2HFWA

Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase iii
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
257
structure length
257
Chain Sequence
EWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGHTCNVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 3
publication title Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 68
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2hfwA00
3KS3A 2EU3A 1TEUX 3MNKA 1CAKA 5FLPA 1J9WA 4PXXA 4FU5A 4QK1A 2NNGA 4Y0JA 1HVAA 2NWPA 4CNRA 3RZ7A 5SZ1A 3K2FA 3MHCA 1IF9A 3D0NA 2CBAA 1I8ZA 4L5VA 1RZCA 1I9NA 5FNJA 3R17B 5CLUA 5DOGA 3S76A 2POVA 3KKXA 1I9OA 1RZDA 1ZSAA 4E49A 1CNKA 1UGFA 4Q99A 4QJPA 5FLSA 5G03A 3ML5A 1CVCA 3M96A 5FLTA 5DVXA 4Z1EA 4YGLA 1I9MA 4ILXA 4Z1NA 1CCUA 1FR7A 2NN7A 4KUWA 4DZ9A 3TVNX 5DSJA 1I91A 4WW8A 4R59A 1TG3A 2FNMA 2WEGA 3S73B 5A25A 4Z0QA 3RJ7A 1UGDA 5SZ2A 3F8EA 3MNIA 5JGTB 1RZEA 4KNNA 3NB5A 2HFWA 4ZX0A 2CBEA 2HOCA 5CA2A 4K0SA 3N4BA 2HKKA 2FOSA 1G53A 2Q38A 4WL4A 5EHWA 3K34A 4HBAA 3T83A 4Q7VA 4TWLA 3V3HB 1YDAA 1G1DA 3OYSA 4TWMA 1OKMA 2FMZA 4Q08A 5EKJA 1ZSBA 3RZ1B 1HECA 4M2WA 5E5RA 1CVBA 4QSIA 4YXIA 1RZAA 3CYUA 4JSSA 4R5AA 4WUPA 5AMDA 4R5BA 1JCZA 2NNVA 4LHIA 1ZGEA 4L5UA 4PZHA 5DSQA 1CCSA 2FOUA 1KWQA 4Q7WA 2OSMA 3RG3A 3RGEA 2AW1A 4M2VA 5E2RA 5J8ZA 5AMLA 1YO0A 4Q7PA 2H15A 5EKMA 2IT4A 3DA2A 3RLDA 1BN4A 1CRAA 3EFTA 4KAPA 4FL7A 4RIUA 1OKNA 3DBUA 3S77B 5JDVB 4RN4A 3V3GB 5G0BA 2NMXA 2FNKA 3T82A 4MDGA 1MUAA 4LU3A 1G48A 5FL5A 5DSOA 4QJOA 1TE3X 3OIMA 3S9TA 3RZ8A 3V2MA 1I90A 5FDCA 1KWRA 4CACA 1IF6A 4ZWZA 3LXEA 3M67A 3MNUA 2W2JA 1FQRA 3PYKA 3U45X 1Z97A 2H4NA 4E3FA 2FOVA 4RIVA 4QSBA 3SAPA 3DV7A 1RZBA 3DC9A 4WW6A 2NWYA 1CAIA 1UGCA 3MHIA 5JEPB 3HS4A 5JG5B 3F7BA 1I9QA 1BCDA 4Q81A 5DSPA 4YYTA 4RUXA 4M2UA 3P5AA 4CNVA 4CA2A 1V9EA 4QSAA 3CAJA 1CNIA 1RAZA 1HEAA 1TEQX 1URTA 1A42A 3DVBA 4ZAOA 1YO2A 1V9IC 2FMGA 3C7PA 3M98A 1UGBA 4YGJA 1UGEA 5DSRA 4JSZA 1HUGA 1CNBA 3BL0A 3FFPX 4Q83A 1XPZA 3S8XA 1G4OA 2ILIA 4CNXA 3M2NA 1ZH9A 1LGDA 4E5QA 1CALA 4FVNA 5CJFA 4YVYA 4FRCA 4XZ5A 5FLRA 4G7AA 1RJ5A 5EKHA 3IEOA 1CVDA 5DSMA 1H9QA 1CILA 4UOVA 3HLJA 3M5TA 5G01A 2NNOA 3DVDA 4KV0A 3DCCA 2CABA 3M5EA 3MDZA 3TMJA 5E28A 1DCBA 5JEHB 3FW3A 1G52A 3V7XA 2EU2A 1H9NA 1G46A 3BL1A 4YWPA 2O4ZA 4L5WA 1UGGA 5SZ5A 3KONA 1I9PA 1CCTA 1XEVA 3V3JA 3M2XA 1BNTA 3HKUA 3MWOA 2CBBA 3M14A 3ML2A 3S74B 4Q90A 4YGNA 5FNGA 4KNIA 4YHAA 1DCAA 3BETA 1CINA 3V5GA 4Q8XA 2VVBX 1HCAA 3KOIA 1AM6A 1CNXA 3OY0A 2CBDA 2Q1BA 3P4VA 3MMFA 3HKTA 3SAXA 1BV3A 4RH2A 4RFDA 1BNUA 5SZ3A 3OIKA 4MDMA 3IGPA 3OILA 4QIZA 4QJ0A 4QEFA 4ZX1A 4FVOA 5BYIA 1IF7A 2AX2A 2NNSA 3DCSA 4HEYA 1BN1A 1HCBA 1CAHA 5DSLA 5A6HA 3KWAA 4KUVA 3RZ0B 1BNMA 5FNKA 4RFCA 1LG5A 5SZ6A 4ZWXA 2NXSA 1DMYA 3HKNA 1G4JA 4GL1X 1CAJA 5IPZA 1YDBA 3N2PA 1CNWA 4K1QA 4Q0LA 1G0FA 1BNVA 4YXOA 6CA2A 1FSQA 3HFPA 3M1QA 3F4XA 2FOYA 2X7UA 3Q31A 4Q6EA 3B1BA 4QTLA 3M1JA 2POWA 5CACA 4K0TA 1CNHA 4K0ZA 2ZNCA 4RUZA 4KP5A 1UGAA 2X7TA 3KOKA 1TTMA 4E3DA 5JQ0A 3R16A 4Q8ZA 4YGKA 3IBIA 1TH9A 4N16A 5EH5A 4QJXA 5SZ4A 2VVAX 1CVAA 5EH8A 1YO1A 1CVEA 1XQ0A 1ZGFA 1TG9A 1BNQA 1BN3A 2CBCA 3IAIA 2NN1A 3M2YA 4HU1A 1Z93A 3P58A 2NXTA 4PQ7A 4XFWA 5EHVA 4ZWYA 12CAA 2POUA 5AMGA 2WD3A 3EFIA 5FLOA 4X5SA 4KNMA 1LG6A 3F7UA 5FNMA 3RG4A 3W6IA 3RYXB 1MOOA 4RUYA 1G0EA 2F14A 3OKVA 3PJJA 1CIMA 1HEDA 4ITPA 4ITOA 3W6HA 5BNLA 3D9ZA 3P44A 4G0CA 5G0CA 5JESB 4K13A 3DD0A 3P55A 4MLTA 4E4AA 4CQ0A 2NXRA 5DSKA 4PYYA 2EZ7A 5EZTX 1HUHA 1CZMA 4HEZA 4Q06A 4HT2A 1FLJA 3NJ9A 1CNJA 4E3GA 3JXGA 3DVCA 2WD2A 1JV0A 1FQMA 3RYZA 1CAOA 1XEGA 3CA2A 4HF3A 4KNJA 3MNHA 5EHEA 5FLQA 1CA3A 4QJWA 4WR7A 1G6VA 1FSRA 1KOQA 3T84A 3SBIA 3CZVA 1AZMA 1ZFQA 2HD6A 3OYQA 4E3HA 3MYQA 3P3JA 5BRWA 3RYVB 4MDLA 3RYJB 4YXUA 5E2KA 3UYQA 4KP8A 1FR4A 1IF5A 4Q78A 2NWZA 3MHLA 3M04A 5JGSB 1FQLA 2X7SA 4HT0A 3UYNA 3DAZA 5EIJA 3HKQA 3N0NA 4QK3A 1TBTX 4FIKA 2OSFA 1IF8A 3M1KA 1KEQA 4Z1JA 3T5ZA 1DMXA 4YX4A 1KOPA 1ZSCA 5E2MA 5FL6A 1CVFA 3JXHC 3JXFA 3U3AX 1G45A 2HL4A 3GZ0A 2FW4A 4HEWA 4XIXA 2GD8A 3S75B 7CA2A 4MO8A 4LP6A 4BF6A 1CNGA 3PO6A 5DSIA 1LUGA 2FOQA 5E2NA 2QOAA 1EOUA 3D93A 1T9NA 3NI5A 1CRMA 5EOIA 3D8WA 1Y7WA 4JS6A 3IBUA 4Q6DA 1G3ZA 5C8IA 4IDRX 5FNIA 3K7KA 8CA2A 4Q49A 3OKUA 3T5UA 2WEHA 3S97A 1BNNA 4Q7SA 5E2SA 5BRVA 3M3XA 4C3TA 2WEOA 4JSAA 4ZWIA 3FE4A 3M2ZA 3P3HA 4Z1KA 3B4FA 4Q07A 3QYKA 5L6KA 3T85A 5DRSA 5JEGB 4Q87A 3DCWA 3ZNCA 4XIWA 4BF1A 3SBHA 1HEBA 3S78B 1H4NA 4WUQA 2QP6A 1CAZA 4MTYA 4QJMA 4QK2A 4M2RA 1FQNA 3V2JA 4ETQC 3N3JA 1RAYA 4Q09A 3IBLA 2CA2A 1CANA 4KUYA 1OKLA 5FDIA 4MLXA 3V3FA 3DD8A 1CAMA 3IBNA 1ZFKA 2NWOA 4N0XB 3M1WA 2Q1QA 1JD0A 3D92A 4PYXA 3S71B 1RJ6A 4COQA 5L3OA 5JQTA 5DSNA 3M40A 1Z9YA 1CNCA 4Q9YA 3RZ5A 4BCWA 1F2WA 4E9OX 1CAYA 1BNWA 2ABEA 4YGFA 5JG3B 4FPTA 2GEHA 4QSJA 3L14A 1TB0X 5SZ7A 3KIGA 5FNLA 3VBDA 9CA2A 4Q8YA 3MNAA 1YDCA 4IWZA 5DOHA 1BZMA 3RYYA 3M5SA 1I9LA 5LMDA 1YDDA 4DZ7A 3U47A 4JSWA 3V3IB 3ZP9A 5FNHA 1CNYA 3KLDB 4QY3A 1CA2A 3TVOX 4QIYA 3MHOA 3S72B 5EH7A 2QO8A 3P5LA 5HPJA 1LZVA 3DC3A 3MZCA 2HNCA 1IF4A 1ZE8A 5E5UA 1ZNCA 3U7CA 5BRUA 1BICA 1THKA 3MHMA 2WEJA 3MNJA 1CVHA 5SZ0A 1OQ5A 2FNNA 4XE1A 5FL4A 1G54A 1AVNA 4CNWA 3KNEA 1FSNA
