4WRRA

A putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
293
Chain Sequence
b'KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVSNNIDAEEKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative diacylglycerol kinase
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 81
structure length 293
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 4wrrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4wrrA01
3S40A 2QV7A 4DY6A 2P1RA 5DHRA 3V8RA 2Q5FA 5EJFA 3V7UA 3V8QA 2AN1A 3T5PA 1YT5A 4WRRA 3V7WA 1Z0UA 1U0RA 5DHPA 3V8PA 2I2FA 2QVLA 1U0TA 5DHQA 2I29A 4V24A 1Z0ZA 3V8NA 3V80A 3V7YA 2I2AA 2I2DA 2I2BA 5DHSA 2BONA 2I1WA 3V8MA 1Y3IA 2JGRA 4L02A 1Y3HA 3VZBA 5EJIA 5DHUA 3VZDA 4HAOA 3VZCA 5DHTA 1Z0SA 3PFNA 5EJGA 1SUWA 4WERA 2I2CA
chains in the Genus database with same CATH superfamily
3KJNA 2XQKA 3QUSA 3K1YA 4F3YA 1NDQA 4AY5A 4EW1A 3DW1X 4ZEXA 2CLSA 4K8RB 3BMNA 4EL0A 3DAPA 3C8ZA 1U1DA 2AW5A 1U0FA 4MGKR 5E9WA 4CKCB 2II6A 5BVHA 2WWGA 2P4EA 3A6GA 1LPAB 3MCVA 3BE4A 4GSKA 4AN0A 4KR6A 5AXAA 4WESA 2OBBA 4QDTA 4GUAA 4R41A 3NT2A 2DHEA 3BIOA 3LRXA 5JEEA 1BHO1 3JQ9C 2XDQB 3OA2A 4J0HA 4X5OA 3THRA 3FYUA 4CHTA 1Q1NA 1U1EA 3OE1A 1KBZA 2OCPA 1LDBA 2XD4A 4M37A 3NZEA 5D84A 4FN4A 1I9GA 4Y1EA 3U7QB 1XL1A 5JZOA 3ADOA 4TS4A 2VJAA 5AH0A 1VCMA 2BWJA 2VXYA 3DQPA 5TGDA 5F7XA 1H4TA 1VL2A 1K2VN 1WEKA 4G0UA 1JDUA 3IERA 2WTXA 1QNLA 1U4OA 1YQ9A 3DPIA 2QQ5A 1UJBA 5AVKA 5CM8B 2ZZMA 1KHTA 1A8HA 3IC5A 2CMHA 3HV0A 3Q9LA 2XXBA 1FXSA 1H8HA 4J7CA 4XARA 1TO6A 5L7YA 1HQKA 1GLGA 1EUQA 4KACA 4WUVA 1Q12A 2BFEB 3ONNA 3K6JA 4HRYA 2O3RA 2DMRA 1A7UA 1IN7A 1E94E 2HMAA 2PXAA 1W0CA 3F6EX 4IQ4A 4XJSA 3VR3D 3X44A 2H48A 3EVDA 4KLAA 1EDZA 4NJMB 3GFSA 3PUYA 2FP4A 1XEWY 2JBAA 2OT3B 2FEZA 1QDLB 2W2MA 3N76A 4GEKA 4TX1A 2ZRPA 2DWPA 3E1GA 1PFVA 1ABBA 3UW1A 4F60A 2IVZA 4C0AC 4E5UA 4MKHA 4NHEA 1JB1A 2AH5A 1VIAA 3STTA 2JANA 3ZWQA 3E58A 3ED5A 3WRXA 2AJCA 1SULA 3ETCA 3SHTA 1GEEA 4MOWA 5LIPA 4JVSB 3DCNA 3C3EA 1M76A 1VKJA 1Z35A 4OQXA 4QC2A 3SZ3A 3NS7A 4OLJA 1ORTA 1LVUA 1M1NA 3EVEA 1ZUD1 4GC9A 1JKXA 1YC5A 1H1TA 1MNAA 1A1VA 1QRTA 3W3AA 4KQGA 3DKIA 4C1BA 1QF9A 1DBRA 2FR8C 2YWGA 4RW0A 1NW5A 1SR8A 4MV7A 3DE1X 2BR5A 4HQOA 5K0LA 2VPZA 2Q0HA 4PCLA 1EYZA 5EUCA 3UXMA 4F2GA 4BO3A 5LXTB 4P7KA 3SF8B 