVA 4CACA 5EHWA 5BNLA 1AZMA 5EKJA 3S97A 1BNUA 3TMJA 4KUYA 1CA3A 4R5BA 1IF4A 3TVOX 5JEPB 3RLDA 1I9NA 5JGSB 4Q07A 4PZHA 4Q9YA 5DOGA 5IPZA 1CCTA 1LZVA 2HKKA 3N3JA 3OKUA 1UGEA 1TBTX 4Z1NA 1F2WA 3FW3A 4L5UA 3M1QA 1FSRA 3DBUA 3V3FA 4CNWA 3F7BA 1CVBA 1G1DA 3LXEA 3RYYA 1ZSBA 3SBHA 4Q8ZA 3N2PA 4MLXA 1IF7A 2NMXA 2CBEA 1Z97A 4HT0A 4RFCA 1BNQA 5BRWA 4XE1A 5A6HA 1CAHA 2FNMA 3JXFA 1I8ZA 5FLQA 5JQ0A 1HEBA 3DCCA 1LG5A 4JSAA 1XEGA 1RZEA 3NI5A 1CAYA 4KNMA 5BYIA 4Q8YA 2ZNCA 7CA2A 1CRAA 2GD8A 4Y0JA 1TH9A 3JXHC 4QJWA 4Z1JA 3RZ0B 3S76A 1Z9YA 3MNJA 1CAZA 1CVCA 3S8XA 2OSFA 4KV0A 4RIVA 4MDLA 4M2UA 4IDRX 5SZ6A 5JESB 4Q08A 1AM6A 3CAJA 3U47A 3P4VA 5FLPA 2NN7A 4CQ0A 1I9QA 3M2NA 3HKTA 1CILA 1CNKA 1ZFQA 2GEHA 4ZWZA 4M2VA 4WW8A 4KP8A 2HOCA 1CALA 1RZAA 4Q78A 1XQ0A 1FSQA 4ZWYA 2EU3A 3KLDB 4RUZA 3F8EA 3MDZA 1RZCA
chains in the Genus database with same CATH topology
4JSZA 4ZX0A 4YXOA 1CNWA 5G0BA 3HKQA 3T83A 3KS3A 3MNUA 4HT2A 3V2JA 3IAIA 1BN3A 3S74B 4JSWA 3P58A 3U3AX 4JSSA 4CNVA 1V9IC 1JV0A 2NXSA 1RZBA 3FFPX 3M98A 5JGTB 1CVAA 5DSMA 5SZ0A 3MHLA 5FNLA 4QSJA 1G53A 3OIMA 1CNBA 3W6IA 4UOVA 3P55A 1YO0A 3RYZA 4YXIA 2NWZA 1UGFA 3QYKA 4KAPA 1BNWA 1CNGA 3VBDA 4MTYA 2CBCA 3R17B 1HVAA 1BN1A 2NXRA 5BRUA 4M2RA 2HL4A 3SAXA 3M1WA 1XEVA 4K13A 1FR4A 4WW6A 4RUYA 4E5QA 4N16A 5EIJA 1ZE8A 5SZ1A 1YDAA 3IEOA 6CA2A 3M5SA 4QIYA 1UGCA 3KKXA 3KNEA 2ABEA 3DA2A 1HUHA 1ZFKA 3M2ZA 2W2JA 3D92A 3V7XA 1CANA 1OKMA 1FQRA 4KNJA 4GL1X 1CRMA 3DV7A 4Q7SA 4G7AA 4RFDA 1CNYA 4YHAA 5L6KA 3DAZA 4DZ7A 3P5AA 5JG5B 5L3OA 4DZ9A 3PO6A 5CA2A 2CA2A 3D0NA 4KUVA 5C8IA 1HCBA 5AMGA 5EZTX 3MHMA 4E3FA 1G46A 5EOIA 3IBNA 4YVYA 4Q49A 1BCDA 3IBIA 3M40A 1I91A 5G0CA 3KOIA 4E4AA 3F4XA 4FPTA 4Q7VA 4YGNA 1BNTA 1HCAA 4R5AA 4PQ7A 3M2YA 1YO2A 2FOUA 4RH2A 4CNRA 1ZSCA 4Q7WA 5JEHB 4ILXA 3DVDA 3OKVA 4RIUA 8CA2A 4QK3A 3DD8A 4LU3A 1LUGA 3ML2A 2WEHA 2WEOA 1EOUA 1I9PA 3OILA 3P3HA 4FVOA 1KEQA 4YX4A 4YGKA 2QO8A 4QSBA 1G0EA 4ETQC 3MMFA 4BF1A 3M3XA 3CZVA 4WL4A 3HS4A 4K0SA 4K0TA 1FQMA 2NWPA 3V3JA 1BZMA 2X7SA 2POVA 3RJ7A 5DSQA 5E28A 3MNIA 3RG4A 3K34A 4E3HA 1TG3A 4Q7PA 4QSIA 4BF6A 3ZP9A 3NB5A 3T85A 5CACA 1I90A 1RJ6A 3KOKA 4Q99A 4ZX1A 2VVBX 1YDBA 1CVFA 1BNVA 2HNCA 3RZ1B 3B1BA 4Z0QA 1IF8A 3F7UA 1CAMA 1CAOA 5G01A 1KWQA 4Q6DA 4KNIA 3KWAA 1I9MA 5FL5A 4CA2A 1H9QA 1RZDA 3M5TA 2FW4A 1Z93A 4Q0LA 2FOVA 4XIWA 4XZ5A 5FLOA 3M5EA 3N0NA 5LMDA 9CA2A 3BL1A 2F14A 4MDGA 3MHOA 1DMXA 1YDDA 2NN1A 1UGAA 3UYNA 5FNMA 3U45X 4XFWA 5DRSA 4Z1EA 4QJXA 4XIXA 5FNIA 1CVEA 1OKNA 1T9NA 5AMDA 1IF5A 1G45A 5FNGA 2NNGA 5FDCA 1CNIA 2CBBA 3OY0A 5SZ7A 1JD0A 3OYSA 4PXXA 3ML5A 2Q38A 4QJ0A 2NWYA 4E49A 1BNNA 2HD6A 1IF9A 4MO8A 5DSKA 2WEJA 4E3DA 4Q06A 4Q81A 2QOAA 1FQLA 5EHVA 3IBUA 1G6VA 1CAKA 5EKMA 2CBDA 3TVNX 4QJMA 4TWMA 1I9OA 3B4FA 3V3GB 1CIMA 3C7PA 1LGDA 3Q31A 2FOSA 1I9LA 4COQA 2FOYA 1BNMA 5CLUA 3NJ9A 2CBAA 1YO1A 4E9OX 3U7CA 2NNOA 3MHIA 4ZWIA 3W6HA 3K2FA 1RJ5A 1XPZA 1ZH9A 3DD0A 3KONA 3MWOA 4KNNA 4WUQA 2FNKA 2ILIA 4YWPA 1OQ5A 1ZGFA 4N0XB 3JXGA 4FU5A 4ITOA 5AMLA 1LG6A 1G3ZA 3MZCA 4YGLA 1CZMA 4Q87A 5E2KA 3MHCA 3DVCA 5E2RA 4R59A 3D9ZA 1FR7A 5FL4A 1CCSA 4FVNA 4HEZA 2FMZA 3RYJB 3RYXB 3DVBA 3UYQA 5JQTA 3HLJA 3IBLA 3PYKA 5SZ4A 5A25A 3S9TA 1HEDA 5FNJA 1THKA 3MNHA 1CNXA 3BETA 1H4NA 3S78B 2AW1A 4TWLA 3R16A 5SZ2A 5FLSA 4L5WA 1MUAA 1BV3A 4G0CA 5DVXA 3RGEA 3V3IB 4LP6A 3CYUA 3P5LA 4HBAA 1UGDA 4FRCA 4QK2A 5E2NA 2VVAX 