chains in the Genus database with same CATH superfamily
3KS3A 2EU3A 1TEUX 3MNKA 1CAKA 5FLPA 1J9WA 4PXXA 4FU5A 4QK1A 2NNGA 4Y0JA 1HVAA 2NWPA 4CNRA 3RZ7A 5SZ1A 3K2FA 3MHCA 1IF9A 3D0NA 2CBAA 1I8ZA 4L5VA 1RZCA 1I9NA 5FNJA 3R17B 5CLUA 5DOGA 3S76A 2POVA 3KKXA 1I9OA 1RZDA 1ZSAA 4E49A 1CNKA 1UGFA 4Q99A 4QJPA 5FLSA 5G03A 3ML5A 1CVCA 3M96A 5FLTA 5DVXA 4Z1EA 4YGLA 1I9MA 4ILXA 4Z1NA 1CCUA 1FR7A 2NN7A 4KUWA 4DZ9A 3TVNX 5DSJA 1I91A 4WW8A 4R59A 1TG3A 2FNMA 2WEGA 3S73B 5A25A 4Z0QA 3RJ7A 1UGDA 5SZ2A 3F8EA 3MNIA 5JGTB 1RZEA 4KNNA 3NB5A 2HFWA 4ZX0A 2CBEA 2HOCA 5CA2A 4K0SA 3N4BA 2HKKA 2FOSA 1G53A 2Q38A 4WL4A 5EHWA 3K34A 4HBAA 3T83A 4Q7VA 4TWLA 3V3HB 1YDAA 1G1DA 3OYSA 4TWMA 1OKMA 2FMZA 4Q08A 5EKJA 1ZSBA 3RZ1B 1HECA 4M2WA 5E5RA 1CVBA 4QSIA 4YXIA 1RZAA 3CYUA 4JSSA 4R5AA 4WUPA 5AMDA 4R5BA 1JCZA 2NNVA 4LHIA 1ZGEA 4L5UA 4PZHA 5DSQA 1CCSA 2FOUA 1KWQA 4Q7WA 2OSMA 3RG3A 3RGEA 2AW1A 4M2VA 5E2RA 5J8ZA 5AMLA 1YO0A 4Q7PA 2H15A 5EKMA 2IT4A 3DA2A 3RLDA 1BN4A 1CRAA 3EFTA 4KAPA 4FL7A 4RIUA 1OKNA 3DBUA 3S77B 5JDVB 4RN4A 3V3GB 5G0BA 2NMXA 2FNKA 3T82A 4MDGA 1MUAA 4LU3A 1G48A 5FL5A 5DSOA 4QJOA 1TE3X 3OIMA 3S9TA 3RZ8A 3V2MA 1I90A 5FDCA 1KWRA 4CACA 1IF6A 4ZWZA 3LXEA 3M67A 3MNUA 2W2JA 1FQRA 3PYKA 3U45X 1Z97A 2H4NA 4E3FA 2FOVA 4RIVA 4QSBA 3SAPA 3DV7A 1RZBA 3DC9A 4WW6A 2NWYA 1CAIA 1UGCA 3MHIA 5JEPB 3HS4A 5JG5B 3F7BA 1I9QA 1BCDA 4Q81A 5DSPA 4YYTA 4RUXA 4M2UA 3P5AA 4CNVA 4CA2A 1V9EA 4QSAA 3CAJA 1CNIA 1RAZA 1HEAA 1TEQX 1URTA 1A42A 3DVBA 4ZAOA 1YO2A 1V9IC 2FMGA 3C7PA 3M98A 1UGBA 4YGJA 1UGEA 5DSRA 4JSZA 1HUGA 1CNBA 3BL0A 3FFPX 4Q83A 1XPZA 3S8XA 1G4OA 2ILIA 4CNXA 3M2NA 1ZH9A 1LGDA 4E5QA 1CALA 4FVNA 5CJFA 4YVYA 4FRCA 4XZ5A 5FLRA 4G7AA 1RJ5A 5EKHA 3IEOA 1CVDA 5DSMA 1H9QA 1CILA 4UOVA 3HLJA 3M5TA 5G01A 2NNOA 3DVDA 4KV0A 3DCCA 2CABA 3M5EA 3MDZA 3TMJA 5E28A 1DCBA 5JEHB 3FW3A 1G52A 3V7XA 2EU2A 1H9NA 1G46A 3BL1A 4YWPA 2O4ZA 4L5WA 1UGGA 5SZ5A 3KONA 1I9PA 1CCTA 1XEVA 3V3JA 3M2XA 1BNTA 3HKUA 3MWOA 2CBBA 3M14A 3ML2A 3S74B 4Q90A 4YGNA 5FNGA 4KNIA 4YHAA 1DCAA 3BETA 1CINA 3V5GA 4Q8XA 2VVBX 1HCAA 3KOIA 1AM6A 1CNXA 3OY0A 2CBDA 2Q1BA 3P4VA 3MMFA 3HKTA 3SAXA 1BV3A 4RH2A 4RFDA 1BNUA 5SZ3A 3OIKA 4MDMA 3IGPA 3OILA 4QIZA 4QJ0A 4QEFA 4ZX1A 4FVOA 5BYIA 1IF7A 2AX2A 2NNSA 3DCSA 4HEYA 1BN1A 1HCBA 1CAHA 5DSLA 5A6HA 3KWAA 4KUVA 3RZ0B 1BNMA 5FNKA 4RFCA 1LG5A 5SZ6A 4ZWXA 2NXSA 1DMYA 3HKNA 1G4JA 4GL1X 1CAJA 5IPZA 1YDBA 3N2PA 1CNWA 4K1QA 4Q0LA 1G0FA 1BNVA 4YXOA 6CA2A 1FSQA 3HFPA 3M1QA 3F4XA 2FOYA 2X7UA 3Q31A 4Q6EA 3B1BA 4QTLA 3M1JA 2POWA 5CACA 4K0TA 1CNHA 4K0ZA 2ZNCA 4RUZA 4KP5A 1UGAA 2X7TA 3KOKA 1TTMA 4E3DA 5JQ0A 3R16A 4Q8ZA 4YGKA 3IBIA 1TH9A 4N16A 5EH5A 4QJXA 5SZ4A 2VVAX 1CVAA 5EH8A 1YO1A 1CVEA 1XQ0A 1ZGFA 1TG9A 1BNQA 1BN3A 2CBCA 3IAIA 2NN1A 3M2YA 4HU1A 1Z93A 3P58A 2NXTA 4PQ7A 4XFWA 5EHVA 4ZWYA 12CAA 2POUA 5AMGA 2WD3A 3EFIA 5FLOA 4X5SA 4KNMA 1LG6A 3F7UA 5FNMA 3RG4A 3W6IA 3RYXB 1MOOA 4RUYA 1G0EA 2F14A 3OKVA 3PJJA 1CIMA 1HEDA 4ITPA 4ITOA 3W6HA 5BNLA 3D9ZA 3P44A 4G0CA 5G0CA 5JESB 4K13A 3DD0A 3P55A 4MLTA 4E4AA 4CQ0A 2NXRA 5DSKA 4PYYA 2EZ7A 5EZTX 1HUHA 1CZMA 4HEZA 4Q06A 4HT2A 1FLJA 3NJ9A 1CNJA 4E3GA 3JXGA 3DVCA 2WD2A 1JV0A 1FQMA 3RYZA 1CAOA 1XEGA 3CA2A 4HF3A 4KNJA 3MNHA 5EHEA 5FLQA 1CA3A 4QJWA 4WR7A 1G6VA 1FSRA 1KOQA 3T84A 3SBIA 3CZVA 1AZMA 1ZFQA 2HD6A 3OYQA 4E3HA 3MYQA 3P3JA 5BRWA 3RYVB 4MDLA 3RYJB 4YXUA 5E2KA 3UYQA 4KP8A 1FR4A 1IF5A 4Q78A 2NWZA 3MHLA 3M04A 5JGSB 1FQLA 2X7SA 4HT0A 3UYNA 3DAZA 5EIJA 3HKQA 3N0NA 4QK3A 1TBTX 4FIKA 2OSFA 1IF8A 3M1KA 1KEQA 4Z1JA 3T5ZA 1DMXA 4YX4A 1KOPA 1ZSCA 5E2MA 5FL6A 1CVFA 3JXHC 3JXFA 3U3AX 1G45A 2HL4A 3GZ0A 2FW4A 4HEWA 4XIXA 2GD8A 3S75B 7CA2A 4MO8A 4LP6A 4BF6A 1CNGA 3PO6A 5DSIA 1LUGA 2FOQA 5E2NA 2QOAA 1EOUA 3D93A 1T9NA 3NI5A 1CRMA 5EOIA 3D8WA 1Y7WA 4JS6A 3IBUA 4Q6DA 1G3ZA 5C8IA 4IDRX 5FNIA 3K7KA 8CA2A 4Q49A 3OKUA 3T5UA 2WEHA 3S97A 1BNNA 4Q7SA 5E2SA 5BRVA 