1OYWA 4JNKA 1P1CA 4H4DA 1RQNA 3WO0A 4KIUA 3SFZA 1G42A 3ENVA 1ZL0A 3ODGA 3U4CA 1DIAA 4IZ6A 2VATA 4RGVA 1KBQA 4YMHA 3IEIA 2W42A 5KO2A 2QTLA 1FQKA 1ORVA 2JEYA 3O47A 4PSKA 5FYQA 3L0YA 5DN6D 3KYCA 1BW9A 3UAGA 1OILA 2XMZA 4GP7A 1KI6A 1HV8A 2J5RA 3FHJA 3T5TA 2GESA 2LKCA 4Q4JB 5EA2A 1CQIB 2HO4A 2VDWB 4ERXA 1O0BA 1EUYA 1Z5GA 1CQZA 1XK7A 1O8CA 1T4GA 1IOWA 4FJ0A 3ICCA 4U2CA 3VNSA 4R3NA 5HJ2A 1K5DA 4DDTA 4EX7A 5KWSA 2FF7A 1JNYA 1G8KA 2YY7A 3D6MA 1TDJA 1JG1A 2PKWA 4QU9A 2C94A 3UA3A 3A25A 1O96B 4Y2UA 3BRQA 2DETA 1FTGA 4ISCA 3HFGA 1X9IA 3IB3A 1NBMA 4NONA 1U5CA 4S0ZA 1N2JA 4C4YA 2VBIA 3MWEA 4TLEA 4QBGB 1AT1A 3LKBA 4TZKA 3W5CA 4CQMA 4IRUB 2X8LA 3DMGA 4ATNA 4RMGA 1AV7A 4RTQA 3IV7A 5EKDA 5KYTA 3C3DA 4EJSC 1G3IA 3QKTA 1EMDA 7ADHA 4WRRA 1RJGA 4BWFB 1AURA 3U09A 1TUGA 4R6XA 1DLJA 2GNPA 1TMOA 5EWLA 1G21B 4LTMA 4GMKA 2VHCA 4L4ZA 3UN1A 4BFCA 4MCAA 2CHFA 1BS1A 1DKUA 3B78A 3IOEA 1A96A 2ZUEA 3VNBA 3UPDA 3LQYA 1BQ3A 1GTMA 1BMTA 1KBOA 5DX1A 2PQMA 4RKWA 2J7PA 5BQXA 2VJMA 1TF7A 1DD1A 3GEDA 1DQSA 1Y5MA 3FCOA 2GYWA 4J29A 3KZ1E 3RFFA 2J31A 4GHWA 2Q46A 2XYPA 5K8VA 4N0DA 2G04A 2WT9A 1V8BA 3TBHA 3QUQA 2PN1A 2CNWA 5B7NA 2G8LA 1KNQA 4RK4A 1AGYA 4PYLA 1JL3A 4YJGB 3TZ6A 4JHXA 2GJ9A 2EDAA 1KGDA 5FUQA 4HH0A 2GZHA 5ALUA 1TVKB 3OURA 1UKBA 1J25A 1TUBA 2OOSA 4X66B 3K94A 3MWDA 3ABQB 1TU0A 2VNJA 2YUTA 1RQLA 4Y2XA 4B2YA 1OVMA 2OL4A 4Q3AA 1O94A 1QYDA 1DWPA 5REQA 1JALA 4IAOA 3JR3A 2I3GA 2G7ZA 2OCBA 1QH8A 4UUNA 2WUEA 5SYNA 4ZWNA 1DX9A 3NM5A 3ZD9A 4O2BB 4A9AA 3NJRA 2VNKA 1CQXA 2OG2A 4UUMA 4CLHA 1NBWB 3O5AA 5L6LB 1C5KA 2B8WA 2X0EA 4J1NA 1UBGA 2FPRA 2IYSA 1JT9A 2IEIA 2GB4A 2JFZA 2Q8QA 5AW4A 1EUCA 5KWIA 2OV3A 3WLLA 3U4QB 3OF2A 1Z2CA 4JQYA 2E37A 2GPBA 2VH1A 2O8CB 2V4UA 2H8KA 1H3FA 1VLVA 4ZDWA 4BAUA 1E6CA 5HRCA 2VCYA 1C29B 1LB1B 1ST3A 2EJWA 5EMJA 4AJLA 3WIBA 2PXXA 2V7TA 4I66A 3ZBPA 2X0DA 2ROQA 1BWRA 1P9WA 1NZFA 4G5QA 2JGKA 1T9HA 1A3CA 4JYMA 4U3JA 5K3BA 4KBFA 4JCCA 4U7GA 2CT8A 1A9XA 2DHQA 2O1WA 2J3IA 4FSHA 1TK9A 4UBKA 4YRTA 4GRDA 4RDIA 3IALA 3OUZA 1HE8B 3B6KA 4Z4HA 4OHRA 1CR1A 4FFBA 1CE8B 2G17A 2JEZA 2KBEA 1Y8QB 2AF3C 1BE6A 1F60A 1NOJA 4LGMA 3BAZA 4NBSA 4U5XA 2D8MA 4ZAFA 5CCEA 5IUNC 3MJSA 1T2AA 5IM4A 1I4EB 2W2OA 1NX6A 2VHXA 2GPWA 2VUSA 3QE0A 3RTGA 4BX9A 5BSHA 1K89A 1R4NA 1CJSA 3L9XA 