2WD3A 5FLRA 4IWZA 5E2MA 2POUA 3D8WA 3M1KA 1V9EA 1CVHA 4HEWA 3T84A 1CNCA 3IGPA 4RUXA 4Z1KA 3S72B 5HPJA 1G0FA 4K0ZA 5FNHA 1OKLA 3OYQA 2Q1BA 4QIZA 1TB0X 1CNHA 1G4OA 1BN4A 1UGBA 3KIGA 2FMGA 1CAIA 3MNAA 2EU2A 3EFIA 3N4BA 4KUWA 4QK1A 2NNSA 2H15A 1A42A 4KP5A 3M96A 1ZGEA 3M14A 5DSIA 3DCWA 5EHEA 1URTA 5CJFA 1Y7WA 4Q83A 2POWA 3GZ0A 4QTLA 2Q1QA 2CABA 5DSOA 1G52A 3HKNA 3DC9A 5JEGB 1FQNA 3BL0A 4QJOA 3T5UA 2X7UA 1TTMA 3SAPA 1HUGA 1YDCA 5SZ3A 5FDIA 3D93A 1TE3X 5SZ5A 2OSMA 2FNNA 5FNKA 5J8ZA 3V3HB 1HECA 2HFWA 3S71B 5EH5A 4QSAA 3ZNCA 3PJJA 5E5UA 1AVNA 3EFTA 4HU1A 3S73B 1KOPA 4Q8XA 1BICA 4YXUA 2NNVA 3M04A 4FL7A 5JDVB 5DSRA 4CNXA 3MYQA 1UGGA 1CINA 3RZ8A 5E5RA 4BCWA 1CAJA 2WD2A 4Q09A 2FOQA 5EH7A 4ZAOA 3T5ZA 3DCSA 1G48A 5DSPA 5FL6A 1MOOA 2O4ZA 1IF6A 5FLTA 3RZ7A 4HEYA 4WR7A 3P3JA 3FE4A 1KWRA 4JS6A 3S77B 3V2MA 5EH8A 1JCZA 2WEGA 3RG3A 4L5VA 3OIKA 3V5GA 2AX2A 4HF3A 3M67A 4WUPA 4K1QA 2X7TA 2NXTA 1ZSAA 4QEFA 1FSNA 5DSNA 1HEAA 4MLTA 4Q90A 5DSLA 3S75B 1CA2A 3MNKA 1RAZA 3K7KA 3T82A 1CCUA 1ZNCA 2IT4A 4PYYA 12CAA 4RN4A 1DMYA 4YGJA 1G54A 3RYVB 3SBIA 2QP6A 4YGFA 1KOQA 1DCBA 4YYTA 1DCAA 5JG3B 2EZ7A 1CVDA 4C3TA 4Q6EA 1TEUX 3M2XA 1FLJA 1RAYA 3HFPA 4X5SA 1TEQX 5DSJA 2H4NA 1H9NA 2NWOA 3DC3A 4ZWXA 5DOHA 4PYXA 4QY3A 4E3GA 1J9WA 3HKUA 4MDMA 4LHIA 5E2SA 3P44A 3RZ5A 3M1JA 4ITPA 4FIKA 1CNJA 5G03A 1TG9A 3L14A 1G4JA 4QJPA 4M2WA 3CA2A 5EKHA 5BRVA 4CACA 5EHWA 5BNLA 1AZMA 5EKJA 3S97A 1BNUA 3TMJA 4KUYA 1CA3A 4R5BA 1IF4A 3TVOX 5JEPB 3RLDA 1I9NA 5JGSB 4Q07A 4PZHA 4Q9YA 5DOGA 5IPZA 1CCTA 1LZVA 2HKKA 3N3JA 3OKUA 1UGEA 1TBTX 4Z1NA 1F2WA 3FW3A 4L5UA 3M1QA 1FSRA 3DBUA 3V3FA 4CNWA 3F7BA 1CVBA 1G1DA 3LXEA 3RYYA 1ZSBA 3SBHA 4Q8ZA 3N2PA 4MLXA 1IF7A 2NMXA 2CBEA 1Z97A 4HT0A 4RFCA 1BNQA 5BRWA 4XE1A 5A6HA 1CAHA 2FNMA 3JXFA 1I8ZA 5FLQA 5JQ0A 1HEBA 3DCCA 1LG5A 4JSAA 1XEGA 1RZEA 3NI5A 1CAYA 4KNMA 5BYIA 4Q8YA 2ZNCA 7CA2A 1CRAA 2GD8A 4Y0JA 1TH9A 3JXHC 4QJWA 4Z1JA 3RZ0B 3S76A 1Z9YA 3MNJA 1CAZA 1CVCA 3S8XA 2OSFA 4KV0A 4RIVA 4MDLA 4M2UA 4IDRX 5SZ6A 5JESB 4Q08A 1AM6A 3CAJA 3U47A 3P4VA 5FLPA 2NN7A 4CQ0A 1I9QA 3M2NA 3HKTA 1CILA 1CNKA 1ZFQA 2GEHA 4ZWZA 4M2VA 4WW8A 4KP8A 2HOCA 1CALA 1RZAA 4Q78A 1XQ0A 1FSQA 4ZWYA 2EU3A 3KLDB 4RUZA 3F8EA 3MDZA 1RZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSZ A;  4ZX0 A;  4YXO A;  1CNW A;  5G0B A;  3HKQ A;  3T83 A;  3KS3 A;  3MNU A;  4HT2 A;  3V2J A;  3IAI A;  1BN3 A;  3S74 B;  4JSW A;  3P58 A;  3U3A X;  4JSS A;  4CNV A;  1V9I C;  1JV0 A;  2NXS A;  1RZB A;  3FFP X;  3M98 A;  5JGT B;  1CVA A;  5DSM A;  5SZ0 A;  3MHL A;  5FNL A;  4QSJ A;  1G53 A;  3OIM A;  1CNB A;  3W6I A;  4UOV A;  3P55 A;  1YO0 A;  3RYZ A;  4YXI A;  2NWZ A;  1UGF A;  3QYK A;  4KAP A;  1BNW A;  1CNG A;  3VBD A;  4MTY A;  2CBC A;  3R17 B;  1HVA A;  1BN1 A;  2NXR A;  5BRU A;  4M2R A;  2HL4 A;  3SAX A;  3M1W A;  1XEV A;  4K13 A;  1FR4 A;  4WW6 A;  4RUY A;  4E5Q A;  4N16 A;  5EIJ A;  1ZE8 A;  5SZ1 A;  1YDA A;  3IEO A;  6CA2 A;  3M5S A;  4QIY A;  1UGC A;  3KKX A;  3KNE A;  2ABE A;  3DA2 A;  1HUH A;  1ZFK A;  3M2Z A;  2W2J A;  3D92 A;  3V7X A;  1CAN A;  1OKM A;  1FQR A;  4KNJ A;  4GL1 X;  1CRM A;  3DV7 A;  4Q7S A;  4G7A A;  4RFD A;  1CNY A;  4YHA A;  5L6K A;  3DAZ A;  4DZ7 A;  3P5A A;  5JG5 B;  5L3O A;  4DZ9 A;  3PO6 A;  5CA2 A;  2CA2 A;  3D0N A;  4KUV A;  5C8I A;  1HCB A;  5AMG A;  5EZT X;  3MHM A;  4E3F A;  1G46 A;  