3M3XA 4C3TA 2WEOA 4JSAA 4ZWIA 3FE4A 3M2ZA 3P3HA 4Z1KA 3B4FA 4Q07A 3QYKA 5L6KA 3T85A 5DRSA 5JEGB 4Q87A 3DCWA 3ZNCA 4XIWA 4BF1A 3SBHA 1HEBA 3S78B 1H4NA 4WUQA 2QP6A 1CAZA 4MTYA 4QJMA 4QK2A 4M2RA 1FQNA 3V2JA 4ETQC 3N3JA 1RAYA 4Q09A 3IBLA 2CA2A 1CANA 4KUYA 1OKLA 5FDIA 4MLXA 3V3FA 3DD8A 1CAMA 3IBNA 1ZFKA 2NWOA 4N0XB 3M1WA 2Q1QA 1JD0A 3D92A 4PYXA 3S71B 1RJ6A 4COQA 5L3OA 5JQTA 5DSNA 3M40A 1Z9YA 1CNCA 4Q9YA 3RZ5A 4BCWA 1F2WA 4E9OX 1CAYA 1BNWA 2ABEA 4YGFA 5JG3B 4FPTA 2GEHA 4QSJA 3L14A 1TB0X 5SZ7A 3KIGA 5FNLA 3VBDA 9CA2A 4Q8YA 3MNAA 1YDCA 4IWZA 5DOHA 1BZMA 3RYYA 3M5SA 1I9LA 5LMDA 1YDDA 4DZ7A 3U47A 4JSWA 3V3IB 3ZP9A 5FNHA 1CNYA 3KLDB 4QY3A 1CA2A 3TVOX 4QIYA 3MHOA 3S72B 5EH7A 2QO8A 3P5LA 5HPJA 1LZVA 3DC3A 3MZCA 2HNCA 1IF4A 1ZE8A 5E5UA 1ZNCA 3U7CA 5BRUA 1BICA 1THKA 3MHMA 2WEJA 3MNJA 1CVHA 5SZ0A 1OQ5A 2FNNA 4XE1A 5FL4A 1G54A 1AVNA 4CNWA 3KNEA 1FSNA
chains in the Genus database with same CATH topology
3KS3A 2EU3A 1TEUX 3MNKA 1CAKA 5FLPA 1J9WA 4PXXA 4FU5A 4QK1A 2NNGA 4Y0JA 1HVAA 2NWPA 4CNRA 3RZ7A 5SZ1A 3K2FA 3MHCA 1IF9A 3D0NA 2CBAA 1I8ZA 4L5VA 1RZCA 1I9NA 5FNJA 3R17B 5CLUA 5DOGA 3S76A 2POVA 3KKXA 1I9OA 1RZDA 1ZSAA 4E49A 1CNKA 1UGFA 4Q99A 4QJPA 5FLSA 5G03A 3ML5A 1CVCA 3M96A 5FLTA 5DVXA 4Z1EA 4YGLA 1I9MA 4ILXA 4Z1NA 1CCUA 1FR7A 2NN7A 4KUWA 4DZ9A 3TVNX 5DSJA 1I91A 4WW8A 4R59A 1TG3A 2FNMA 2WEGA 3S73B 5A25A 4Z0QA 3RJ7A 1UGDA 5SZ2A 3F8EA 3MNIA 5JGTB 1RZEA 4KNNA 3NB5A 2HFWA 4ZX0A 2CBEA 2HOCA 5CA2A 4K0SA 3N4BA 2HKKA 2FOSA 1G53A 2Q38A 4WL4A 5EHWA 3K34A 4HBAA 3T83A 4Q7VA 4TWLA 3V3HB 1YDAA 1G1DA 3OYSA 4TWMA 1OKMA 2FMZA 4Q08A 5EKJA 1ZSBA 3RZ1B 1HECA 4M2WA 5E5RA 1CVBA 4QSIA 4YXIA 1RZAA 3CYUA 4JSSA 4R5AA 4WUPA 5AMDA 4R5BA 1JCZA 2NNVA 4LHIA 1ZGEA 4L5UA 4PZHA 5DSQA 1CCSA 2FOUA 1KWQA 4Q7WA 2OSMA 3RG3A 3RGEA 2AW1A 4M2VA 5E2RA 5J8ZA 5AMLA 1YO0A 4Q7PA 2H15A 5EKMA 2IT4A 3DA2A 3RLDA 1BN4A 1CRAA 3EFTA 4KAPA 4FL7A 4RIUA 1OKNA 3DBUA 3S77B 5JDVB 4RN4A 3V3GB 5G0BA 2NMXA 2FNKA 3T82A 4MDGA 1MUAA 4LU3A 1G48A 5FL5A 5DSOA 4QJOA 1TE3X 3OIMA 3S9TA 3RZ8A 3V2MA 1I90A 5FDCA 1KWRA 4CACA 1IF6A 4ZWZA 3LXEA 3M67A 3MNUA 2W2JA 1FQRA 3PYKA 3U45X 1Z97A 2H4NA 4E3FA 2FOVA 4RIVA 4QSBA 3SAPA 3DV7A 1RZBA 3DC9A 4WW6A 2NWYA 1CAIA 1UGCA 3MHIA 5JEPB 3HS4A 5JG5B 3F7BA 1I9QA 1BCDA 4Q81A 5DSPA 4YYTA 4RUXA 4M2UA 3P5AA 4CNVA 4CA2A 1V9EA 4QSAA 3CAJA 1CNIA 1RAZA 1HEAA 1TEQX 1URTA 1A42A 3DVBA 4ZAOA 1YO2A 1V9IC 2FMGA 3C7PA 3M98A 1UGBA 4YGJA 1UGEA 5DSRA 4JSZA 1HUGA 1CNBA 3BL0A 3FFPX 4Q83A 1XPZA 3S8XA 1G4OA 2ILIA 4CNXA 3M2NA 1ZH9A 1LGDA 4E5QA 1CALA 4FVNA 5CJFA 4YVYA 4FRCA 4XZ5A 5FLRA 4G7AA 1RJ5A 5EKHA 3IEOA 1CVDA 5DSMA 1H9QA 1CILA 4UOVA 3HLJA 3M5TA 5G01A 2NNOA 3DVDA 4KV0A 3DCCA 2CABA 3M5EA 3MDZA 3TMJA 5E28A 1DCBA 5JEHB 3FW3A 1G52A 3V7XA 2EU2A 1H9NA 1G46A 3BL1A 4YWPA 2O4ZA 4L5WA 1UGGA 5SZ5A 3KONA 1I9PA 1CCTA 1XEVA 3V3JA 3M2XA 1BNTA 3HKUA 3MWOA 2CBBA 3M14A 3ML2A 3S74B 4Q90A 4YGNA 5FNGA 4KNIA 4YHAA 1DCAA 3BETA 1CINA 3V5GA 4Q8XA 2VVBX 1HCAA 3KOIA 1AM6A 1CNXA 3OY0A 2CBDA 2Q1BA 3P4VA 3MMFA 3HKTA 3SAXA 1BV3A 4RH2A 4RFDA 1BNUA 5SZ3A 3OIKA 4MDMA 3IGPA 3OILA 4QIZA 4QJ0A 4QEFA 4ZX1A 4FVOA 5BYIA 1IF7A 2AX2A 2NNSA 3DCSA 4HEYA 1BN1A 1HCBA 1CAHA 5DSLA 5A6HA 3KWAA 4KUVA 3RZ0B 1BNMA 5FNKA 4RFCA 1LG5A 5SZ6A 4ZWXA 2NXSA 1DMYA 3HKNA 1G4JA 4GL1X 1CAJA 5IPZA 1YDBA 3N2PA 1CNWA 4K1QA 4Q0LA 1G0FA 1BNVA 4YXOA 6CA2A 1FSQA 3HFPA 3M1QA 3F4XA 2FOYA 2X7UA 3Q31A 4Q6EA 3B1BA 4QTLA 3M1JA 2POWA 5CACA 4K0TA 1CNHA 4K0ZA 2ZNCA 4RUZA 4KP5A 1UGAA 2X7TA 3KOKA 1TTMA 4E3DA 5JQ0A 3R16A 4Q8ZA 4YGKA 3IBIA 1TH9A 4N16A 5EH5A 4QJXA 5SZ4A 2VVAX 1CVAA 5EH8A 1YO1A 1CVEA 1XQ0A 1ZGFA 1TG9A 1BNQA 1BN3A 2CBCA 3IAIA 2NN1A 3M2YA 4HU1A 1Z93A 3P58A 2NXTA 4PQ7A 4XFWA 5EHVA 4ZWYA 12CAA 2POUA 5AMGA 2WD3A 3EFIA 5FLOA 4X5SA 4KNMA 1LG6A 3F7UA 5FNMA 3RG4A 3W6IA 3RYXB 1MOOA 4RUYA 1G0EA 2F14A 3OKVA 3PJJA 1CIMA 1HEDA 4ITPA 4ITOA 3W6HA 5BNLA 3D9ZA 3P44A 4G0CA 5G0CA 5JESB 4K13A 3DD0A 3P55A 4MLTA 4E4AA 4CQ0A 2NXRA 5DSKA 4PYYA 2EZ7A 5EZTX 1HUHA 1CZMA 4HEZA 4Q06A 4HT2A 1FLJA 3NJ9A 1CNJA 4E3GA 3JXGA 3DVCA 2WD2A 1JV0A 1FQMA 3RYZA 1CAOA 1XEGA 3CA2A 4HF3A 4KNJA 3MNHA 5EHEA 5FLQA 1CA3A 4QJWA 4WR7A 1G6VA 1FSRA 1KOQA 3T84A 3SBIA 3CZVA 1AZMA 1ZFQA 2HD6A 3OYQA 4E3HA 3MYQA 3P3JA 5BRWA 3RYVB 4MDLA 3RYJB 4YXUA 5E2KA 3UYQA 4KP8A 1FR4A 1IF5A 4Q78A 2NWZA 3MHLA 3M04A 5JGSB 1FQLA 2X7SA 4HT0A 3UYNA 3DAZA 5EIJA 3HKQA 3N0NA 4QK3A 1TBTX 4FIKA 2OSFA 1IF8A 3M1KA 1KEQA 4Z1JA 3T5ZA 1DMXA 4YX4A 1KOPA 1ZSCA 5E2MA 5FL6A 1CVFA 3JXHC 3JXFA 3U3AX 1G45A 2HL4A 3GZ0A 2FW4A 4HEWA 