3PPWA 4AURA 4JT8A 3W05A 2OUKA 5JCPA 4NE2A 3HEBA 4E03A 4LVCA 4F6CA 2PA0A 2JVIA 1QRRA 4A0QA 2DUMA 3VR5H 4BGEA 4Q01A 1FLNA 5J2TA 3WMGA 5A02A 3K0FA 1SCBA 1UJ4A 1F0KA 2FCRA 3EVTA 4FIDA 3U3JA 3W0LB 1AMOA 4AY6A 3NPMA 4R71A 1NQWA 4X90A 4BNKA 1D2NA 3VDRA 1SUPA 2R1TB 3TNFA 3JQRA 5IG2A 1AXGA 2FNAA 5FUXA 5JSFA 3PNQA 2IEZA 5TGTA 4EF4A 3K9CA 5BW4A 4DA9A 4GKAA 1ZSYA 2PWYA 1CIJA 3KVRA 3LF1A 2FZEA 4B80A 2P79A 2VTBB 4QTYA 4EFKA 1O9HA 5CM2Z 4CN8A 1E2HA 4V38A 1ZFNA 1MPTA 2EP8A 1MJNA 2HB6A 2JEOA 3DVSX 3LZDA 3PNVA 2NUBA 4IG9A 4PW0A 5GONF 2BGLA 3TR5A 3HJNA 2IXDA 5JEKA 1P1FA 4PYMA 1Z4LA 3IOMA 4GIBA 4PU0A 3ELUA 2VSQA 2FSUA 4JYBA 2IPLA 3T7SA 4B2LA 2OBNA 3OH8A 3T1TA 1T36A 4YUYA 1UDRA 1VSUA 3T3HA 4OFXA 3AETA 4EK9A 2CB0A 4M9QA 4G5OA 5CAEA 2QG6A 2Y9MB 2X15A 5HKKD 2Q3BA 4RANA 3VTFA 1N32B 2XMSA 5LYJF 4E94A 1N7HA 4F4CA 1KS2A 4B3CA 2PWBA 2ZR7A 1X74A 3PUXA 1VGRA 4XR4A 1I9CA 2XIJA 4PO1A 1EFPB 4A91A 1RWVA 5BNFA 4BQPA 3DDHA 3FPJA 2NUPB 2V96A 3Q88A 4HX5A 4LDAA 4X7BA 4ZU6X 1BGWA 3M6MD 3PI7A 2JCXA 3P9RA 3QPBA 4IOLA 3TPCA 4L08A 4BMVA 1YNOA 4K1XA 2OXIA 3VMFA 5DEIA 2W0MA 5JAOA 5JNSA 4K28A 2FEOA 1J7JA 1J97A 3LOQA 1XVLA 3B52X 1PR6A 4F4JA 2V7EA 3ZOZA 2Q0XA 1NU8A 2JI7A 3I1IA 2HFKA 3ESAA 3N39C 3OWOA 5DH9A 3I72A 2KS6A 2C2KA 3AWIA 1KPHA 2GCGA 3RG8A 4C7MA 4DIBA 4EG3A 1GAXA 4JLWA 3ZZNA 3CX7A 3Q6IA 1EGVB 1LBEA 5KQPA 2D0OB 2Q7DA 2FEAA 3BCHA 2B8JA 3GLKA 3COWA 1H9CA 5JUWA 2HX1A 2Q21A 1R6UA 1SUAA 2ENUA 3QXCA 4LZAA 4LY3A 2YJ3A 5I5GA 1WXDA 4PHFA 4C7VA 4F6RA 2J1LA 4HZUA 3MTAA 4NXMB 1OX5A 2OYSA 3T9BA 2EWVA 5DN6A 3TN7A 3IP5A 2F00A 2RAUA 1TEHA 2CJFA 1VCOA 4QPZA 5DNUA 2X0JA 1P0FA 2P4QA 3FBWA 1HFWA 3H2SA 4O2AF 3A2MA 3I6WA 3DCJA 5DKFA 1C0IA 3TJMA 2IS1A 3GQSA 2GPSA 1YK0A 3WYGA 5I9MA 3S27A 4RPIA 4RAOA 4OYLA 1C80A 5F12A 4KK4A 2QVLA 3QA9A 2GD1O 3OFND 4JZYA 2GHQA 1E4EA 5ADHA 4ZYXA 5FO0A 1WWKA 4MQ5A 4I5IA 5JAPA 5LMZA 2JLWA 3SQWA 4OJNA 2ZAIA 4C6TB 1M0TA 4EGSA 4V0KA 2ISSD 4J3NA 1T2NA 2QORA 3GXBA 2ZRNA 4JKOA 1J49A 5E6UA 1KOLA 2UUCB 3L6EA 1R7RA 5DYYA 2DM6A 1T2DA 3L77A 1NR7A 4AUEA 2XUKA 1XPOA 4R6WA 3UB2A 4F92B 3LUDA 3IVAA 4G9EA 3GJRA 1GNRA 1DKNA 1NONA 4NFHA 4DMRA 1G3RA 3DOUA 3B51X 4ESEA 2ZRQA 3U39A 4Y2VA 1JEJA 2FPPA 5EMHA 4AKSA 1ZD9A 4RTNA 1T9GR 1QS0B 2JLXA 2PT9A 4R0NA 3UJ8A 4TYNA 1MH1A 1SMKA 3P4UA 