5EOI A;  3IBN A;  4YVY A;  4Q49 A;  1BCD A;  3IBI A;  3M40 A;  1I91 A;  5G0C A;  3KOI A;  4E4A A;  3F4X A;  4FPT A;  4Q7V A;  4YGN A;  1BNT A;  1HCA A;  4R5A A;  4PQ7 A;  3M2Y A;  1YO2 A;  2FOU A;  4RH2 A;  4CNR A;  1ZSC A;  4Q7W A;  5JEH B;  4ILX A;  3DVD A;  3OKV A;  4RIU A;  8CA2 A;  4QK3 A;  3DD8 A;  4LU3 A;  1LUG A;  3ML2 A;  2WEH A;  2WEO A;  1EOU A;  1I9P A;  3OIL A;  3P3H A;  4FVO A;  1KEQ A;  4YX4 A;  4YGK A;  2QO8 A;  4QSB A;  1G0E A;  4ETQ C;  3MMF A;  4BF1 A;  3M3X A;  3CZV A;  4WL4 A;  3HS4 A;  4K0S A;  4K0T A;  1FQM A;  2NWP A;  3V3J A;  1BZM A;  2X7S A;  2POV A;  3RJ7 A;  5DSQ A;  5E28 A;  3MNI A;  3RG4 A;  3K34 A;  4E3H A;  1TG3 A;  4Q7P A;  4QSI A;  4BF6 A;  3ZP9 A;  3NB5 A;  3T85 A;  5CAC A;  1I90 A;  1RJ6 A;  3KOK A;  4Q99 A;  4ZX1 A;  2VVB X;  1YDB A;  1CVF A;  1BNV A;  2HNC A;  3RZ1 B;  3B1B A;  4Z0Q A;  1IF8 A;  3F7U A;  1CAM A;  1CAO A;  5G01 A;  1KWQ A;  4Q6D A;  4KNI A;  3KWA A;  1I9M A;  5FL5 A;  4CA2 A;  1H9Q A;  1RZD A;  3M5T A;  2FW4 A;  1Z93 A;  4Q0L A;  2FOV A;  4XIW A;  4XZ5 A;  5FLO A;  3M5E A;  3N0N A;  5LMD A;  9CA2 A;  3BL1 A;  2F14 A;  4MDG A;  3MHO A;  1DMX A;  1YDD A;  2NN1 A;  1UGA A;  3UYN A;  5FNM A;  3U45 X;  4XFW A;  5DRS A;  4Z1E A;  4QJX A;  4XIX A;  5FNI A;  1CVE A;  1OKN A;  1T9N A;  5AMD A;  1IF5 A;  1G45 A;  5FNG A;  2NNG A;  5FDC A;  1CNI A;  2CBB A;  3OY0 A;  5SZ7 A;  1JD0 A;  3OYS A;  4PXX A;  3ML5 A;  2Q38 A;  4QJ0 A;  2NWY A;  4E49 A;  1BNN A;  2HD6 A;  1IF9 A;  4MO8 A;  5DSK A;  2WEJ A;  4E3D A;  4Q06 A;  4Q81 A;  2QOA A;  1FQL A;  5EHV A;  3IBU A;  1G6V A;  1CAK A;  5EKM A;  2CBD A;  3TVN X;  4QJM A;  4TWM A;  1I9O A;  3B4F A;  3V3G B;  1CIM A;  3C7P A;  1LGD A;  3Q31 A;  2FOS A;  1I9L A;  4COQ A;  2FOY A;  1BNM A;  5CLU A;  3NJ9 A;  2CBA A;  1YO1 A;  4E9O X;  3U7C A;  2NNO A;  3MHI A;  4ZWI A;  3W6H A;  3K2F A;  1RJ5 A;  1XPZ A;  1ZH9 A;  3DD0 A;  3KON A;  3MWO A;  4KNN A;  4WUQ A;  2FNK A;  2ILI A;  4YWP A;  1OQ5 A;  1ZGF A;  4N0X B;  3JXG A;  4FU5 A;  4ITO A;  5AML A;  1LG6 A;  1G3Z A;  3MZC A;  4YGL A;  1CZM A;  4Q87 A;  5E2K A;  3MHC A;  3DVC A;  5E2R A;  4R59 A;  3D9Z A;  1FR7 A;  5FL4 A;  1CCS A;  4FVN A;  4HEZ A;  2FMZ A;  3RYJ B;  3RYX B;  3DVB A;  3UYQ A;  5JQT A;  3HLJ A;  3IBL A;  3PYK A;  5SZ4 A;  5A25 A;  3S9T A;  1HED A;  5FNJ A;  1THK A;  3MNH A;  1CNX A;  3BET A;  1H4N A;  3S78 B;  2AW1 A;  4TWL A;  3R16 A;  5SZ2 A;  5FLS A;  4L5W A;  1MUA A;  1BV3 A;  4G0C A;  5DVX A;  3RGE A;  3V3I B;  4LP6 A;  3CYU A;  3P5L A;  4HBA A;  1UGD A;  4FRC A;  4QK2 A;  5E2N A;  2VVA X;  2WD3 A;  5FLR A;  4IWZ A;  5E2M A;  2POU A;  3D8W A;  3M1K A;  1V9E A;  1CVH A;  4HEW A;  3T84 A;  1CNC A;  3IGP A;  4RUX A;  4Z1K A;  3S72 B;  5HPJ A;  1G0F A;  4K0Z A;  5FNH A;  1OKL A;  3OYQ A;  2Q1B A;  4QIZ A;  1TB0 X;  1CNH A;  1G4O A;  1BN4 A;  1UGB A;  3KIG A;  2FMG A;  1CAI A;  3MNA A;  2EU2 A;  3EFI A;  3N4B A;  4KUW A;  4QK1 A;  2NNS A;  2H15 A;  1A42 A;  4KP5 A;  3M96 A;  1ZGE A;  3M14 A;  5DSI A;  3DCW A;  5EHE A;  1URT A;  5CJF A;  1Y7W A;  4Q83 A;  2POW A;  3GZ0 A;  4QTL A;  2Q1Q A;  2CAB A;  5DSO A;  1G52 A;  3HKN A;  3DC9 A;  5JEG B;  1FQN A;  3BL0 A;  4QJO A;  3T5U A;  2X7U A;  1TTM A;  3SAP A;  1HUG A;  1YDC A;  5SZ3 A;  5FDI A;  3D93 A;  1TE3 X;  5SZ5 A;  2OSM A;  2FNN A;  5FNK A;  