4XIXA 2GD8A 3S75B 7CA2A 4MO8A 4LP6A 4BF6A 1CNGA 3PO6A 5DSIA 1LUGA 2FOQA 5E2NA 2QOAA 1EOUA 3D93A 1T9NA 3NI5A 1CRMA 5EOIA 3D8WA 1Y7WA 4JS6A 3IBUA 4Q6DA 1G3ZA 5C8IA 4IDRX 5FNIA 3K7KA 8CA2A 4Q49A 3OKUA 3T5UA 2WEHA 3S97A 1BNNA 4Q7SA 5E2SA 5BRVA 3M3XA 4C3TA 2WEOA 4JSAA 4ZWIA 3FE4A 3M2ZA 3P3HA 4Z1KA 3B4FA 4Q07A 3QYKA 5L6KA 3T85A 5DRSA 5JEGB 4Q87A 3DCWA 3ZNCA 4XIWA 4BF1A 3SBHA 1HEBA 3S78B 1H4NA 4WUQA 2QP6A 1CAZA 4MTYA 4QJMA 4QK2A 4M2RA 1FQNA 3V2JA 4ETQC 3N3JA 1RAYA 4Q09A 3IBLA 2CA2A 1CANA 4KUYA 1OKLA 5FDIA 4MLXA 3V3FA 3DD8A 1CAMA 3IBNA 1ZFKA 2NWOA 4N0XB 3M1WA 2Q1QA 1JD0A 3D92A 4PYXA 3S71B 1RJ6A 4COQA 5L3OA 5JQTA 5DSNA 3M40A 1Z9YA 1CNCA 4Q9YA 3RZ5A 4BCWA 1F2WA 4E9OX 1CAYA 1BNWA 2ABEA 4YGFA 5JG3B 4FPTA 2GEHA 4QSJA 3L14A 1TB0X 5SZ7A 3KIGA 5FNLA 3VBDA 9CA2A 4Q8YA 3MNAA 1YDCA 4IWZA 5DOHA 1BZMA 3RYYA 3M5SA 1I9LA 5LMDA 1YDDA 4DZ7A 3U47A 4JSWA 3V3IB 3ZP9A 5FNHA 1CNYA 3KLDB 4QY3A 1CA2A 3TVOX 4QIYA 3MHOA 3S72B 5EH7A 2QO8A 3P5LA 5HPJA 1LZVA 3DC3A 3MZCA 2HNCA 1IF4A 1ZE8A 5E5UA 1ZNCA 3U7CA 5BRUA 1BICA 1THKA 3MHMA 2WEJA 3MNJA 1CVHA 5SZ0A 1OQ5A 2FNNA 4XE1A 5FL4A 1G54A 1AVNA 4CNWA 3KNEA 1FSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS3 A;  2EU3 A;  1TEU X;  3MNK A;  1CAK A;  5FLP A;  1J9W A;  4PXX A;  4FU5 A;  4QK1 A;  2NNG A;  4Y0J A;  1HVA A;  2NWP A;  4CNR A;  3RZ7 A;  5SZ1 A;  3K2F A;  3MHC A;  1IF9 A;  3D0N A;  2CBA A;  1I8Z A;  4L5V A;  1RZC A;  1I9N A;  5FNJ A;  3R17 B;  5CLU A;  5DOG A;  3S76 A;  2POV A;  3KKX A;  1I9O A;  1RZD A;  1ZSA A;  4E49 A;  1CNK A;  1UGF A;  4Q99 A;  4QJP A;  5FLS A;  5G03 A;  3ML5 A;  1CVC A;  3M96 A;  5FLT A;  5DVX A;  4Z1E A;  4YGL A;  1I9M A;  4ILX A;  4Z1N A;  1CCU A;  1FR7 A;  2NN7 A;  4KUW A;  4DZ9 A;  3TVN X;  5DSJ A;  1I91 A;  4WW8 A;  4R59 A;  1TG3 A;  2FNM A;  2WEG A;  3S73 B;  5A25 A;  4Z0Q A;  3RJ7 A;  1UGD A;  5SZ2 A;  3F8E A;  3MNI A;  5JGT B;  1RZE A;  4KNN A;  3NB5 A;  2HFW A;  4ZX0 A;  2CBE A;  2HOC A;  5CA2 A;  4K0S A;  3N4B A;  2HKK A;  2FOS A;  1G53 A;  2Q38 A;  4WL4 A;  5EHW A;  3K34 A;  4HBA A;  3T83 A;  4Q7V A;  4TWL A;  3V3H B;  1YDA A;  1G1D A;  3OYS A;  4TWM A;  1OKM A;  2FMZ A;  4Q08 A;  5EKJ A;  1ZSB A;  3RZ1 B;  1HEC A;  4M2W A;  5E5R A;  1CVB A;  4QSI A;  4YXI A;  1RZA A;  3CYU A;  4JSS A;  4R5A A;  4WUP A;  5AMD A;  4R5B A;  1JCZ A;  2NNV A;  4LHI A;  1ZGE A;  4L5U A;  4PZH A;  5DSQ A;  1CCS A;  2FOU A;  1KWQ A;  4Q7W A;  2OSM A;  3RG3 A;  3RGE A;  2AW1 A;  4M2V A;  5E2R A;  5J8Z A;  5AML A;  1YO0 A;  4Q7P A;  2H15 A;  5EKM A;  2IT4 A;  3DA2 A;  3RLD A;  1BN4 A;  1CRA A;  3EFT A;  4KAP A;  4FL7 A;  4RIU A;  1OKN A;  3DBU A;  3S77 B;  5JDV B;  4RN4 A;  3V3G B;  5G0B A;  2NMX A;  2FNK A;  3T82 A;  4MDG A;  1MUA A;  4LU3 A;  1G48 A;  5FL5 A;  5DSO A;  4QJO A;  1TE3 X;  3OIM A;  3S9T A;  3RZ8 A;  3V2M A;  1I90 A;  5FDC A;  1KWR A;  4CAC A;  1IF6 A;  4ZWZ A;  3LXE A;  3M67 A;  3MNU A;  2W2J A;  1FQR A;  3PYK A;  3U45 X;  1Z97 A;  2H4N A;  4E3F A;  2FOV A;  4RIV A;  4QSB A;  3SAP A;  3DV7 A;  1RZB A;  3DC9 A;  4WW6 A;  2NWY A;  1CAI A;  1UGC A;  3MHI A;  5JEP B;  3HS4 A;  5JG5 B;  3F7B A;  1I9Q A;  1BCD A;  4Q81 A;  5DSP A;  4YYT A;  4RUX A;  4M2U A;  3P5A A;  4CNV A;  4CA2 A;  1V9E A;  4QSA A;  3CAJ A;  1CNI A;  1RAZ A;  1HEA A;  1TEQ X;  1URT A;  1A42 A;  3DVB A;  4ZAO A;  1YO2 A;  1V9I C;  2FMG A;  3C7P A;  3M98 A;  1UGB A;  4YGJ A;  1UGE A;  5DSR A;  4JSZ A;  1HUG A;  1CNB A;  3BL0 A;  3FFP X;  4Q83 A;  1XPZ A;  3S8X A;  1G4O A;  2ILI A;  4CNX A;  3M2N A;  1ZH9 A;  1LGD A;  4E5Q A;  1CAL A;  4FVN A;  5CJF A;  4YVY A;  4FRC A;  4XZ5 A;  5FLR A;  4G7A A;  1RJ5 A;  5EKH A;  3IEO A;  1CVD A;  5DSM A;  1H9Q A;  1CIL A;  4UOV A;  3HLJ A;  3M5T A;  5G01 A;  2NNO A;  3DVD A;  4KV0 A;  3DCC A;  2CAB A;  3M5E A;  3MDZ A;  3TMJ A;  5E28 A;  1DCB A;  5JEH B;  3FW3 A;  1G52 A;  3V7X A;  2EU2 A;  1H9N A;  1G46 A;  3BL1 A;  4YWP A;  2O4Z A;  4L5W A;  1UGG A;  5SZ5 A;  3KON A;  1I9P A;  1CCT A;  1XEV A;  3V3J A;  3M2X A;  1BNT A;  3HKU A;  3MWO A;  2CBB A;  3M14 A;  3ML2 A;  3S74 B;  4Q90 A;  4YGN A;  5FNG A;  4KNI A;  4YHA A;  1DCA A;  3BET A;  1CIN A;  3V5G A;  4Q8X A;  2VVB X;  1HCA A;  3KOI A;  1AM6 A;  1CNX A;  3OY0 A;  2CBD A;  2Q1B A;  3P4V A;  3MMF A;  3HKT A;  3SAX A;  1BV3 A;  4RH2 A;  4RFD A;  1BNU A;  5SZ3 A;  3OIK A;  4MDM A;  3IGP A;  3OIL A;  4QIZ A;  4QJ0 A;  4QEF A;  4ZX1 A;  4FVO A;  5BYI A;  1IF7 A;  2AX2 A;  2NNS A;  3DCS A;  4HEY A;  1BN1 