1C0PA 4Q9NA 1CR2A 1UJNA 1Q7RA 2I2WA 2IDZA 4INZA 4YN3A 5TSDA 3VH2A 1JEQA 3RYCA 3D43A 1XF1A 2C2WA 1PW5A 5T4BA 3G8CA 1IG0A 2RARA 5H8WA 3S70A 3ZNOA 1NYQA 4X63A 2NU6A 1WXWA 5D86A 2XZOA 3S2EA 2CF5A 1XA4A 2YYZA 3DNMA 5BRJA 3NBKA 4OHOA 1A9OA 1TMYA 2BHNA 2FWRA 3HPRA 3HNPA 3LHDA 3C3YA 4GX1A 4LRSB 2PX8A 4QTXA 1DLIA 4MVJG 2R7NA 3AIIA 3I09A 4UHKA 5LQCA 2XTZA 3CVJA 1SKAA 2H5JA 1DP4A 3QKRA 4BCBA 3FY4A 1XAJA 3IBSA 3K53A 1NHGA 1E2LA 3LUKA 3PL1A 4EY4A 5J63A 3KZNA 2DSNA 1HE5A 1MEJA 2ZU0C 4F3RA 2YYSA 1DKMA 1VMEA 4DR2B 4NZPA 1OXXK 4HGPA 3QBJA 4GOLD 4JZKA 4WKBA 2O5VA 2OORA 3BQ9A 3EGWA 1CRZA 3LOUA 3L5OA 5E2BA 3WLEA 3U26A 4F11A 5T7BA 1E9BA 3T99A 4JJKA 3AUFA 3H2IA 3IQWA 3VOBA 2OXFA 4GMXA 4UTNA 3JQQA 2HU8A 1NUQA 2WYHA 3BPSA 3HWRA 3ZVRA 1U0OC 2FPSA 3ANTA 3JQDA 4DQUA 1N33B 1GCIA 1RYYA 2EGGA 2OZEA 5FNVA 3ZCTA 1J4PA 1W9HA 4L3VA 1ACJA 1R21A 4IICA 3ICQB 2EJBA 5I3CA 2CCKA 1L8LA 1XELA 4GGMX 4ZCMA 2DPMA 3C3AA 2J7KA 4V3CA 4EI9A 4XIJA 2HMVA 1QIGA 1J7KA 1E9DA 4YHHB 2L82A 5FV4A 4J0JA 3WDSA 3STUA 3TK1A 2V5VA 2B2CA 2HSZA 3EBOA 4IDNA 1FC0A 1OZGA 3VTAA 1PR5A 1BIFA 1VI2A 1E8MA 3C6ZA 1J9GA 3G02A 3LF2A 4IUDS 4LDQA 1HH4A 4M0LA 4OHPA 3AVUA 5DNDA 3DDSA 2YWHA 1T4CB 3QEJA 4WCVA 4DSUA 621PA 5LKRA 4LNUB 2CKMA 4IS3A 2QVBA 1QORA 1J21A 3SEQA 5LXTF 5TPZD 4CFZA 4KGVA 4J90A 2XB8A 3BHNA 1ABFA 1VMDA 1YCHA 4J2OA 3RAFC 3IODA 3D64A 4MI9A 1WCWA 4Q6BA 1CUYA 1Z2NX 3F1KA 1D2HA 3QVWA 4BMNA 1YZQA 1NW4A 1XRMA 3MEQA 4OA5A 5GPBA 3FHTA 4N18A 5LN1A 5AHOA 5FI3A 3D8RA 2FDXA 2R44A 1T29A 1T2FA 5JSKA 1KZHA 1WSAA 4GZ6A 2IUUA 1N2CA 2WG0A 3G5UA 4R0MA 1B0AA 3LK6A 4KYVA 1NYLA 2WAOA 2PX6A 1GUYA 2H2DA 1H23A 1LC0A 1IHXA 2PZKA 3C70A 3KP1A 4IBOA 3QU9A 4RHCA 3TINA 2WLTA 3U3RA 4CWAA 4Z7QB 1F8FA 1T0PA 3K5HA 1DC3A 4M36A 1GPH1 2OC4A 3CCCA 3DMNA 5HVNA 1FNCA 5JPDA 1RC1A 2GZ3A 2OK8A 4OQFA 4ZAZA 5A06A 2PD3A 3VKVA 2RG7A 1JLMA 1NZJA 2B82A 3NG1A 4UM7A 1SIUA 2DYKA 2ZYHA 4V0SA 1E0AA 3WLIA 2VSYA 4P4LA 1ULZA 2H2AA 1ZCZA 3AW9A 1C7RA 4YCCA 1J5PA 4WHMA 3FGOA 1KFCB 3DE0X 3QITA 4REMA 3A1DA 4KUEA 1EX9A 2GYUA 4IV8A 1Z39A 4Z0NA 3USCS 4B0PA 4CLOA 1YR9A 2AFIA 3H2ZA 4EA7A 2QE6A 3B89A 2Y1DA 1ODSA 1M74A 1E1KA 3NVDA 4W1QA 3D3WB 1F5SA 5EXPA 1XG5A 2I7XA 4EVRA 5MDHA 4J1TA 1DEAA 3CMCO 2FE4A 3LFTA 4WDRA 3PJEA 1M67A 5HKKA 4OHZA 2H16A 2GXQA 3EVNA 4Q03A 