5J8Z A;  3V3H B;  1HEC A;  2HFW A;  3S71 B;  5EH5 A;  4QSA A;  3ZNC A;  3PJJ A;  5E5U A;  1AVN A;  3EFT A;  4HU1 A;  3S73 B;  1KOP A;  4Q8X A;  1BIC A;  4YXU A;  2NNV A;  3M04 A;  4FL7 A;  5JDV B;  5DSR A;  4CNX A;  3MYQ A;  1UGG A;  1CIN A;  3RZ8 A;  5E5R A;  4BCW A;  1CAJ A;  2WD2 A;  4Q09 A;  2FOQ A;  5EH7 A;  4ZAO A;  3T5Z A;  3DCS A;  1G48 A;  5DSP A;  5FL6 A;  1MOO A;  2O4Z A;  1IF6 A;  5FLT A;  3RZ7 A;  4HEY A;  4WR7 A;  3P3J A;  3FE4 A;  1KWR A;  4JS6 A;  3S77 B;  3V2M A;  5EH8 A;  1JCZ A;  2WEG A;  3RG3 A;  4L5V A;  3OIK A;  3V5G A;  2AX2 A;  4HF3 A;  3M67 A;  4WUP A;  4K1Q A;  2X7T A;  2NXT A;  1ZSA A;  4QEF A;  1FSN A;  5DSN A;  1HEA A;  4MLT A;  4Q90 A;  5DSL A;  3S75 B;  1CA2 A;  3MNK A;  1RAZ A;  3K7K A;  3T82 A;  1CCU A;  1ZNC A;  2IT4 A;  4PYY A;  12CA A;  4RN4 A;  1DMY A;  4YGJ A;  1G54 A;  3RYV B;  3SBI A;  2QP6 A;  4YGF A;  1KOQ A;  1DCB A;  4YYT A;  1DCA A;  5JG3 B;  2EZ7 A;  1CVD A;  4C3T A;  4Q6E A;  1TEU X;  3M2X A;  1FLJ A;  1RAY A;  3HFP A;  4X5S A;  1TEQ X;  5DSJ A;  2H4N A;  1H9N A;  2NWO A;  3DC3 A;  4ZWX A;  5DOH A;  4PYX A;  4QY3 A;  4E3G A;  1J9W A;  3HKU A;  4MDM A;  4LHI A;  5E2S A;  3P44 A;  3RZ5 A;  3M1J A;  4ITP A;  4FIK A;  1CNJ A;  5G03 A;  1TG9 A;  3L14 A;  1G4J A;  4QJP A;  4M2W A;  3CA2 A;  5EKH A;  5BRV A;  4CAC A;  5EHW A;  5BNL A;  1AZM A;  5EKJ A;  3S97 A;  1BNU A;  3TMJ A;  4KUY A;  1CA3 A;  4R5B A;  1IF4 A;  3TVO X;  5JEP B;  3RLD A;  1I9N A;  5JGS B;  4Q07 A;  4PZH A;  4Q9Y A;  5DOG A;  5IPZ A;  1CCT A;  1LZV A;  2HKK A;  3N3J A;  3OKU A;  1UGE A;  1TBT X;  4Z1N A;  1F2W A;  3FW3 A;  4L5U A;  3M1Q A;  1FSR A;  3DBU A;  3V3F A;  4CNW A;  3F7B A;  1CVB A;  1G1D A;  3LXE A;  3RYY A;  1ZSB A;  3SBH A;  4Q8Z A;  3N2P A;  4MLX A;  1IF7 A;  2NMX A;  2CBE A;  1Z97 A;  4HT0 A;  4RFC A;  1BNQ A;  5BRW A;  4XE1 A;  5A6H A;  1CAH A;  2FNM A;  3JXF A;  1I8Z A;  5FLQ A;  5JQ0 A;  1HEB A;  3DCC A;  1LG5 A;  4JSA A;  1XEG A;  1RZE A;  3NI5 A;  1CAY A;  4KNM A;  5BYI A;  4Q8Y A;  2ZNC A;  7CA2 A;  1CRA A;  2GD8 A;  4Y0J A;  1TH9 A;  3JXH C;  4QJW A;  4Z1J A;  3RZ0 B;  3S76 A;  1Z9Y A;  3MNJ A;  1CAZ A;  1CVC A;  3S8X A;  2OSF A;  4KV0 A;  4RIV A;  4MDL A;  4M2U A;  4IDR X;  5SZ6 A;  5JES B;  4Q08 A;  1AM6 A;  3CAJ A;  3U47 A;  3P4V A;  5FLP A;  2NN7 A;  4CQ0 A;  1I9Q A;  3M2N A;  3HKT A;  1CIL A;  1CNK A;  1ZFQ A;  2GEH A;  4ZWZ A;  4M2V A;  4WW8 A;  4KP8 A;  2HOC A;  1CAL A;  1RZA A;  4Q78 A;  1XQ0 A;  1FSQ A;  4ZWY A;  2EU3 A;  3KLD B;  4RUZ A;  3F8E A;  3MDZ A;  1RZC A; 
#chains in the Genus database with same CATH topology
 4JSZ A;  4ZX0 A;  4YXO A;  1CNW A;  5G0B A;  3HKQ A;  3T83 A;  3KS3 A;  3MNU A;  4HT2 A;  3V2J A;  3IAI A;  1BN3 A;  3S74 B;  4JSW A;  3P58 A;  3U3A X;  4JSS A;  4CNV A;  1V9I C;  1JV0 A;  2NXS A;  1RZB A;  3FFP X;  3M98 A;  5JGT B;  1CVA A;  5DSM A;  5SZ0 A;  3MHL A;  5FNL A;  4QSJ A;  1G53 A;  3OIM A;  1CNB A;  3W6I A;  4UOV A;  3P55 A;  1YO0 A;  3RYZ A;  4YXI A;  2NWZ A;  1UGF A;  3QYK A;  4KAP A;  1BNW A;  1CNG A;  3VBD A;  4MTY A;  2CBC A;  3R17 B;  1HVA A;  1BN1 A;  2NXR A;  5BRU A;  4M2R A;  2HL4 A;  3SAX A;  3M1W A;  1XEV A;  4K13 A;  1FR4 A;  4WW6 A;  4RUY A;  4E5Q A;  4N16 A;  5EIJ A;  1ZE8 A;  5SZ1 A;  1YDA A;  3IEO A;  6CA2 A;  3M5S A;  4QIY A;  1UGC A;  3KKX A;  3KNE A;  