1G3GA

Nmr structure of the fha1 domain of yeast rad53
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
164
structure length
164
Chain Sequence
GENITQPTQQSTQATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the FHA1 domain of yeast Rad53 and identification of binding sites for both FHA1 and its target protein Rad9
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords PROTIEN KINASE SPK1
total genus 19
structure length 164
sequence length 164
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1g3gA00
3I6WA 3POAA 1QU5A 2CSWA 2PIEA 3I6UA 3HUFA 4D9VA 2AFFA 3I0NA 1FHQA 2JPEA 1FHRA 1J4QA 3UOTA 3ELSA 2G1LA 1K3JA 2XT9B 1WLNA 2JQLA 3HX1A 3UN0A 1J4KA 4JONA 1J4LA 4EJQA 3ELVA 3VA4A 5A8IA 2KB4A 4H87A 2BRFA 4A0EA 1UJXA 2KKLA 1K2MA 1K2NA 2W3OA 5DJOA 4EGXA 3UNNA 1YJ5C 2JQIA 1MZKA 1LGPA 2FF4A 3KT9A 1GXCA 3VA1A 1UHTA 1G3GA 3OUNA 1WV3A 3UMZA 1K3QA 3VPYA 4G2SA 2JKDA 4QCJA 1LGQA 1DMZA 3GQSA 2EH0A 2LC1A 3FM8A 1R21A 2A0TA 3PO8A 1J4OA 1G6GA 2JQJA 1K3NA 3HUEA 3I0MA 3MDBA 5E50A 3UNMA 1YJMA 2FEZA 2KB3A 2KFUA 1J4PA 3UV0A
chains in the Genus database with same CATH superfamily
1KHXA 3I6WA 3POAA 1MJSA 2PIEA 3I6UA 3HUFA 3S40A 3I0NA 1U0TA 2JPEA 2I2BA 1Y3HA 1J4LA 1Z0SA 4EJQA 5DHPA 5EJHA 3VA4A 5JEOA 2BRFA 1UJXA 3GMJA 2I2FA 2W3OA 5DHSA 3V8PA 5DHUA 2FF4A 3KT9A 3V7UA 1K3QA 5BVIA 2I2CA 2JKDA 1LGQA 3FM8A 5JEKA 3PO8A 1K3NA 2JQJA 2I2DA 3MDBA 3UNMA 2Q5FA 5JEJA 2KFUA 1J4PA 1U7VB 3VZBA 3UV0A 3VZDA 1KHUA 1QU5A 4D9VA 5DHQA 1J4QA 4L02A 3UOTA 1K3JA 2I2AA 1WLNA 2XT9B 3UN0A 1U7FB 4JONA 2KB4A 4H87A 1K2MA 4A0EA 1DEVA 1K2NA 3V8MA 5JELA 5JERA 5JEMA 3VPYA 1YT5A 1U0RA 1R21A 2A0TA 1J4OA 1G6GA 1MR1A 5E50A 5EJGA 3V8QA 2KB3A 1U7FA 3VZCA 2CSWA 1YGSA 2QVLA 3A77A 1FHQA 2AN1A 4A4YA 3ELSA 2G1LA 3HX1A 2I29A 1G88A 2QV7A 4KU0D 3V7WA 5A8IA 1Z0ZA 5C4VA 2KKLA 5DJOA 3UNNA 1YJ5C 1MZKA 3VA1A 1UHTA 3UMZA 1WV3A 4G2SA 1U7VA 4QCJA 3PFNA 4R9PA 5DHRA 2I1WA 3T5PA 1SUWA 3HUEA 3I0MA 1YJMA 2BONA 1ZOQA 3V8RA 2AFFA 4JIWD 1Z0UA 1FHRA 2P1RA 2JGRA 5DHTA 2JQLA 1MK2A 1J4KA 3ELVA 3DITA 5EJIA 4EGXA 2JQIA 4DY6A 4WRRA 1QWTA 1LGPA 4V24A 1GXCA 3DSHA 1DD1A 1G3GA 3OUNA 2XXSA 4HAOA 3V8NA 1DMZA 3GQSA 2EH0A 2LC1A 3AFOA 3V80A 5EJFA 4WERA 3V7YA 1Y3IA 1J2FA 2FEZA 4JIVD
chains in the Genus database with same CATH topology