2AC4A 2EW2A 5A4AA 2D7DA 1QPBA 4X54A 3OY2A 2JPEA 4Q9LA 1E9FA 3E7XA 3LL7A 5LDDC 4EPWA 3ROKA 4JFAA 1ZJ5A 3A9VA 5F3WB 2BEVA 2AI1A 4G23A 2B8NA 4IIHA 4G0QA 5BMVA 2ZXUA 4A0RA 1J9ZA 1UFOA 3F71A 3PFGA 4EX6A 4NJEB 4P4GA 5C1BA 1HLPA 4FE3A 2VQFB 5ISMA 4J9VA 2VDPB 3OTQA 3K4HA 2BM8A 5IS2A 3ZDXB 4XUCA 3HL4A 1S2OA 1PR1A 1HTBA 1YQQA 5EZ6B 2N9UA 4J0GA 2FWIA 2R6JA 3NTRA 1B16A 3RYFA 3AY3A 5J5AA 4MGEA 5BSFA 2RD2A 3ZGZA 2I7CA 3ELDA 3BD6A 2JFXA 3PPXA 2GEBA 1CJKC 3OP4A 2X0KA 1KIAA 2ZULA 4M22A 4Q4DA 4I19A 4PSVA 4ZOAA 1M66A 3VU8A 2G4VA 4R54A 2FW9A 5I9SA 4O2BF 2ZIXA 4X64B 2A1IA 2W2TA 1CX9B 2ZUDA 2P68A 1AQYA 3GGJA 5CCDA 1KMHB 1IXYA 4X94A 2ZQ5A 1F20A 2N1BA 2NXWA 2X3UA 5KYUA 1CFJA 1V5FA 4OM8A 5TMEA 1T6XA 3DEHA 3H3FA 4FM9A 1Q77A 1ICEA 2OCGA 2YNMD 2P65A 2AG8A 2HSGA 2WLSA 1NURA 5T6BA 1UXHA 3B3QA 3GJ0A 3HJCA 3M6WA 4KRFA 4MWOA 2GF2A 1ZWLA 1MFPA 2EBFX 1UBMS 3LDHA 2WD7B 4JMPA 4QU8A 4RHXA 3NC0C 1JEYB 4MVJE 4BEVA 4H0CA 3PJDA 4QUBA 3VHXB 1A98A 1JAXA 3NDJA 1MOZA 3I01M 4KLZA 4HADA 2ZRDA 1UEJA 3HDQA 3OBBA 4KFSA 5L3ZA 2AA3A 1C4XA 1IIRA 2OHFA 3PVCA 3H04A 5B3JA 2PKRA 3HWWA 1R6BX 4CKYA 1NOKA 3GAAA 3LHSA 5ELLA 6REQB 1ML4A 2FJPA 4JD5A 2ZBRA 1KNXA 5C8DA 4ZIRA 2A5JA 2C8LA 2ORIA 3NOQA 3OPYA 1K5GA 3BFKA 2CSWA 1HLDA 3RUCA 3HO8A 1Z7WA 4ZQHA 1UKCA 2ETVA 4HZGA 2OGSA 1QGYA 4I46A 5KUTA 5I4BA 1W46A 1WW3A 2APJA 1SG9A 2WD8A 4P38A 1DFHA 1G0OA 2D1SA 3PTAA 4CHGA 1FP7A 3PC8C 1UMBB 4LC0A 2AG5A 3C3WA 1CIVA 3ASVA 1RXUA 2X6QA 3OEYA 2HQRA 5CJ2A 1ZS9A 2X42A 2WM3A 3A1SA 3VJMA 2H1IA 3ROPA 1YZLA 2YQ4A 1FUKA 1GITA 2COUA 3RJZA 1EA7A 3EGCA 1NVDA 3G2KA 2JAXA 5DK4A 3TW8B 1NVWQ 5A9RA 3AF4A 3HI4A 1ZIPA 3V00A 1QLJA 3MTGA 4W9NA 5EZSA 2RHWA 4YPVA 3O9ZA 4QBKA 2XE8A 2IPMA 3D4NA 3H2JA 4DTIA 1WUIS 4EY5A 1T5HX 1XV5A 4CMIB 1FUYB 2Z8YM 4DN6A 5H3CA 1T1IA 1NLFA 2HF8A 2XBMA 2XMGA 3AHIA 2DQZA 1X19A 3UVEA 1UPBA 2HCRA 3V2IA 2NYUA 5G3ZA 5JXJA 4DARA 4TM8A 1BN7A 2G1KA 5JAQA 1W59A 1DCTA 4WXHA 2FFBA 1PZNA 5G0SA 4OHFA 5E50A 4RV5A 3S2IA 2ZB8A 2DPLA 3I0MA 2J5KA 2VPWA 3DL7A 4LJRA 4LHXA 1M2EA 2IYVA 4HAZA 1Z0ZA 1W5EA 3EZGA 2C2XA 3HCFA 3MT7A 1ICIA 2ZRKA 4ZANA 4Y6OA 2DUWA 4ND7A 4JA2A 1QQ5A 3JASB 1JKMA 3NKFA 2C2OA 5DLQC 3E48A 1XMQB 1KJJA 2JRCA 4DCNA 4ZFNA 3GUUA 3D7SA 2I33A 1OJLA 4FGUA 1J8VA 4UFNA 3GB9A 2XUIA 2HXGA 3JAKA 3BWDD 3PRJA 