2ABE A;  3DA2 A;  1HUH A;  1ZFK A;  3M2Z A;  2W2J A;  3D92 A;  3V7X A;  1CAN A;  1OKM A;  1FQR A;  4KNJ A;  4GL1 X;  1CRM A;  3DV7 A;  4Q7S A;  4G7A A;  4RFD A;  1CNY A;  4YHA A;  5L6K A;  3DAZ A;  4DZ7 A;  3P5A A;  5JG5 B;  5L3O A;  4DZ9 A;  3PO6 A;  5CA2 A;  2CA2 A;  3D0N A;  4KUV A;  5C8I A;  1HCB A;  5AMG A;  5EZT X;  3MHM A;  4E3F A;  1G46 A;  5EOI A;  3IBN A;  4YVY A;  4Q49 A;  1BCD A;  3IBI A;  3M40 A;  1I91 A;  5G0C A;  3KOI A;  4E4A A;  3F4X A;  4FPT A;  4Q7V A;  4YGN A;  1BNT A;  1HCA A;  4R5A A;  4PQ7 A;  3M2Y A;  1YO2 A;  2FOU A;  4RH2 A;  4CNR A;  1ZSC A;  4Q7W A;  5JEH B;  4ILX A;  3DVD A;  3OKV A;  4RIU A;  8CA2 A;  4QK3 A;  3DD8 A;  4LU3 A;  1LUG A;  3ML2 A;  2WEH A;  2WEO A;  1EOU A;  1I9P A;  3OIL A;  3P3H A;  4FVO A;  1KEQ A;  4YX4 A;  4YGK A;  2QO8 A;  4QSB A;  1G0E A;  4ETQ C;  3MMF A;  4BF1 A;  3M3X A;  3CZV A;  4WL4 A;  3HS4 A;  4K0S A;  4K0T A;  1FQM A;  2NWP A;  3V3J A;  1BZM A;  2X7S A;  2POV A;  3RJ7 A;  5DSQ A;  5E28 A;  3MNI A;  3RG4 A;  3K34 A;  4E3H A;  1TG3 A;  4Q7P A;  4QSI A;  4BF6 A;  3ZP9 A;  3NB5 A;  3T85 A;  5CAC A;  1I90 A;  1RJ6 A;  3KOK A;  4Q99 A;  4ZX1 A;  2VVB X;  1YDB A;  1CVF A;  1BNV A;  2HNC A;  3RZ1 B;  3B1B A;  4Z0Q A;  1IF8 A;  3F7U A;  1CAM A;  1CAO A;  5G01 A;  1KWQ A;  4Q6D A;  4KNI A;  3KWA A;  1I9M A;  5FL5 A;  4CA2 A;  1H9Q A;  1RZD A;  3M5T A;  2FW4 A;  1Z93 A;  4Q0L A;  2FOV A;  4XIW A;  4XZ5 A;  5FLO A;  3M5E A;  3N0N A;  5LMD A;  9CA2 A;  3BL1 A;  2F14 A;  4MDG A;  3MHO A;  1DMX A;  1YDD A;  2NN1 A;  1UGA A;  3UYN A;  5FNM A;  3U45 X;  4XFW A;  5DRS A;  4Z1E A;  4QJX A;  4XIX A;  5FNI A;  1CVE A;  1OKN A;  1T9N A;  5AMD A;  1IF5 A;  1G45 A;  5FNG A;  2NNG A;  5FDC A;  1CNI A;  2CBB A;  3OY0 A;  5SZ7 A;  1JD0 A;  3OYS A;  4PXX A;  3ML5 A;  2Q38 A;  4QJ0 A;  2NWY A;  4E49 A;  1BNN A;  2HD6 A;  1IF9 A;  4MO8 A;  5DSK A;  2WEJ A;  4E3D A;  4Q06 A;  4Q81 A;  2QOA A;  1FQL A;  5EHV A;  3IBU A;  1G6V A;  1CAK A;  5EKM A;  2CBD A;  3TVN X;  4QJM A;  4TWM A;  1I9O A;  3B4F A;  3V3G B;  1CIM A;  3C7P A;  1LGD A;  3Q31 A;  2FOS A;  1I9L A;  4COQ A;  2FOY A;  1BNM A;  5CLU A;  3NJ9 A;  2CBA A;  1YO1 A;  4E9O X;  3U7C A;  2NNO A;  3MHI A;  4ZWI A;  3W6H A;  3K2F A;  1RJ5 A;  1XPZ A;  1ZH9 A;  3DD0 A;  3KON A;  3MWO A;  4KNN A;  4WUQ A;  2FNK A;  2ILI A;  4YWP A;  1OQ5 A;  1ZGF A;  4N0X B;  3JXG A;  4FU5 A;  4ITO A;  5AML A;  1LG6 A;  1G3Z A;  3MZC A;  4YGL A;  1CZM A;  4Q87 A;  5E2K A;  3MHC A;  3DVC A;  5E2R A;  4R59 A;  3D9Z A;  1FR7 A;  5FL4 A;  1CCS A;  4FVN A;  4HEZ A;  2FMZ A;  3RYJ B;  3RYX B;  3DVB A;  3UYQ A;  5JQT A;  3HLJ A;  3IBL A;  3PYK A;  5SZ4 A;  5A25 A;  3S9T A;  1HED A;  5FNJ A;  1THK A;  3MNH A;  1CNX A;  3BET A;  1H4N A;  3S78 B;  2AW1 A;  4TWL A;  3R16 A;  5SZ2 A;  5FLS A;  4L5W A;  1MUA A;  1BV3 A;  4G0C A;  5DVX A;  3RGE A;  3V3I B;  4LP6 A;  3CYU A;  3P5L A;  4HBA A;  1UGD A;  4FRC A;  4QK2 A;  5E2N A;  2VVA X;  2WD3 A;  5FLR A;  4IWZ A;  5E2M A;  2POU A;  3D8W A;  3M1K A;  1V9E A;  1CVH A;  4HEW A;  3T84 A;  1CNC A;  3IGP A;  4RUX A;  4Z1K A;  3S72 B;  5HPJ A;  1G0F A;  4K0Z A;  5FNH A;  1OKL A;  3OYQ A;  2Q1B A;  4QIZ A;  1TB0 X;  1CNH A;  1G4O A;  1BN4 A;  1UGB A;  3KIG A;  2FMG A;  1CAI A;  3MNA A;  2EU2 A;  3EFI A;  3N4B A;  4KUW A;  4QK1 A;  2NNS A;  2H15 A;  1A42 