1J2FA

X-ray crystal structure of irf-3 and its functional implications
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
226
Chain Sequence
NPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of IRF-3 and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Interferon regulatory factor 3
total genus 61
structure length 226
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10401 IRF-3 Interferon-regulatory factor 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.10 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1j2fA00
1U7VA 5JERA 1ZOQA 4R9PA 5JEMA 1QWTA 5JEKA 1U7VB 1U7FB 1MR1A 1KHUA 5JEOA 1U7FA 1DD1A 1DEVA 5JELA 3DSHA 1G88A 5BVIA 1YGSA 3DITA 5JEJA 1MK2A 1MJSA 1J2FA 1KHXA 5C4VA 3A77A 3GMJA
chains in the Genus database with same CATH superfamily
1K2NA 1U7VA 3I6WA 5JERA 2I2CA 2JQLA 4R9PA 2QVLA 4JIWD 2FEZA 4H87A 5DHRA 5JEKA 1U7FB 2JKDA 1GXCA 1J4QA 1SUWA 4WRRA 3V8MA 2AN1A 4L02A 3UMZA 1J4OA 1MZKA 1K2MA 1YT5A 5BVIA 4G2SA 2FF4A 3V7YA 1FHQA 3DITA 5E50A 1J4KA 3OUNA 2I29A 1Z0SA 3PO8A 2BRFA 3I0NA 1FHRA 3HUFA 1WV3A 1Z0UA 5JEMA 1K3QA 3I6UA 1QWTA 1Y3IA 2PIEA 2JGRA 4JONA 5DHSA 3V7WA 1R21A 3UV0A 5A8IA 5JEOA 3GQSA 2KB3A 3VA4A 4A0EA 2I2BA 3VZBA 1G6GA 3V8RA 5JELA 5EJHA 2G1LA 2I2DA 2XXSA 1U0TA 3HUEA 4V24A 5EJIA 1G3GA 1MJSA 5EJGA 1KHXA 1Y3HA 2JPEA 3V80A 3GMJA 4D9VA 4DY6A 1YJ5C 3ELVA 3FM8A 3POAA 2I2FA 2JQIA 1YJMA 3T5PA 1U7VB 4HAOA 1MR1A 4JIVD 1KHUA 3I0MA 3VA1A 1U7FA 2AFFA 3HX1A 1J4LA 3MDBA 3V8NA 3VZDA 5EJFA 3DSHA 4KU0D 1G88A 3UN0A 1YGSA 2KKLA 1K3JA 4EJQA 5C4VA 4A4YA 2A0TA 2KFUA 5DHUA 1LGQA 4QCJA 1QU5A 3UNMA 4EGXA 1ZOQA 3ELSA 3KT9A 3UOTA 1K3NA 2P1RA 5DHPA 5DHTA 1DMZA 1UHTA 3S40A 2I1WA 1J4PA 2KB4A 3V8QA 2I2AA 3V8PA 1DD1A 2W3OA 1DEVA 2BONA 2Q5FA 3PFNA 2XT9B 1Z0ZA 3UNNA 5DHQA 3VZCA 1LGPA 5JEJA 1MK2A 2LC1A 1U0RA 3V7UA 1UJXA 1J2FA 1WLNA 2JQJA 2EH0A 5DJOA 3A77A 2CSWA 2QV7A 4WERA 3AFOA 3VPYA
chains in the Genus database with same CATH topology
1K2NA 1U7VA 3I6WA 5JERA 2JQLA 4R9PA 2QVLA 4JIWD 2FEZA 4H87A 5JEKA 1U7FB 2JKDA 1GXCA 1J4QA 4WRRA 4L02A 3UMZA 1J4OA 1MZKA 1K2MA 5BVIA 4G2SA 2FF4A 1FHQA 3DITA 5E50A 1J4KA 3OUNA 3PO8A 2BRFA 3I0NA 1FHRA 3HUFA 1WV3A 5JEMA 1K3QA 3I6UA 1QWTA 2PIEA 2JGRA 4JONA 1R21A 3UV0A 5A8IA 5JEOA 3GQSA 2KB3A 3VA4A 4A0EA 3VZBA 1G6GA 5JELA 2G1LA 2XXSA 3HUEA 4V24A 1G3GA 1MJSA 1KHXA 2JPEA 3GMJA 4D9VA 1YJ5C 3ELVA 3FM8A 3POAA 2JQIA 1YJMA 3T5PA 1U7VB 1MR1A 4JIVD 1KHUA 3I0MA 3VA1A 1U7FA 2AFFA 3HX1A 1J4LA 3MDBA 3VZDA 3DSHA 4KU0D 1G88A 3UN0A 1YGSA 2KKLA 1K3JA 4EJQA 5C4VA 4A4YA 2A0TA 2KFUA 1LGQA 4QCJA 1QU5A 3UNMA 4EGXA 1ZOQA 3ELSA 3KT9A 3UOTA 1K3NA 2P1RA 1DMZA 1UHTA 3S40A 1J4PA 2KB4A 1DD1A 2W3OA 1DEVA 2BONA 2XT9B 3UNNA 3VZCA 1LGPA 5JEJA 1MK2A 2LC1A 1UJXA 1J2FA 1WLNA 2JQJA 2EH0A 5DJOA 3A77A 2CSWA 2QV7A 4WERA 3VPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7V A;  5JER A;  1ZOQ A;  4R9P A;  5JEM A;  1QWT A;  5JEK A;  1U7V B;  1U7F B;  1MR1 A;  1KHU A;  5JEO A;  1U7F A;  1DD1 A;  1DEV A;  5JEL A;  3DSH A;  1G88 A;  5BVI A;  1YGS A;  3DIT A;  5JEJ A;  1MK2 A;  1MJS A;  1J2F A;  1KHX A;  5C4V A;  3A77 A;  3GMJ A; 