4I4TB 5ICSA 2QD2A 1HK7A 1M2WA 4XX0A 2OCAA 3K5PA 3PITA 5EHZA 2Z43A 1FZQA 1DHTA 3FDZB 1KJ9A 3FF4A 3L8DA 1LJ8A 3RO7A 3UA4A 4ETNA 4ZYWA 1PEYA 1YQUA 3U61B 2J9FA 4JUDX 1ZBDA 5HA5A 1AXRA 2WKQA 3EIHA 4IWXA 3N75A 4BGUA 4DBLE 1K5PA 1OGJA 1M5TA 5JEMA 1VDZA 2BKLA 2WIAA 4L78A 1FXWF 5HIJA 1G3UA 4NC9A 3RABA 1P0CA 4N5NA 4HQFA 1Z07A 3DNPA 3UMSA 4CKXA 1YSCA 2HDNB 3SN6A 4CM1A 2BMEA 3O6VA 4EUNA 3RUHA 1Z7GA 1JHQA 1DQYA 4GKBA 5TPZA 2EW8A 3WKEA 4UPVA 4XLZA 2AEFA 4JLNA 5EQFA 1SCAA 2VTEA 3TDKA 3L5KA 3HA3A 3QU2A 1Z6GA 1FRZA 2H2WA 1EGAA 1ZRNA 1C4KA 1PJLA 3K9BA 5JD3A 4TQGA 1BRMA 2C00A 4UTZA 2WAMA 3H1BA 4H59A 3O1JC 4G97A 4UBIA 4IV5A 4YMIA 4BV9A 1E8DA 1Q0TA 1MZPA 2VNHA 3M1AA 3IT0A 4BV2A 3VU1A 5EE5B 2WILA 5T8KA 4N82A 1M34B 2OG1A 2RKBA 3B5IA 4I36A 4JLUA 1HNXB 5IAOA 2V54A 3KJIA 1TW2A 4HLNA 2VK4A 1JAIA 3TI7A 4PG8A 3A04A 2HIAA 2FWMX 4TL6A 1G38A 2IPAB 4A6EA 1SB9A 3M81A 4CJXA 2A58A 2R86A 2O8EB 4LMAA 3UB3A 1E1YA 4HX2A 2PH7A 3RSSA 3H9GA 1EDEA 5F52A 3K4PA 3T5AA 1QQBA 1R2QA 3WLSA 5GJBA 2DFVA 1J2UA 4OUDA 3VPSA 4FW8A 1U2DA 1X1TA 2OBFA 3R20A 4JT4A 1PFGA 1L4UA 3CISA 3D9QX 3OOEA 3MGBA 1QFJA 2YHBA 1F3OA 1CJMA 4DA8A 2DQ4A 4FKMA 4YYEA 5BR1A 4BDSA 2EL9A 2HQ1A 2NU9B 2I2BA 3QEKA 1M1YA 4FLEA 3N3BC 3NT4A 4A4DA 1MGOA 3CEJA 2G06A 3KB8A 3BWBA 4E14A 3I6UA 3IEMA 1X1QA 4INPA 3UAOA 3J7AC 3LUHA 2IL1A 2G63A 5K3AA 2C97A 1BWSA 3EUEA 3EGEA 2PRIA 4MJLA 4FD3A 2XT9B 7ABPA 4MQFB 5AR1A 1U2ZA 2A1UA 3PFBA 1MT0A 1FDRA 2Q5FA 1SIOA 3KYJB 1CLUA 1Q0PA 2DH5A 4FT4A 3FKJA 1N5LA 1Z0IA 3PEEA 5EHQA 2YWJA 3L3BA 3W5AA 3OQ1A 2RJOA 4G1CA 2AUNA 4L5IA 4XXHA 5AHXA 1DRWA 4QNRA 1JG7A 5K6RA 2HR1A 4FOOA 3WLJA 1ZN9A 4ZOQI 1NNI1 4B9EA 1F9EA 5C5EA 4I99A 1T2EA 1F8XA 2JARA 2LCIA 3ESCA 3A4TA 2E4XA 1VIYA 1BTOA 1XEXA 2H3HA 1RMTA 4RO0A 3RREA 3WWOA 3QJYA 3WWEA 4FDUA 3L0OA 4YREA 3CE6A 1P75A 2X7XA 5FADA 3V33A 1UXJA 3CY6A 4NU0A 4GOXA 2XF2A 3IUMA 1UOQA 1XHEA 1P9RA 5AM0A 2G1LA 1WKVA 1RWPA 4NTZA 3DEJA 1XRRA 1Z6TA 3F6YA 3FDIA 3KKOA 1FEZA 2HGSA 3CWQA 2XGGA 2QWXA 1IY2A 5CFMA 1FFXB 1ISHA 1LTKA 3GN2A 1OFIA 1NF3A 1E92A 4QGGA 2P91A 4D6PA 4M98A 3MAGA 2NVUA 3MA0A 3HMKA 4M2LA 1EWTA 4IXTA 3W6UA 3UB4A 1WIWA 1X38A 2YNMA 2GJAA 4IDGA 2GEKA 1I8TA 3OTIA 2OO5C 2A9PA 1G20B 4IDDA 4QNNA 3ZHYA 4HNGA 4F4UA 1Q83A 2YY5A 5JNUA 3JD1A 3TR0A 1ACMA 3NUGA 1S1CA 