A;  4KP5 A;  3M96 A;  1ZGE A;  3M14 A;  5DSI A;  3DCW A;  5EHE A;  1URT A;  5CJF A;  1Y7W A;  4Q83 A;  2POW A;  3GZ0 A;  4QTL A;  2Q1Q A;  2CAB A;  5DSO A;  1G52 A;  3HKN A;  3DC9 A;  5JEG B;  1FQN A;  3BL0 A;  4QJO A;  3T5U A;  2X7U A;  1TTM A;  3SAP A;  1HUG A;  1YDC A;  5SZ3 A;  5FDI A;  3D93 A;  1TE3 X;  5SZ5 A;  2OSM A;  2FNN A;  5FNK A;  5J8Z A;  3V3H B;  1HEC A;  2HFW A;  3S71 B;  5EH5 A;  4QSA A;  3ZNC A;  3PJJ A;  5E5U A;  1AVN A;  3EFT A;  4HU1 A;  3S73 B;  1KOP A;  4Q8X A;  1BIC A;  4YXU A;  2NNV A;  3M04 A;  4FL7 A;  5JDV B;  5DSR A;  4CNX A;  3MYQ A;  1UGG A;  1CIN A;  3RZ8 A;  5E5R A;  4BCW A;  1CAJ A;  2WD2 A;  4Q09 A;  2FOQ A;  5EH7 A;  4ZAO A;  3T5Z A;  3DCS A;  1G48 A;  5DSP A;  5FL6 A;  1MOO A;  2O4Z A;  1IF6 A;  5FLT A;  3RZ7 A;  4HEY A;  4WR7 A;  3P3J A;  3FE4 A;  1KWR A;  4JS6 A;  3S77 B;  3V2M A;  5EH8 A;  1JCZ A;  2WEG A;  3RG3 A;  4L5V A;  3OIK A;  3V5G A;  2AX2 A;  4HF3 A;  3M67 A;  4WUP A;  4K1Q A;  2X7T A;  2NXT A;  1ZSA A;  4QEF A;  1FSN A;  5DSN A;  1HEA A;  4MLT A;  4Q90 A;  5DSL A;  3S75 B;  1CA2 A;  3MNK A;  1RAZ A;  3K7K A;  3T82 A;  1CCU A;  1ZNC A;  2IT4 A;  4PYY A;  12CA A;  4RN4 A;  1DMY A;  4YGJ A;  1G54 A;  3RYV B;  3SBI A;  2QP6 A;  4YGF A;  1KOQ A;  1DCB A;  4YYT A;  1DCA A;  5JG3 B;  2EZ7 A;  1CVD A;  4C3T A;  4Q6E A;  1TEU X;  3M2X A;  1FLJ A;  1RAY A;  3HFP A;  4X5S A;  1TEQ X;  5DSJ A;  2H4N A;  1H9N A;  2NWO A;  3DC3 A;  4ZWX A;  5DOH A;  4PYX A;  4QY3 A;  4E3G A;  1J9W A;  3HKU A;  4MDM A;  4LHI A;  5E2S A;  3P44 A;  3RZ5 A;  3M1J A;  4ITP A;  4FIK A;  1CNJ A;  5G03 A;  1TG9 A;  3L14 A;  1G4J A;  4QJP A;  4M2W A;  3CA2 A;  5EKH A;  5BRV A;  4CAC A;  5EHW A;  5BNL A;  1AZM A;  5EKJ A;  3S97 A;  1BNU A;  3TMJ A;  4KUY A;  1CA3 A;  4R5B A;  1IF4 A;  3TVO X;  5JEP B;  3RLD A;  1I9N A;  5JGS B;  4Q07 A;  4PZH A;  4Q9Y A;  5DOG A;  5IPZ A;  1CCT A;  1LZV A;  2HKK A;  3N3J A;  3OKU A;  1UGE A;  1TBT X;  4Z1N A;  1F2W A;  3FW3 A;  4L5U A;  3M1Q A;  1FSR A;  3DBU A;  3V3F A;  4CNW A;  3F7B A;  1CVB A;  1G1D A;  3LXE A;  3RYY A;  1ZSB A;  3SBH A;  4Q8Z A;  3N2P A;  4MLX A;  1IF7 A;  2NMX A;  2CBE A;  1Z97 A;  4HT0 A;  4RFC A;  1BNQ A;  5BRW A;  4XE1 A;  5A6H A;  1CAH A;  2FNM A;  3JXF A;  1I8Z A;  5FLQ A;  5JQ0 A;  1HEB A;  3DCC A;  1LG5 A;  4JSA A;  1XEG A;  1RZE A;  3NI5 A;  1CAY A;  4KNM A;  5BYI A;  4Q8Y A;  2ZNC A;  7CA2 A;  1CRA A;  2GD8 A;  4Y0J A;  1TH9 A;  3JXH C;  4QJW A;  4Z1J A;  3RZ0 B;  3S76 A;  1Z9Y A;  3MNJ A;  1CAZ A;  1CVC A;  3S8X A;  2OSF A;  4KV0 A;  4RIV A;  4MDL A;  4M2U A;  4IDR X;  5SZ6 A;  5JES B;  4Q08 A;  1AM6 A;  3CAJ A;  3U47 A;  3P4V A;  5FLP A;  2NN7 A;  4CQ0 A;  1I9Q A;  3M2N A;  3HKT A;  1CIL A;  1CNK A;  1ZFQ A;  2GEH A;  4ZWZ A;  4M2V A;  4WW8 A;  4KP8 A;  2HOC A;  1CAL A;  1RZA A;  4Q78 A;  1XQ0 A;  1FSQ A;  4ZWY A;  2EU3 A;  3KLD B;  4RUZ A;  3F8E A;  3MDZ A;  1RZC A; 
#chains in the Genus database with same CATH homology