A;  1HCB A;  1CAH A;  5DSL A;  5A6H A;  3KWA A;  4KUV A;  3RZ0 B;  1BNM A;  5FNK A;  4RFC A;  1LG5 A;  5SZ6 A;  4ZWX A;  2NXS A;  1DMY A;  3HKN A;  1G4J A;  4GL1 X;  1CAJ A;  5IPZ A;  1YDB A;  3N2P A;  1CNW A;  4K1Q A;  4Q0L A;  1G0F A;  1BNV A;  4YXO A;  6CA2 A;  1FSQ A;  3HFP A;  3M1Q A;  3F4X A;  2FOY A;  2X7U A;  3Q31 A;  4Q6E A;  3B1B A;  4QTL A;  3M1J A;  2POW A;  5CAC A;  4K0T A;  1CNH A;  4K0Z A;  2ZNC A;  4RUZ A;  4KP5 A;  1UGA A;  2X7T A;  3KOK A;  1TTM A;  4E3D A;  5JQ0 A;  3R16 A;  4Q8Z A;  4YGK A;  3IBI A;  1TH9 A;  4N16 A;  5EH5 A;  4QJX A;  5SZ4 A;  2VVA X;  1CVA A;  5EH8 A;  1YO1 A;  1CVE A;  1XQ0 A;  1ZGF A;  1TG9 A;  1BNQ A;  1BN3 A;  2CBC A;  3IAI A;  2NN1 A;  3M2Y A;  4HU1 A;  1Z93 A;  3P58 A;  2NXT A;  4PQ7 A;  4XFW A;  5EHV A;  4ZWY A;  12CA A;  2POU A;  5AMG A;  2WD3 A;  3EFI A;  5FLO A;  4X5S A;  4KNM A;  1LG6 A;  3F7U A;  5FNM A;  3RG4 A;  3W6I A;  3RYX B;  1MOO A;  4RUY A;  1G0E A;  2F14 A;  3OKV A;  3PJJ A;  1CIM A;  1HED A;  4ITP A;  4ITO A;  3W6H A;  5BNL A;  3D9Z A;  3P44 A;  4G0C A;  5G0C A;  5JES B;  4K13 A;  3DD0 A;  3P55 A;  4MLT A;  4E4A A;  4CQ0 A;  2NXR A;  5DSK A;  4PYY A;  2EZ7 A;  5EZT X;  1HUH A;  1CZM A;  4HEZ A;  4Q06 A;  4HT2 A;  1FLJ A;  3NJ9 A;  1CNJ A;  4E3G A;  3JXG A;  3DVC A;  2WD2 A;  1JV0 A;  1FQM A;  3RYZ A;  1CAO A;  1XEG A;  3CA2 A;  4HF3 A;  4KNJ A;  3MNH A;  5EHE A;  5FLQ A;  1CA3 A;  4QJW A;  4WR7 A;  1G6V A;  1FSR A;  1KOQ A;  3T84 A;  3SBI A;  3CZV A;  1AZM A;  1ZFQ A;  2HD6 A;  3OYQ A;  4E3H A;  3MYQ A;  3P3J A;  5BRW A;  3RYV B;  4MDL A;  3RYJ B;  4YXU A;  5E2K A;  3UYQ A;  4KP8 A;  1FR4 A;  1IF5 A;  4Q78 A;  2NWZ A;  3MHL A;  3M04 A;  5JGS B;  1FQL A;  2X7S A;  4HT0 A;  3UYN A;  3DAZ A;  5EIJ A;  3HKQ A;  3N0N A;  4QK3 A;  1TBT X;  4FIK A;  2OSF A;  1IF8 A;  3M1K A;  1KEQ A;  4Z1J A;  3T5Z A;  1DMX A;  4YX4 A;  1KOP A;  1ZSC A;  5E2M A;  5FL6 A;  1CVF A;  3JXH C;  3JXF A;  3U3A X;  1G45 A;  2HL4 A;  3GZ0 A;  2FW4 A;  4HEW A;  4XIX A;  2GD8 A;  3S75 B;  7CA2 A;  4MO8 A;  4LP6 A;  4BF6 A;  1CNG A;  3PO6 A;  5DSI A;  1LUG A;  2FOQ A;  5E2N A;  2QOA A;  1EOU A;  3D93 A;  1T9N A;  3NI5 A;  1CRM A;  5EOI A;  3D8W A;  1Y7W A;  4JS6 A;  3IBU A;  4Q6D A;  1G3Z A;  5C8I A;  4IDR X;  5FNI A;  3K7K A;  8CA2 A;  4Q49 A;  3OKU A;  3T5U A;  2WEH A;  3S97 A;  1BNN A;  4Q7S A;  5E2S A;  5BRV A;  3M3X A;  4C3T A;  2WEO A;  4JSA A;  4ZWI A;  3FE4 A;  3M2Z A;  3P3H A;  4Z1K A;  3B4F A;  4Q07 A;  3QYK A;  5L6K A;  3T85 A;  5DRS A;  5JEG B;  4Q87 A;  3DCW A;  3ZNC A;  4XIW A;  4BF1 A;  3SBH A;  1HEB A;  3S78 B;  1H4N A;  4WUQ A;  2QP6 A;  1CAZ A;  4MTY A;  4QJM A;  4QK2 A;  4M2R A;  1FQN A;  3V2J A;  4ETQ C;  3N3J A;  1RAY A;  4Q09 A;  3IBL A;  2CA2 A;  1CAN A;  4KUY A;  1OKL A;  5FDI A;  4MLX A;  3V3F A;  3DD8 A;  1CAM A;  3IBN A;  1ZFK A;  2NWO A;  4N0X B;  3M1W A;  2Q1Q A;  1JD0 A;  3D92 A;  4PYX A;  3S71 B;  1RJ6 A;  4COQ A;  5L3O A;  5JQT A;  5DSN A;  3M40 A;  1Z9Y A;  1CNC A;  4Q9Y A;  3RZ5 A;  4BCW A;  1F2W A;  4E9O X;  1CAY A;  1BNW A;  2ABE A;  4YGF A;  5JG3 B;  4FPT A;  2GEH A;  4QSJ A;  3L14 A;  1TB0 X;  5SZ7 A;  3KIG A;  5FNL A;  3VBD A;  9CA2 A;  4Q8Y A;  3MNA A;  1YDC A;  4IWZ A;  5DOH A;  1BZM A;  3RYY A;  3M5S A;  1I9L A;  5LMD A;  1YDD A;  4DZ7 A;  3U47 A;  4JSW A;  3V3I B;  3ZP9 A;  5FNH A;  1CNY A;  3KLD B;  4QY3 A;  1CA2 A;  3TVO X;  4QIY A;  3MHO A;  3S72 B;  5EH7 A;  2QO8 A;  3P5L A;  5HPJ A;  1LZV A;  3DC3 A;  3MZC A;  2HNC A;  1IF4 A;  1ZE8 A;  5E5U A;  1ZNC A;  3U7C A;  5BRU A;  1BIC A;  1THK A;  3MHM A;  2WEJ A;  3MNJ A;  1CVH A;  5SZ0 A;  1OQ5 A;  2FNN A;  4XE1 A;  5FL4 A;  1G54 A;  1AVN A;  4CNW A;  3KNE A;  1FSN A; 
#chains in the Genus database with same CATH topology
 3KS3 A;  2EU3 A;  1TEU X;  3MNK A;  1CAK A;  5FLP A;  1J9W A;  4PXX A;  4FU5 A;  4QK1 A;  2NNG A;  4Y0J A;  1HVA A;  2NWP A;  4CNR A;  3RZ7 A;  5SZ1 A;  3K2F A;  3MHC A;  1IF9 A;  3D0N A;  2CBA A;  1I8Z A;  4L5V A;  1RZC A;  1I9N A;  5FNJ A;  3R17 B;  5CLU A;  5DOG A;  3S76 A;  2POV A;  3KKX A;  1I9O A;  1RZD A;  1ZSA A;  4E49 A;  1CNK A;  1UGF A;  4Q99 A;  4QJP A;  5FLS A;  5G03 A;  3ML5 A;  1CVC A;  3M96 A;  5FLT A;  5DVX A;  4Z1E A;  4YGL A;  1I9M A;  4ILX A;  4Z1N A;  1CCU A;  1FR7 A;  2NN7 A;  4KUW A;  4DZ9 A;  3TVN X;  5DSJ A;  1I91 A;  4WW8 A;  4R59 A;  1TG3 A;  2FNM A;  2WEG A;  3S73 B;  5A25 A;  4Z0Q A;  3RJ7 A;  1UGD A;  5SZ2 A;  3F8E A;  3MNI A;  