1IY9A 3BL6A 1MAVA 1W85B 1X39A 2B25A 4XRGA 3OFJA 4JC4A 2DP4E 2VO1A 3M5WA 3GLGB 1JJIA 2VAWA 2ZLBA 4HFJA 4B48A 5B7QA 1ISJA 5HF8A 1TA0A 2O6HA 1B8OA 1U1IA 1WP4A 1FW8A 2NV2B 1N0VC 4XCVA 5MN5A 1Q22A 4RXTA 2ZRMA 5IYZB 2ZVPX 1GPBA 1GRQA 3PFCA 4MS3B 5HZHA 2XOEA 2CJPA 4TKVA 1X7YA 1FU7A 4DLUA 2RGRA 3D0OA 1D5WA 1NIPA 2IYRA 2O50A 1E6LA 3G1TA 2DFTA 1QH9A 1SCNE 2H3EA 2ZIVB 1R9JA 3I32A 2YFYA 3AV3A 1CD5A 3F74A 2A0KA 4ZI2A 2XTNA 1UPAA 3UWMA 8AT1A 1FJXA 1E1RD 5BXQC 3U4MA 3K0CC 4DPKA 4JBHA 3HZZA 5K0ZA 4EB3A 3TLEA 3LHIA 3LXUX 1EI9A 4RK5A 1NBME 4YWHA 3V48A 1IWPB 4IDHA 3EYAA 3KQOA 3M1LA 4WIAA 4RQBA 2DXIA 4ENPA 4C88A 1F38A 3X2EA 5BQ3A 5KSZA 5CDUA 1BA3A 5FOTA 3OQJA 2QR5A 4Q05A 4C21A 1U7XA 1NSYA 4D8WA 2R0QC 3GROA 4TXHA 3JWIA 1T1GA 3C0KA 4XYMA 2ZTHA 4L8WB 1C7JA 5EKXA 2ZJ8A 1PG5A 3W8EA 2O05A 2IIBA 1K4MA 4M1WA 4DRXB 5JNLA 4EFMA 1U1CA 4WLOA 5FTMA 1L3IA 3I9KA 1GFWA 3P52A 3P2EA 5H80A 3ZDCA 2BP7B 2YINC 3Q3GE 3O9MA 3WGIA 5D1HA 3VX4A 4XCXA 4F4HA 2ADFA 2Z8ZA 1EQ2A 3KR9A 5EPOA 4NZNA 4QBFA 1RAIA 4CE6A 1GT6A 1XVAA 3GF4A 4B7ZA 1RYEA 5ECWA 2UUOA 1N3LA 4BNHA 2F62A 1DUSA 5A4JA 3E82A 2C7VA 3WHIA 3HP1A 1WW8A 2B7CA 3G7UA 3HVUA 1F3LA 5HQJA 3B85A 3ZI4A 4PANA 3NHUA 3AI2A 2PJUA 4CTMA 1Y5LA 1NUTA 2V9CA 3AOGA 3FG9A 3KWJA 1IY8A 4U0KA 3TUIC 2PUAA 2SCUB 1NKVA 3P0RA 1ZM9A 1VDMA 3QMPA 2R60A 1J2JA 1ZISA 1YZTA 1P0PA 5DRYA 1P9OA 3GJSA 4PYNA 1ESZA 1E2PA 1T4MA 1T0HB 5KNDD 1YQEA 1J8FA 2JDIA 2MYTA 3AR8A 3HDYA 3N8HA 3MF4A 2VEOA 1R5OA 1NN5A 4MDFA 1YI0A 4Q4HA 2NU8A 3NALA 2QZPA 1CW2B 3TLYA 1XEAA 5IN5A 5AVXA 4Q9KA 2IOFA 5BYBA 4L85A 1BXRB 1QHNA 1C4WA 4Q19A 1HXHA 2H2GA 1JAHA 2JFWA 2QTCA 1RHRA 1IONA 1ZIYA 4TWRA 4Y9DA 3PIDA 4HGNA 4QPJC 4CIVA 4CTOA 3WKDA 4DREA 1TRHA 5C1DA 2HEGA 2X8WA 3TZKA 1K3QA 2Z2ZA 2CN1A 3LY5A 1ENYA 2CY0A 2H9AA 3NTQA 4K46A 3K70B 3HO6A 4XJVA 4Y9TA 1UP4A 1YU6A 2NZVG 2R6R1 4QD3A 3WIUA 2D1QA 5AW2A 1YO6A 4O5OA 4RHTA 3RW9A 2ZFUA 3C8DA 3WWZA 1GILA 3A4YA 4NF2A 1FTSA 3RPEA 4RD0A 3RYHA 3MW8A 4QQFA 1G8YA 4H1HA 1CUVA 2BSXA 1HORA 4RLQA 4C4OA 2NTJA 4DG8A 2ZM6B 4PPNA 2EFCB 3HXKA 4KWHA 3AEQB 4I1UA 5A6SB 3DW3X 2AJ8A 2YR0A 1ADGA 3FYSA 4HXFB 4UU7A 5CIQA 3PXUA 1HYQA 1NN1A 4NV0A 4Y6RA 4DIOA 4JI4B 4IHKA 4TVOA 3SOPA 3RVDA 2RC6A 3D8NA 3QYFA 3ISJA 3TEFA 5K6AA 3ZVKA 1ZVQA 4EB8A 4POAA 2ZCJA 1SB8A 4WZAB 3DF9A 