 4JSZ A;  4ZX0 A;  4YXO A;  1CNW A;  5G0B A;  3HKQ A;  3T83 A;  3KS3 A;  3MNU A;  4HT2 A;  3V2J A;  3IAI A;  1BN3 A;  3S74 B;  4JSW A;  3P58 A;  3U3A X;  4JSS A;  4CNV A;  1V9I C;  1JV0 A;  2NXS A;  1RZB A;  3FFP X;  3M98 A;  5JGT B;  1CVA A;  5DSM A;  5SZ0 A;  3MHL A;  5FNL A;  4QSJ A;  1G53 A;  3OIM A;  1CNB A;  3W6I A;  4UOV A;  3P55 A;  1YO0 A;  3RYZ A;  4YXI A;  2NWZ A;  1UGF A;  3QYK A;  4KAP A;  1BNW A;  1CNG A;  3VBD A;  4MTY A;  2CBC A;  3R17 B;  1HVA A;  1BN1 A;  2NXR A;  5BRU A;  4M2R A;  2HL4 A;  3SAX A;  3M1W A;  1XEV A;  4K13 A;  1FR4 A;  4WW6 A;  4RUY A;  4E5Q A;  4N16 A;  5EIJ A;  1ZE8 A;  5SZ1 A;  1YDA A;  3IEO A;  6CA2 A;  3M5S A;  4QIY A;  1UGC A;  3KKX A;  3KNE A;  2ABE A;  3DA2 A;  1HUH A;  1ZFK A;  3M2Z A;  2W2J A;  3D92 A;  3V7X A;  1CAN A;  1OKM A;  1FQR A;  4KNJ A;  4GL1 X;  1CRM A;  3DV7 A;  4Q7S A;  4G7A A;  4RFD A;  1CNY A;  4YHA A;  5L6K A;  3DAZ A;  4DZ7 A;  3P5A A;  5JG5 B;  5L3O A;  4DZ9 A;  3PO6 A;  5CA2 A;  2CA2 A;  3D0N A;  4KUV A;  5C8I A;  1HCB A;  5AMG A;  5EZT X;  3MHM A;  4E3F A;  1G46 A;  5EOI A;  3IBN A;  4YVY A;  4Q49 A;  1BCD A;  3IBI A;  3M40 A;  1I91 A;  5G0C A;  3KOI A;  4E4A A;  3F4X A;  4FPT A;  4Q7V A;  4YGN A;  1BNT A;  1HCA A;  4R5A A;  4PQ7 A;  3M2Y A;  1YO2 A;  2FOU A;  4RH2 A;  4CNR A;  1ZSC A;  4Q7W A;  5JEH B;  4ILX A;  3DVD A;  3OKV A;  4RIU A;  8CA2 A;  4QK3 A;  3DD8 A;  4LU3 A;  1LUG A;  3ML2 A;  2WEH A;  2WEO A;  1EOU A;  1I9P A;  3OIL A;  3P3H A;  4FVO A;  1KEQ A;  4YX4 A;  4YGK A;  2QO8 A;  4QSB A;  1G0E A;  4ETQ C;  3MMF A;  4BF1 A;  3M3X A;  3CZV A;  4WL4 A;  3HS4 A;  4K0S A;  4K0T A;  1FQM A;  2NWP A;  3V3J A;  1BZM A;  2X7S A;  2POV A;  3RJ7 A;  5DSQ A;  5E28 A;  3MNI A;  3RG4 A;  3K34 A;  4E3H A;  1TG3 A;  4Q7P A;  4QSI A;  4BF6 A;  3ZP9 A;  3NB5 A;  3T85 A;  5CAC A;  1I90 A;  1RJ6 A;  3KOK A;  4Q99 A;  4ZX1 A;  2VVB X;  1YDB A;  1CVF A;  1BNV A;  2HNC A;  3RZ1 B;  3B1B A;  4Z0Q A;  1IF8 A;  3F7U A;  1CAM A;  1CAO A;  5G01 A;  1KWQ A;  4Q6D A;  4KNI A;  3KWA A;  1I9M A;  5FL5 A;  4CA2 A;  1H9Q A;  1RZD A;  3M5T A;  2FW4 A;  1Z93 A;  4Q0L A;  2FOV A;  4XIW A;  4XZ5 A;  5FLO A;  3M5E A;  3N0N A;  5LMD A;  9CA2 A;  3BL1 A;  2F14 A;  4MDG A;  3MHO A;  1DMX A;  1YDD A;  2NN1 A;  1UGA A;  3UYN A;  5FNM A;  3U45 X;  4XFW A;  5DRS A;  4Z1E A;  4QJX A;  4XIX A;  5FNI A;  1CVE A;  1OKN A;  1T9N A;  5AMD A;  1IF5 A;  1G45 A;  5FNG A;  2NNG A;  5FDC A;  1CNI A;  2CBB A;  3OY0 A;  5SZ7 A;  1JD0 A;  3OYS A;  4PXX A;  3ML5 A;  2Q38 A;  4QJ0 A;  2NWY A;  4E49 A;  1BNN A;  2HD6 A;  1IF9 A;  4MO8 A;  5DSK A;  2WEJ A;  4E3D A;  4Q06 A;  4Q81 A;  2QOA A;  1FQL A;  5EHV A;  3IBU A;  1G6V A;  1CAK A;  5EKM A;  2CBD A;  3TVN X;  4QJM A;  4TWM A;  1I9O A;  3B4F A;  3V3G B;  1CIM A;  3C7P A;  1LGD A;  3Q31 A;  2FOS A;  1I9L A;  4COQ A;  2FOY A;  1BNM A;  5CLU A;  3NJ9 A;  2CBA A;  1YO1 A;  4E9O X;  3U7C A;  2NNO A;  3MHI A;  4ZWI A;  3W6H A;  3K2F A;  1RJ5 A;  1XPZ A;  1ZH9 A;  3DD0 A;  3KON A;  3MWO A;  4KNN A;  4WUQ A;  2FNK A;  2ILI A;  4YWP A;  1OQ5 A;  1ZGF A;  4N0X B;  3JXG A;  4FU5 A;  4ITO A;  5AML A;  1LG6 A;  1G3Z A;  3MZC A;  4YGL A;  1CZM A;  4Q87 A;  5E2K A;  3MHC A;  3DVC A;  5E2R A;  4R59 A;  3D9Z A;  1FR7 A;  5FL4 A;  1CCS A;  4FVN A;  4HEZ A;  2FMZ A;  3RYJ B;  3RYX B;  3DVB A;  3UYQ A;  5JQT A;  3HLJ A;  3IBL A;  3PYK A;  5SZ4 A;  5A25 A;  3S9T A;  1HED A;  5FNJ A;  1THK A;  3MNH A;  1CNX A;  3BET A;  1H4N A;  3S78 B;  2AW1 A;  4TWL A;  3R16 A;  5SZ2 A;  5FLS A;  4L5W A;  1MUA A;  1BV3 A;  4G0C A;  5DVX A;  3RGE A;  3V3I B;  4LP6 A;  3CYU A;  3P5L A;  4HBA A;  1UGD A;  4FRC A;  4QK2 A;  5E2N A;  2VVA X;  2WD3 A;  5FLR