5JGT B;  1RZE A;  4KNN A;  3NB5 A;  2HFW A;  4ZX0 A;  2CBE A;  2HOC A;  5CA2 A;  4K0S A;  3N4B A;  2HKK A;  2FOS A;  1G53 A;  2Q38 A;  4WL4 A;  5EHW A;  3K34 A;  4HBA A;  3T83 A;  4Q7V A;  4TWL A;  3V3H B;  1YDA A;  1G1D A;  3OYS A;  4TWM A;  1OKM A;  2FMZ A;  4Q08 A;  5EKJ A;  1ZSB A;  3RZ1 B;  1HEC A;  4M2W A;  5E5R A;  1CVB A;  4QSI A;  4YXI A;  1RZA A;  3CYU A;  4JSS A;  4R5A A;  4WUP A;  5AMD A;  4R5B A;  1JCZ A;  2NNV A;  4LHI A;  1ZGE A;  4L5U A;  4PZH A;  5DSQ A;  1CCS A;  2FOU A;  1KWQ A;  4Q7W A;  2OSM A;  3RG3 A;  3RGE A;  2AW1 A;  4M2V A;  5E2R A;  5J8Z A;  5AML A;  1YO0 A;  4Q7P A;  2H15 A;  5EKM A;  2IT4 A;  3DA2 A;  3RLD A;  1BN4 A;  1CRA A;  3EFT A;  4KAP A;  4FL7 A;  4RIU A;  1OKN A;  3DBU A;  3S77 B;  5JDV B;  4RN4 A;  3V3G B;  5G0B A;  2NMX A;  2FNK A;  3T82 A;  4MDG A;  1MUA A;  4LU3 A;  1G48 A;  5FL5 A;  5DSO A;  4QJO A;  1TE3 X;  3OIM A;  3S9T A;  3RZ8 A;  3V2M A;  1I90 A;  5FDC A;  1KWR A;  4CAC A;  1IF6 A;  4ZWZ A;  3LXE A;  3M67 A;  3MNU A;  2W2J A;  1FQR A;  3PYK A;  3U45 X;  1Z97 A;  2H4N A;  4E3F A;  2FOV A;  4RIV A;  4QSB A;  3SAP A;  3DV7 A;  1RZB A;  3DC9 A;  4WW6 A;  2NWY A;  1CAI A;  1UGC A;  3MHI A;  5JEP B;  3HS4 A;  5JG5 B;  3F7B A;  1I9Q A;  1BCD A;  4Q81 A;  5DSP A;  4YYT A;  4RUX A;  4M2U A;  3P5A A;  4CNV A;  4CA2 A;  1V9E A;  4QSA A;  3CAJ A;  1CNI A;  1RAZ A;  1HEA A;  1TEQ X;  1URT A;  1A42 A;  3DVB A;  4ZAO A;  1YO2 A;  1V9I C;  2FMG A;  3C7P A;  3M98 A;  1UGB A;  4YGJ A;  1UGE A;  5DSR A;  4JSZ A;  1HUG A;  1CNB A;  3BL0 A;  3FFP X;  4Q83 A;  1XPZ A;  3S8X A;  1G4O A;  2ILI A;  4CNX A;  3M2N A;  1ZH9 A;  1LGD A;  4E5Q A;  1CAL A;  4FVN A;  5CJF A;  4YVY A;  4FRC A;  4XZ5 A;  5FLR A;  4G7A A;  1RJ5 A;  5EKH A;  3IEO A;  1CVD A;  5DSM A;  1H9Q A;  1CIL A;  4UOV A;  3HLJ A;  3M5T A;  5G01 A;  2NNO A;  3DVD A;  4KV0 A;  3DCC A;  2CAB A;  3M5E A;  3MDZ A;  3TMJ A;  5E28 A;  1DCB A;  5JEH B;  3FW3 A;  1G52 A;  3V7X A;  2EU2 A;  1H9N A;  1G46 A;  3BL1 A;  4YWP A;  2O4Z A;  4L5W A;  1UGG A;  5SZ5 A;  3KON A;  1I9P A;  1CCT A;  1XEV A;  3V3J A;  3M2X A;  1BNT A;  3HKU A;  3MWO A;  2CBB A;  3M14 A;  3ML2 A;  3S74 B;  4Q90 A;  4YGN A;  5FNG A;  4KNI A;  4YHA A;  1DCA A;  3BET A;  1CIN A;  3V5G A;  4Q8X A;  2VVB X;  1HCA A;  3KOI A;  1AM6 A;  1CNX A;  3OY0 A;  2CBD A;  2Q1B A;  3P4V A;  3MMF A;  3HKT A;  3SAX A;  1BV3 A;  4RH2 A;  4RFD A;  1BNU A;  5SZ3 A;  3OIK A;  4MDM A;  3IGP A;  3OIL A;  4QIZ A;  4QJ0 A;  4QEF A;  4ZX1 A;  4FVO A;  5BYI A;  1IF7 A;  2AX2 A;  2NNS A;  3DCS A;  4HEY A;  1BN1 A;  1HCB A;  1CAH A;  5DSL A;  5A6H A;  3KWA A;  4KUV A;  3RZ0 B;  1BNM A;  5FNK A;  4RFC A;  1LG5 A;  5SZ6 A;  4ZWX A;  2NXS A;  1DMY A;  3HKN A;  1G4J A;  4GL1 X;  1CAJ A;  5IPZ A;  1YDB A;  3N2P A;  1CNW A;  4K1Q A;  4Q0L A;  1G0F A;  1BNV A;  4YXO A;  6CA2 A;  1FSQ A;  3HFP A;  3M1Q A;  3F4X A;  2FOY A;  2X7U A;  3Q31 A;  4Q6E A;  3B1B A;  4QTL A;  3M1J A;  2POW A;  5CAC A;  4K0T A;  1CNH A;  4K0Z A;  2ZNC A;  4RUZ A;  4KP5 A;  1UGA A;  2X7T A;  3KOK A;  1TTM A;  4E3D A;  5JQ0 A;  3R16 A;  4Q8Z A;  4YGK A;  3IBI A;  1TH9 A;  4N16 A;  5EH5 A;  4QJX A;  5SZ4 A;  2VVA X;  1CVA A;  5EH8 A;  1YO1 A;  1CVE A;  1XQ0 A;  1ZGF A;  1TG9 A;  1BNQ A;  1BN3 A;  2CBC A;  3IAI A;  2NN1 A;  3M2Y A;  4HU1 A;  1Z93 A;  3P58 A;  2NXT A;  4PQ7 A;  4XFW A;  5EHV A;  4ZWY A;  12CA A;  2POU A;  5AMG A;  2WD3 A;  3EFI A;  5FLO A;  4X5S A;  4KNM A;  1LG6 A;  3F7U A;  5FNM A;  3RG4 A;  3W6I A;  3RYX B;  1MOO A;  4RUY A;  1G0E A;  2F14 A;  3OKV A;  3PJJ A;  1CIM A;  1HED A;  4ITP A;  4ITO A;  3W6H A;  5BNL A;  3D9Z A;  3P44 A;  4G0C A;  5G0C A;  5JES B;  4K13 A;  3DD0 A;  3P55 A;  4MLT A;  4E4A A;  4CQ0 A;  2NXR A;  5DSK A;  4PYY A;  2EZ7 A;  5EZT X;  1HUH A;  1CZM A;  4HEZ A;  4Q06 A;  4HT2 A;  1FLJ A;  3NJ9 A;  1CNJ A;  4E3G A;  3JXG A;  3DVC A;  2WD2 A;  1JV0 A;  1FQM A;  3RYZ A;  1CAO A;  1XEG A;  3CA2 A;  4HF3 A;  4KNJ A;  3MNH A;  5EHE A;  5FLQ A;  1CA3 A;  4QJW A;  4WR7 A;  1G6V A;  1FSR A;  1KOQ A;  3T84 A;  3SBI A;  3CZV A;  1AZM A;  1ZFQ A;  2HD6 A;  3OYQ A;  4E3H A;  3MYQ A;  3P3J A;  5BRW A;  3RYV B;  4MDL A;  3RYJ B;  4YXU A;  5E2K A;  3UYQ A;  4KP8 A;  1FR4 A;  1IF5 A;  4Q78 A;  2NWZ A;  3MHL A;  3M04 A;  5JGS B;  1FQL A;  2X7S A;  4HT0 A;  3UYN A;  3DAZ A;  5EIJ A;  3HKQ A;  3N0N A;  4QK3 A;  1TBT X;  4FIK A;  2OSF A;  1IF8 A;  3M1K A;  1KEQ A;  4Z1J A;  3T5Z A;  1DMX A;  4YX4 