1KHXA 3I6WA 3POAA 1MJSA 2PIEA 3I6UA 3HUFA 3S40A 3I0NA 2JPEA 4EJQA 5JEOA 1J4LA 3VA4A 2BRFA 1UJXA 3GMJA 2W3OA 2FF4A 3KT9A 1K3QA 5BVIA 2JKDA 1LGQA 3FM8A 5JEKA 3PO8A 1K3NA 2JQJA 3MDBA 3UNMA 5JEJA 2KFUA 1J4PA 1U7VB 3VZBA 3UV0A 3VZDA 1KHUA 1QU5A 4D9VA 1J4QA 4L02A 3UOTA 1K3JA 2XT9B 1WLNA 3UN0A 1U7FB 4JONA 2KB4A 4H87A 1K2MA 4A0EA 1DEVA 1K2NA 5JELA 5JERA 5JEMA 3VPYA 1R21A 2A0TA 1J4OA 1G6GA 1MR1A 5E50A 2KB3A 1U7FA 3VZCA 2CSWA 1YGSA 2QVLA 3A77A 1FHQA 4A4YA 3ELSA 2G1LA 3HX1A 2QV7A 1G88A 4KU0D 5A8IA 5C4VA 2KKLA 5DJOA 3UNNA 1YJ5C 1MZKA 3VA1A 1UHTA 3UMZA 1WV3A 4G2SA 1U7VA 4QCJA 4R9PA 3T5PA 3HUEA 3I0MA 1YJMA 2BONA 1ZOQA 2AFFA 4JIWD 1FHRA 2P1RA 2JGRA 2JQLA 1MK2A 1J4KA 3ELVA 3DITA 4EGXA 2JQIA 4WRRA 1QWTA 1LGPA 4V24A 1GXCA 3DSHA 1DD1A 1G3GA 3OUNA 2XXSA 1DMZA 3GQSA 2EH0A 2LC1A 4WERA 1J2FA 2FEZA 4JIVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6W A;  3POA A;  1QU5 A;  2CSW A;  2PIE A;  3I6U A;  3HUF A;  4D9V A;  2AFF A;  3I0N A;  1FHQ A;  2JPE A;  1FHR A;  1J4Q A;  3UOT A;  3ELS A;  2G1L A;  1K3J A;  2XT9 B;  1WLN A;  2JQL A;  3HX1 A;  3UN0 A;  1J4K A;  4JON A;  1J4L A;  4EJQ A;  3ELV A;  3VA4 A;  5A8I A;  2KB4 A;  4H87 A;  2BRF A;  4A0E A;  1UJX A;  2KKL A;  1K2M A;  1K2N A;  2W3O A;  5DJO A;  4EGX A;  3UNN A;  1YJ5 C;  2JQI A;  1MZK A;  1LGP A;  2FF4 A;  3KT9 A;  1GXC A;  3VA1 A;  1UHT A;  1G3G A;  3OUN A;  1WV3 A;  3UMZ A;  1K3Q A;  3VPY A;  4G2S A;  2JKD A;  4QCJ A;  1LGQ A;  1DMZ A;  3GQS A;  2EH0 A;  2LC1 A;  3FM8 A;  1R21 A;  2A0T A;  3PO8 A;  1J4O A;  1G6G A;  2JQJ A;  1K3N A;  3HUE A;  3I0M A;  3MDB A;  5E50 A;  3UNM A;  1YJM A;  2FEZ A;  2KB3 A;  2KFU A;  1J4P A;  3UV0 A; 
#chains in the Genus database with same CATH topology
 1KHX A;  3I6W A;  3POA A;  1MJS A;  2PIE A;  3I6U A;  3HUF A;  3S40 A;  3I0N A;  1U0T A;  2JPE A;  2I2B A;  1Y3H A;  1J4L A;  1Z0S A;  4EJQ A;  5DHP A;  5EJH A;  3VA4 A;  5JEO A;  2BRF A;  1UJX A;  3GMJ A;  2I2F A;  2W3O A;  5DHS A;  3V8P A;  5DHU A;  2FF4 A;  3KT9 A;  3V7U A;  1K3Q A;  5BVI A;  2I2C A;  2JKD A;  1LGQ A;  3FM8 A;  5JEK A;  3PO8 A;  1K3N A;  2JQJ A;  2I2D A;  3MDB A;  3UNM A;  2Q5F A;  5JEJ A;  2KFU A;  1J4P A;  1U7V B;  3VZB A;  3UV0 A;  3VZD A;  1KHU A;  1QU5 A;  4D9V A;  5DHQ A;  1J4Q A;  4L02 A;  3UOT A;  1K3J A;  2I2A A;  1WLN A;  2XT9 B;  3UN0 A;  1U7F B;  4JON A;  2KB4 A;  4H87 A;  1K2M A;  4A0E