A;  4IWZ A;  5E2M A;  2POU A;  3D8W A;  3M1K A;  1V9E A;  1CVH A;  4HEW A;  3T84 A;  1CNC A;  3IGP A;  4RUX A;  4Z1K A;  3S72 B;  5HPJ A;  1G0F A;  4K0Z A;  5FNH A;  1OKL A;  3OYQ A;  2Q1B A;  4QIZ A;  1TB0 X;  1CNH A;  1G4O A;  1BN4 A;  1UGB A;  3KIG A;  2FMG A;  1CAI A;  3MNA A;  2EU2 A;  3EFI A;  3N4B A;  4KUW A;  4QK1 A;  2NNS A;  2H15 A;  1A42 A;  4KP5 A;  3M96 A;  1ZGE A;  3M14 A;  5DSI A;  3DCW A;  5EHE A;  1URT A;  5CJF A;  1Y7W A;  4Q83 A;  2POW A;  3GZ0 A;  4QTL A;  2Q1Q A;  2CAB A;  5DSO A;  1G52 A;  3HKN A;  3DC9 A;  5JEG B;  1FQN A;  3BL0 A;  4QJO A;  3T5U A;  2X7U A;  1TTM A;  3SAP A;  1HUG A;  1YDC A;  5SZ3 A;  5FDI A;  3D93 A;  1TE3 X;  5SZ5 A;  2OSM A;  2FNN A;  5FNK A;  5J8Z A;  3V3H B;  1HEC A;  2HFW A;  3S71 B;  5EH5 A;  4QSA A;  3ZNC A;  3PJJ A;  5E5U A;  1AVN A;  3EFT A;  4HU1 A;  3S73 B;  1KOP A;  4Q8X A;  1BIC A;  4YXU A;  2NNV A;  3M04 A;  4FL7 A;  5JDV B;  5DSR A;  4CNX A;  3MYQ A;  1UGG A;  1CIN A;  3RZ8 A;  5E5R A;  4BCW A;  1CAJ A;  2WD2 A;  4Q09 A;  2FOQ A;  5EH7 A;  4ZAO A;  3T5Z A;  3DCS A;  1G48 A;  5DSP A;  5FL6 A;  1MOO A;  2O4Z A;  1IF6 A;  5FLT A;  3RZ7 A;  4HEY A;  4WR7 A;  3P3J A;  3FE4 A;  1KWR A;  4JS6 A;  3S77 B;  3V2M A;  5EH8 A;  1JCZ A;  2WEG A;  3RG3 A;  4L5V A;  3OIK A;  3V5G A;  2AX2 A;  4HF3 A;  3M67 A;  4WUP A;  4K1Q A;  2X7T A;  2NXT A;  1ZSA A;  4QEF A;  1FSN A;  5DSN A;  1HEA A;  4MLT A;  4Q90 A;  5DSL A;  3S75 B;  1CA2 A;  3MNK A;  1RAZ A;  3K7K A;  3T82 A;  1CCU A;  1ZNC A;  2IT4 A;  4PYY A;  12CA A;  4RN4 A;  1DMY A;  4YGJ A;  1G54 A;  3RYV B;  3SBI A;  2QP6 A;  4YGF A;  1KOQ A;  1DCB A;  4YYT A;  1DCA A;  5JG3 B;  2EZ7 A;  1CVD A;  4C3T A;  4Q6E A;  1TEU X;  3M2X A;  1FLJ A;  1RAY A;  3HFP A;  4X5S A;  1TEQ X;  5DSJ A;  2H4N A;  1H9N A;  2NWO A;  3DC3 A;  4ZWX A;  5DOH A;  4PYX A;  4QY3 A;  4E3G A;  1J9W A;  3HKU A;  4MDM A;  4LHI A;  5E2S A;  3P44 A;  3RZ5 A;  3M1J A;  4ITP A;  4FIK A;  1CNJ A;  5G03 A;  1TG9 A;  3L14 A;  1G4J A;  4QJP A;  4M2W A;  3CA2 A;  5EKH A;  5BRV A;  4CAC A;  5EHW A;  5BNL A;  1AZM A;  5EKJ A;  3S97 A;  1BNU A;  3TMJ A;  4KUY A;  1CA3 A;  4R5B A;  1IF4 A;  3TVO X;  5JEP B;  3RLD A;  1I9N A;  5JGS B;  4Q07 A;  4PZH A;  4Q9Y A;  5DOG A;  5IPZ A;  1CCT A;  1LZV A;  2HKK A;  3N3J A;  3OKU A;  1UGE A;  1TBT X;  4Z1N A;  1F2W A;  3FW3 A;  4L5U A;  3M1Q A;  1FSR A;  3DBU A;  3V3F A;  4CNW A;  3F7B A;  1CVB A;  1G1D A;  3LXE A;  3RYY A;  1ZSB A;  3SBH A;  4Q8Z A;  3N2P A;  4MLX A;  1IF7 A;  2NMX A;  2CBE A;  1Z97 A;  4HT0 A;  4RFC A;  1BNQ A;  5BRW A;  4XE1 A;  5A6H A;  1CAH A;  2FNM A;  3JXF A;  1I8Z A;  5FLQ A;  5JQ0 A;  1HEB A;  3DCC A;  1LG5 A;  4JSA A;  1XEG A;  1RZE A;  3NI5 A;  1CAY A;  4KNM A;  5BYI A;  4Q8Y A;  2ZNC A;  7CA2 A;  1CRA A;  2GD8 A;  4Y0J A;  1TH9 A;  3JXH C;  4QJW A;  4Z1J A;  3RZ0 B;  3S76 A;  1Z9Y A;  3MNJ A;  1CAZ A;  1CVC A;  3S8X A;  2OSF A;  4KV0 A;  4RIV A;  4MDL A;  4M2U A;  4IDR X;  5SZ6 A;  5JES B;  4Q08 A;  1AM6 A;  3CAJ A;  3U47 A;  3P4V A;  5FLP A;  2NN7 A;  4CQ0 A;  1I9Q A;  3M2N A;  3HKT A;  1CIL A;  1CNK A;  1ZFQ A;  2GEH A;  4ZWZ A;  4M2V A;  4WW8 A;  4KP8 A;  2HOC A;  1CAL A;  1RZA A;  4Q78 A;  1XQ0 A;  1FSQ A;  4ZWY A;  2EU3 A;  3KLD B;  4RUZ A;  3F8E A;  3MDZ A;  1RZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...