A;  1KOP A;  1ZSC A;  5E2M A;  5FL6 A;  1CVF A;  3JXH C;  3JXF A;  3U3A X;  1G45 A;  2HL4 A;  3GZ0 A;  2FW4 A;  4HEW A;  4XIX A;  2GD8 A;  3S75 B;  7CA2 A;  4MO8 A;  4LP6 A;  4BF6 A;  1CNG A;  3PO6 A;  5DSI A;  1LUG A;  2FOQ A;  5E2N A;  2QOA A;  1EOU A;  3D93 A;  1T9N A;  3NI5 A;  1CRM A;  5EOI A;  3D8W A;  1Y7W A;  4JS6 A;  3IBU A;  4Q6D A;  1G3Z A;  5C8I A;  4IDR X;  5FNI A;  3K7K A;  8CA2 A;  4Q49 A;  3OKU A;  3T5U A;  2WEH A;  3S97 A;  1BNN A;  4Q7S A;  5E2S A;  5BRV A;  3M3X A;  4C3T A;  2WEO A;  4JSA A;  4ZWI A;  3FE4 A;  3M2Z A;  3P3H A;  4Z1K A;  3B4F A;  4Q07 A;  3QYK A;  5L6K A;  3T85 A;  5DRS A;  5JEG B;  4Q87 A;  3DCW A;  3ZNC A;  4XIW A;  4BF1 A;  3SBH A;  1HEB A;  3S78 B;  1H4N A;  4WUQ A;  2QP6 A;  1CAZ A;  4MTY A;  4QJM A;  4QK2 A;  4M2R A;  1FQN A;  3V2J A;  4ETQ C;  3N3J A;  1RAY A;  4Q09 A;  3IBL A;  2CA2 A;  1CAN A;  4KUY A;  1OKL A;  5FDI A;  4MLX A;  3V3F A;  3DD8 A;  1CAM A;  3IBN A;  1ZFK A;  2NWO A;  4N0X B;  3M1W A;  2Q1Q A;  1JD0 A;  3D92 A;  4PYX A;  3S71 B;  1RJ6 A;  4COQ A;  5L3O A;  5JQT A;  5DSN A;  3M40 A;  1Z9Y A;  1CNC A;  4Q9Y A;  3RZ5 A;  4BCW A;  1F2W A;  4E9O X;  1CAY A;  1BNW A;  2ABE A;  4YGF A;  5JG3 B;  4FPT A;  2GEH A;  4QSJ A;  3L14 A;  1TB0 X;  5SZ7 A;  3KIG A;  5FNL A;  3VBD A;  9CA2 A;  4Q8Y A;  3MNA A;  1YDC A;  4IWZ A;  5DOH A;  1BZM A;  3RYY A;  3M5S A;  1I9L A;  5LMD A;  1YDD A;  4DZ7 A;  3U47 A;  4JSW A;  3V3I B;  3ZP9 A;  5FNH A;  1CNY A;  3KLD B;  4QY3 A;  1CA2 A;  3TVO X;  4QIY A;  3MHO A;  3S72 B;  5EH7 A;  2QO8 A;  3P5L A;  5HPJ A;  1LZV A;  3DC3 A;  3MZC A;  2HNC A;  1IF4 A;  1ZE8 A;  5E5U A;  1ZNC A;  3U7C A;  5BRU A;  1BIC A;  1THK A;  3MHM A;  2WEJ A;  3MNJ A;  1CVH A;  5SZ0 A;  1OQ5 A;  2FNN A;  4XE1 A;  5FL4 A;  1G54 A;  1AVN A;  4CNW A;  3KNE A;  1FSN A; 
#chains in the Genus database with same CATH homology
 3KS3 A;  2EU3 A;  1TEU X;  3MNK A;  1CAK A;  5FLP A;  1J9W A;  4PXX A;  4FU5 A;  4QK1 A;  2NNG A;  4Y0J A;  1HVA A;  2NWP A;  4CNR A;  3RZ7 A;  5SZ1 A;  3K2F A;  3MHC A;  1IF9 A;  3D0N A;  2CBA A;  1I8Z A;  4L5V A;  1RZC A;  1I9N A;  5FNJ A;  3R17 B;  5CLU A;  5DOG A;  3S76 A;  2POV A;  3KKX A;  1I9O A;  1RZD A;  1ZSA A;  4E49 A;  1CNK A;  1UGF A;  4Q99 A;  4QJP A;  5FLS A;  5G03 A;  3ML5 A;  1CVC A;  3M96 A;  5FLT A;  5DVX A;  4Z1E A;  4YGL A;  1I9M A;  4ILX A;  4Z1N A;  1CCU A;  1FR7 A;  2NN7 A;  4KUW A;  4DZ9 A;  3TVN X;  5DSJ A;  1I91 A;  4WW8 A;  4R59 A;  1TG3 A;  2FNM A;  2WEG A;  3S73 B;  5A25 A;  4Z0Q A;  3RJ7 A;  1UGD A;  5SZ2 A;  3F8E A;  3MNI A;  5JGT B;  1RZE A;  4KNN A;  3NB5 A;  2HFW A;  4ZX0 A;  2CBE A;  2HOC A;  5CA2 A;  4K0S A;  3N4B A;  2HKK A;  2FOS A;  1G53 A;  2Q38 A;  4WL4 A;  5EHW A;  3K34 A;  4HBA A;  3T83 A;  4Q7V A;  4TWL A;  3V3H B;  1YDA A;  1G1D A;  3OYS A;  4TWM A;  1OKM A;  2FMZ A;  4Q08 A;  5EKJ A;  1ZSB A;  3RZ1 B;  1HEC A;  4M2W A;  5E5R A;  1CVB A;  4QSI A;  4YXI A;  1RZA A;  3CYU A;  4JSS A;  4R5A A;  4WUP A;  5AMD A;  4R5B A;  1JCZ A;  2NNV A;  4LHI A;  1ZGE A;  4L5U A;  4PZH A;  5DSQ A;  1CCS A;  2FOU A;  1KWQ A;  4Q7W A;  2OSM A;  3RG3 A;  3RGE A;  2AW1 A;  4M2V A;  5E2R A;  5J8Z A;  5AML A;  1YO0 A;  4Q7P A;  2H15 A;  5EKM A;  2IT4 A;  3DA2 A;  3RLD A;  1BN4 A;  1CRA A;  3EFT A;  4KAP A;  4FL7 A;  4RIU A;  1OKN A;  3DBU A;  3S77 B;  5JDV B;  4RN4 A;  3V3G B;  5G0B A;  2NMX A;  2FNK A;  3T82 A;  4MDG A;  1MUA A;  4LU3 A;  1G48 A;  5FL5 A;  5DSO A;  4QJO A;  1TE3 X;  3OIM A;  3S9T A;  3RZ8 A;  3V2M A;  1I90 A;  5FDC A;  1KWR A;  4CAC A;  1IF6 A;  4ZWZ A;  3LXE A;  3M67 A;  3MNU A;  2W2J A;  1FQR A;  3PYK A;  3U45 X;  1Z97 A;  2H4N A;  4E3F A;  2FOV A;  4RIV A;  4QSB A;  3SAP A;  3DV7 A;  1RZB A;  3DC9 A;  4WW6 A;  2NWY A;  1CAI A;  1UGC A;  3MHI A;  5JEP B;  3HS4 A;  5JG5 B;  3F7B A;  1I9Q A;  1BCD A;  4Q81 A;  5DSP A;  4YYT A;  4RUX A;  4M2U A;  3P5A A;  4CNV A;  4CA2 A;  1V9E A;  4QSA A;  3CAJ A;  1CNI A;  1RAZ A;  1HEA A;  1TEQ X;  1URT A;  1A42 A;  3DVB A;  4ZAO A;  1YO2 A;  1V9I C;  2FMG A;  3C7P A;  3M98 A;  1UGB A;  4YGJ A;  1UGE A;  5DSR A;  4JSZ A;  1HUG A;  1CNB A;  3BL0 A;  3FFP X;  4Q83 A;  1XPZ A;  3S8X A;  1G4O A;  2ILI A;  4CNX A;  3M2N A;  1ZH9 A;  1LGD A;  4E5Q A;  1CAL A;  4FVN A;  5CJF A;  4YVY A;  4FRC A;  4XZ5 A;  5FLR A;  4G7A A;  1RJ5 A;  5EKH A;  3IEO A;  1CVD A;  5DSM A;  1H9Q A;  1CIL A;  4UOV A;  3HLJ A;  3M5T A;  5G01 A;  2NNO A;  3DVD A;  4KV0 A;  3DCC A;  