A;  1DEV A;  1K2N A;  3V8M A;  5JEL A;  5JER A;  5JEM A;  3VPY A;  1YT5 A;  1U0R A;  1R21 A;  2A0T A;  1J4O A;  1G6G A;  1MR1 A;  5E50 A;  5EJG A;  3V8Q A;  2KB3 A;  1U7F A;  3VZC A;  2CSW A;  1YGS A;  2QVL A;  3A77 A;  1FHQ A;  2AN1 A;  4A4Y A;  3ELS A;  2G1L A;  3HX1 A;  2I29 A;  1G88 A;  2QV7 A;  4KU0 D;  3V7W A;  5A8I A;  1Z0Z A;  5C4V A;  2KKL A;  5DJO A;  3UNN A;  1YJ5 C;  1MZK A;  3VA1 A;  1UHT A;  3UMZ A;  1WV3 A;  4G2S A;  1U7V A;  4QCJ A;  3PFN A;  4R9P A;  5DHR A;  2I1W A;  3T5P A;  1SUW A;  3HUE A;  3I0M A;  1YJM A;  2BON A;  1ZOQ A;  3V8R A;  2AFF A;  4JIW D;  1Z0U A;  1FHR A;  2P1R A;  2JGR A;  5DHT A;  2JQL A;  1MK2 A;  1J4K A;  3ELV A;  3DIT A;  5EJI A;  4EGX A;  2JQI A;  4DY6 A;  4WRR A;  1QWT A;  1LGP A;  4V24 A;  1GXC A;  3DSH A;  1DD1 A;  1G3G A;  3OUN A;  2XXS A;  4HAO A;  3V8N A;  1DMZ A;  3GQS A;  2EH0 A;  2LC1 A;  3AFO A;  3V80 A;  5EJF A;  4WER A;  3V7Y A;  1Y3I A;  1J2F A;  2FEZ A;  4JIV D; 
#chains in the Genus database with same CATH homology
 1KHX A;  3I6W A;  3POA A;  1MJS A;  2PIE A;  3I6U A;  3HUF A;  3S40 A;  3I0N A;  2JPE A;  4EJQ A;  5JEO A;  1J4L A;  3VA4 A;  2BRF A;  1UJX A;  3GMJ A;  2W3O A;  2FF4 A;  3KT9 A;  1K3Q A;  5BVI A;  2JKD A;  1LGQ A;  3FM8 A;  5JEK A;  3PO8 A;  1K3N A;  2JQJ A;  3MDB A;  3UNM A;  5JEJ A;  2KFU A;  1J4P A;  1U7V B;  3VZB A;  3UV0 A;  3VZD A;  1KHU A;  1QU5 A;  4D9V A;  1J4Q A;  4L02 A;  3UOT A;  1K3J A;  2XT9 B;  1WLN A;  3UN0 A;  1U7F B;  4JON A;  2KB4 A;  4H87 A;  1K2M A;  4A0E A;  1DEV A;  1K2N A;  5JEL A;  5JER A;  5JEM A;  3VPY A;  1R21 A;  2A0T A;  1J4O A;  1G6G A;  1MR1 A;  5E50 A;  2KB3 A;  1U7F A;  3VZC A;  2CSW A;  1YGS A;  2QVL A;  3A77 A;  1FHQ A;  4A4Y A;  3ELS A;  2G1L A;  3HX1 A;  2QV7 A;  1G88 A;  4KU0 D;  5A8I A;  5C4V A;  2KKL A;  5DJO A;  3UNN A;  1YJ5 C;  1MZK A;  3VA1 A;  1UHT A;  3UMZ A;  1WV3 A;  4G2S A;  1U7V A;  4QCJ A;  4R9P A;  3T5P A;  3HUE A;  3I0M A;  1YJM A;  2BON A;  1ZOQ A;  2AFF A;  4JIW D;  1FHR A;  2P1R A;  2JGR A;  2JQL A;  1MK2 A;  1J4K A;  3ELV A;  3DIT A;  4EGX A;  2JQI A;  4WRR A;  1QWT A;  1LGP A;  4V24 A;  1GXC A;  3DSH A;  1DD1 A;  1G3G A;  3OUN A;  2XXS A;  1DMZ A;  3GQS A;  2EH0 A;  2LC1 A;  4WER A;  1J2F A;  2FEZ A;  4JIV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...