#chains in the Genus database with same CATH topology
 1K2N A;  1U7V A;  3I6W A;  5JER A;  2I2C A;  2JQL A;  4R9P A;  2QVL A;  4JIW D;  2FEZ A;  4H87 A;  5DHR A;  5JEK A;  1U7F B;  2JKD A;  1GXC A;  1J4Q A;  1SUW A;  4WRR A;  3V8M A;  2AN1 A;  4L02 A;  3UMZ A;  1J4O A;  1MZK A;  1K2M A;  1YT5 A;  5BVI A;  4G2S A;  2FF4 A;  3V7Y A;  1FHQ A;  3DIT A;  5E50 A;  1J4K A;  3OUN A;  2I29 A;  1Z0S A;  3PO8 A;  2BRF A;  3I0N A;  1FHR A;  3HUF A;  1WV3 A;  1Z0U A;  5JEM A;  1K3Q A;  3I6U A;  1QWT A;  1Y3I A;  2PIE A;  2JGR A;  4JON A;  5DHS A;  3V7W A;  1R21 A;  3UV0 A;  5A8I A;  5JEO A;  3GQS A;  2KB3 A;  3VA4 A;  4A0E A;  2I2B A;  3VZB A;  1G6G A;  3V8R A;  5JEL A;  5EJH A;  2G1L A;  2I2D A;  2XXS A;  1U0T A;  3HUE A;  4V24 A;  5EJI A;  1G3G A;  1MJS A;  5EJG A;  1KHX A;  1Y3H A;  2JPE A;  3V80 A;  3GMJ A;  4D9V A;  4DY6 A;  1YJ5 C;  3ELV A;  3FM8 A;  3POA A;  2I2F A;  2JQI A;  1YJM A;  3T5P A;  1U7V B;  4HAO A;  1MR1 A;  4JIV D;  1KHU A;  3I0M A;  3VA1 A;  1U7F A;  2AFF A;  3HX1 A;  1J4L A;  3MDB A;  3V8N A;  3VZD A;  5EJF A;  3DSH A;  4KU0 D;  1G88 A;  3UN0 A;  1YGS A;  2KKL A;  1K3J A;  4EJQ A;  5C4V A;  4A4Y A;  2A0T A;  2KFU A;  5DHU A;  1LGQ A;  4QCJ A;  1QU5 A;  3UNM A;  4EGX A;  1ZOQ A;  3ELS A;  3KT9 A;  3UOT A;  1K3N A;  2P1R A;  5DHP A;  5DHT A;  1DMZ A;  1UHT A;  3S40 A;  2I1W A;  1J4P A;  2KB4 A;  3V8Q A;  2I2A A;  3V8P A;  1DD1 A;  2W3O A;  1DEV A;  2BON A;  2Q5F A;  3PFN A;  2XT9 B;  1Z0Z A;  3UNN A;  5DHQ A;  3VZC A;  1LGP A;  5JEJ A;  1MK2 A;  2LC1 A;  1U0R A;  3V7U A;  1UJX A;  1J2F A;  1WLN A;  2JQJ A;  2EH0 A;  5DJO A;  3A77 A;  2CSW A;  2QV7 A;  4WER A;  3AFO A;  3VPY A; 
#chains in the Genus database with same CATH homology
 1K2N A;  1U7V A;  3I6W A;  5JER A;  2JQL A;  4R9P A;  2QVL A;  4JIW D;  2FEZ A;  4H87 A;  5JEK A;  1U7F B;  2JKD A;  1GXC A;  1J4Q A;  4WRR A;  4L02 A;  3UMZ A;  1J4O A;  1MZK A;  1K2M A;  5BVI A;  4G2S A;  2FF4 A;  1FHQ A;  3DIT A;  5E50 A;  1J4K A;  3OUN A;  3PO8 A;  2BRF A;  3I0N A;  1FHR A;  3HUF A;  1WV3 A;  5JEM A;  1K3Q A;  3I6U A;  1QWT A;  2PIE A;  2JGR A;  4JON A;  1R21 A;  3UV0 A;  5A8I A;  5JEO A;  3GQS A;  2KB3 A;  3VA4 A;  4A0E A;  3VZB A;  1G6G A;  5JEL A;  2G1L A;  2XXS A;  3HUE A;  4V24 A;  1G3G A;  1MJS A;  1KHX A;  2JPE A;  3GMJ A;  4D9V A;  1YJ5 C;  3ELV A;  3FM8 A;  3POA A;  2JQI A;  1YJM A;  3T5P A;  1U7V B;  1MR1 A;  4JIV D;  1KHU A;  3I0M A;  3VA1 A;  1U7F A;  2AFF A;  3HX1 A;  1J4L A;  3MDB A;  3VZD A;  3DSH A;  4KU0 D;  1G88 A;  3UN0 A;  1YGS A;  2KKL A;  1K3J A;  4EJQ A;  5C4V A;  4A4Y A;  2A0T A;  2KFU A;  1LGQ A;  4QCJ A;  1QU5 A;  3UNM A;  4EGX A;  1ZOQ A;  3ELS A;  3KT9 A;  3UOT A;  1K3N A;  2P1R A;  1DMZ A;  1UHT A;  3S40 A;  1J4P A;  2KB4 A;  1DD1 A;  2W3O A;  1DEV A;  2BON A;  2XT9 B;  3UNN A;  3VZC A;  1LGP A;  5JEJ A;  1MK2 A;  2LC1 A;  1UJX A;  1J2F A;  1WLN A;  2JQJ A;  2EH0 A;  5DJO A;  3A77 A;  2CSW A;  2QV7 A;  4WER A;  3VPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...