2CAB A;  3M5E A;  3MDZ A;  3TMJ A;  5E28 A;  1DCB A;  5JEH B;  3FW3 A;  1G52 A;  3V7X A;  2EU2 A;  1H9N A;  1G46 A;  3BL1 A;  4YWP A;  2O4Z A;  4L5W A;  1UGG A;  5SZ5 A;  3KON A;  1I9P A;  1CCT A;  1XEV A;  3V3J A;  3M2X A;  1BNT A;  3HKU A;  3MWO A;  2CBB A;  3M14 A;  3ML2 A;  3S74 B;  4Q90 A;  4YGN A;  5FNG A;  4KNI A;  4YHA A;  1DCA A;  3BET A;  1CIN A;  3V5G A;  4Q8X A;  2VVB X;  1HCA A;  3KOI A;  1AM6 A;  1CNX A;  3OY0 A;  2CBD A;  2Q1B A;  3P4V A;  3MMF A;  3HKT A;  3SAX A;  1BV3 A;  4RH2 A;  4RFD A;  1BNU A;  5SZ3 A;  3OIK A;  4MDM A;  3IGP A;  3OIL A;  4QIZ A;  4QJ0 A;  4QEF A;  4ZX1 A;  4FVO A;  5BYI A;  1IF7 A;  2AX2 A;  2NNS A;  3DCS A;  4HEY A;  1BN1 A;  1HCB A;  1CAH A;  5DSL A;  5A6H A;  3KWA A;  4KUV A;  3RZ0 B;  1BNM A;  5FNK A;  4RFC A;  1LG5 A;  5SZ6 A;  4ZWX A;  2NXS A;  1DMY A;  3HKN A;  1G4J A;  4GL1 X;  1CAJ A;  5IPZ A;  1YDB A;  3N2P A;  1CNW A;  4K1Q A;  4Q0L A;  1G0F A;  1BNV A;  4YXO A;  6CA2 A;  1FSQ A;  3HFP A;  3M1Q A;  3F4X A;  2FOY A;  2X7U A;  3Q31 A;  4Q6E A;  3B1B A;  4QTL A;  3M1J A;  2POW A;  5CAC A;  4K0T A;  1CNH A;  4K0Z A;  2ZNC A;  4RUZ A;  4KP5 A;  1UGA A;  2X7T A;  3KOK A;  1TTM A;  4E3D A;  5JQ0 A;  3R16 A;  4Q8Z A;  4YGK A;  3IBI A;  1TH9 A;  4N16 A;  5EH5 A;  4QJX A;  5SZ4 A;  2VVA X;  1CVA A;  5EH8 A;  1YO1 A;  1CVE A;  1XQ0 A;  1ZGF A;  1TG9 A;  1BNQ A;  1BN3 A;  2CBC A;  3IAI A;  2NN1 A;  3M2Y A;  4HU1 A;  1Z93 A;  3P58 A;  2NXT A;  4PQ7 A;  4XFW A;  5EHV A;  4ZWY A;  12CA A;  2POU A;  5AMG A;  2WD3 A;  3EFI A;  5FLO A;  4X5S A;  4KNM A;  1LG6 A;  3F7U A;  5FNM A;  3RG4 A;  3W6I A;  3RYX B;  1MOO A;  4RUY A;  1G0E A;  2F14 A;  3OKV A;  3PJJ A;  1CIM A;  1HED A;  4ITP A;  4ITO A;  3W6H A;  5BNL A;  3D9Z A;  3P44 A;  4G0C A;  5G0C A;  5JES B;  4K13 A;  3DD0 A;  3P55 A;  4MLT A;  4E4A A;  4CQ0 A;  2NXR A;  5DSK A;  4PYY A;  2EZ7 A;  5EZT X;  1HUH A;  1CZM A;  4HEZ A;  4Q06 A;  4HT2 A;  1FLJ A;  3NJ9 A;  1CNJ A;  4E3G A;  3JXG A;  3DVC A;  2WD2 A;  1JV0 A;  1FQM A;  3RYZ A;  1CAO A;  1XEG A;  3CA2 A;  4HF3 A;  4KNJ A;  3MNH A;  5EHE A;  5FLQ A;  1CA3 A;  4QJW A;  4WR7 A;  1G6V A;  1FSR A;  1KOQ A;  3T84 A;  3SBI A;  3CZV A;  1AZM A;  1ZFQ A;  2HD6 A;  3OYQ A;  4E3H A;  3MYQ A;  3P3J A;  5BRW A;  3RYV B;  4MDL A;  3RYJ B;  4YXU A;  5E2K A;  3UYQ A;  4KP8 A;  1FR4 A;  1IF5 A;  4Q78 A;  2NWZ A;  3MHL A;  3M04 A;  5JGS B;  1FQL A;  2X7S A;  4HT0 A;  3UYN A;  3DAZ A;  5EIJ A;  3HKQ A;  3N0N A;  4QK3 A;  1TBT X;  4FIK A;  2OSF A;  1IF8 A;  3M1K A;  1KEQ A;  4Z1J A;  3T5Z A;  1DMX A;  4YX4 A;  1KOP A;  1ZSC A;  5E2M A;  5FL6 A;  1CVF A;  3JXH C;  3JXF A;  3U3A X;  1G45 A;  2HL4 A;  3GZ0 A;  2FW4 A;  4HEW A;  4XIX A;  2GD8 A;  3S75 B;  7CA2 A;  4MO8 A;  4LP6 A;  4BF6 A;  1CNG A;  3PO6 A;  5DSI A;  1LUG A;  2FOQ A;  5E2N A;  2QOA A;  1EOU A;  3D93 A;  1T9N A;  3NI5 A;  1CRM A;  5EOI A;  3D8W A;  1Y7W A;  4JS6 A;  3IBU A;  4Q6D A;  1G3Z A;  5C8I A;  4IDR X;  5FNI A;  3K7K A;  8CA2 A;  4Q49 A;  3OKU A;  3T5U A;  2WEH A;  3S97 A;  1BNN A;  4Q7S A;  5E2S A;  5BRV A;  3M3X A;  4C3T A;  2WEO A;  4JSA A;  4ZWI A;  3FE4 A;  3M2Z A;  3P3H A;  4Z1K A;  3B4F A;  4Q07 A;  3QYK A;  5L6K A;  3T85 A;  5DRS A;  5JEG B;  4Q87 A;  3DCW A;  3ZNC A;  4XIW A;  4BF1 A;  3SBH A;  1HEB A;  3S78 B;  1H4N A;  4WUQ A;  2QP6 A;  1CAZ A;  4MTY A;  4QJM A;  4QK2 A;  4M2R A;  1FQN A;  3V2J A;  4ETQ C;  3N3J A;  1RAY A;  4Q09 A;  3IBL A;  2CA2 A;  1CAN A;  4KUY A;  1OKL A;  5FDI A;  4MLX A;  3V3F A;  3DD8 A;  1CAM A;  3IBN A;  1ZFK A;  2NWO A;  4N0X B;  3M1W A;  2Q1Q A;  1JD0 A;  3D92 A;  4PYX A;  3S71 B;  1RJ6 A;  4COQ A;  5L3O A;  5JQT A;  5DSN A;  3M40 A;  1Z9Y A;  1CNC A;  4Q9Y A;  3RZ5 A;  4BCW A;  1F2W A;  4E9O X;  1CAY A;  1BNW A;  2ABE A;  4YGF A;  5JG3 B;  4FPT A;  2GEH A;  4QSJ A;  3L14 A;  1TB0 X;  5SZ7 A;  3KIG A;  5FNL A;  3VBD A;  9CA2 A;  4Q8Y A;  3MNA A;  1YDC A;  4IWZ A;  5DOH A;  1BZM A;  3RYY A;  3M5S A;  1I9L A;  5LMD A;  1YDD A;  4DZ7 A;  3U47 A;  4JSW A;  3V3I B;  3ZP9 A;  5FNH A;  1CNY A;  3KLD B;  4QY3 A;  1CA2 A;  3TVO X;  4QIY A;  3MHO A;  3S72 B;  5EH7 A;  2QO8 A;  3P5L A;  5HPJ A;  1LZV A;  3DC3 A;  3MZC A;  2HNC A;  1IF4 A;  1ZE8 A;  5E5U A;  1ZNC A;  3U7C A;  5BRU A;  1BIC A;  1THK A;  3MHM A;  2WEJ A;  3MNJ A;  1CVH A;  5SZ0 A;  1OQ5 A;  2FNN A;  4XE1 A;  5FL4 A;  1G54 A;  1AVN A;  4CNW A;  3KNE A;  1FSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...