2A67A 2AYXA 3OZ7A 2X8JA 4Q48A 2WUWE 1GNSA 1KI1A 1R6DA 1AQIA 3WK7A 4HOYA 1QMGA 3D5QA 4LIPD 4RMIA 4CMEA 2H4YA 2PRJA 2WWWA 4J4BA 1G5TA 5I7HA 1W94A 4UEQA 1HNNA 4LJ9A 4CFSA 1MG0A 4AZ0B 1XIVA 5CEFA 3L2OB 3SOZA 2H5IA 4MIOA 5K8IA 2YFHA 1POXA 3EXHB 5JTTA 4YCAA 4ND1A 4A2PA 5BMOA 3VM6A 1YXMA 4OK5A 3T1YB 4FGZA 3SVLA 1T5DX 3BCUA 3GHYA 4GVPA 3SVTA 2J3QA 2D06A 2JGMA 2P75A 2D59A 4UXJA 5TE9A 1P5HA 4JI7B 1ECFA 2PYZA 1KIFA 1NP3A 1TFRA 2PLFA 4HVTA 4W99A 5EP3A 5B3AA 2QPAA 5T64A 3KSZO 4AZSA 1FUEA 2WWTA 3MMNA 3NV7A 2IE8A 4GRAA 3NW9A 4PG4A 4QELA 1G6HA 1VJRA 5DYGA 3RK0A 1RBYA 4BVFA 1JIXA 3UW3A 5FWXB 1S02A 1VKRA 2FJ0A 2Z4TA 3IQGX 4ZVKA 3M2PA 4Y98A 2X9LA 3NIFB 2Y67A 1IEXA 4JOSA 3OIFA 2Y1OA 3C3BA 2VR1A 5BNTA 3ACCA 3PFFA 5JERA 3WZLA 4JL5A 3ZGLA 1NJFA 2M1ZA 5AJHA 1Q92A 5GVRA 4X7RA 1MO3A 2P2SA 1T3SA 1YZNA 3DV0A 4HATA 3IESA 4OXYA 4PX3A 1G8HA 1ZONA 5TIIA 1J1UA 3Q6NA 2JKYA 1W4LA 2AOTA 3YASA 3SKXA 3T54A 1CUSA 4UHDA 3L6DA 3KEFA 4HNUA 4L51A 4E15A 3H5NA 5EJIA 1VIDA 3X43A 4AW9A 3BMCA 4GYYA 4IOJA 5DYNA 2A5GA 2PSHA 3MCTA 4GX2A 5TX7A 4G0OA 4QRIA 4MMYB 3HSKA 3VGJA 5KPJA 3ZWWA 2FK7A 2DCMA 1PS0A 2Q49A 3UF0A 1K7FB 1GDTA 1DXQA 4KQXA 4PGAA 3VNQA 1GJRA 1PGOA 3HKBB 1LLCA 3LP5A 1N4AA 3VISA 4Q9DA 4I4TF 4Q39A 1KAQA 4FEAA 4AKHA 3O82A 4J91A 1BEZA 4D4HA 3W5VA 4CEJA 2C9MA 4IIYA 1I7SB 2WFLB 1UZAA 3W8NA 1N1EA 3S28A 2F3QA 3CQ9A 3AKEA 1L5RA 3DDCA 3FA2A 3SBXA 5FO1A 4M0KA 3CUYA 4JELA 3N6XA 1SUEA 4IQFA 3AEUA 2O6LA 2QDXA 4EP1A 4RM2A 2B3DA 2RCNA 5A2GA 1JQDA 1SN7A 2JQIA 4QXMA 3VYUB 3UJAA 3GRAA 2JJ2D 2VDKB 4D4MA 4FTWA 3RBZA 2ZOSA 3RKRA 5KPDA 5HKOA 4P7JA 5SICE 3ZZMA 1E5LA 2GEFA 4PZUA 1GNVA 3LUBA 3F6BX 1SBIA 2AOUB 1P80A 1GNLA 2A30A 3BE6A 1Z16A 3MJEA 3VU9B 1V35A 1Q0SA 1M1ZA 3L7AA 4EMUA 3NEAA 2BZSA 2YBDA 3DVRX 1E1RA 4LV5B 5EL0A 3ZDBA 4D79A 1GKUB 1RR6A 1DXHA 1C8KA 1H1LA 1Z8HA 3HCNA 1B41A 3FETA 3QBDA 1XZJA 4YRIA 1PK8A 5ALEA 2IY9A 2WMDA 4XM0A 4G65A 3U1BA 3V55A 3QXGA 2PUWA 1KI8A 5GGYA 3ZDRA 1WLNA 4HP8A 2KM1A 3A11A 3MPOA 4DV1B 4Q7MB 3GBPA 1T9BA 1KQFA 3O4VA 1GZSA 2C78A 2C5BA 2PKXA 4TQ9A 5TARA 1G8SA 3P71T 1IOLA 3N8GA 4AWAA 3R24A 6AT1A 1V26A 5FOVA 4R0VA 2O5CA 3PPIA 1KQNA 4DC0A 1XMIA 3HV2A 1UDWA 2XVAA 4HDAA 4KO2S 3V4OA 4CM8A 2BTQB 1WSDA 3ZVNA 4H6VA 2B8EA 1JBKA 1XALA 5AI4A 3TTYA 4LYDA 5ILGA 2JCVA 3FPAA 2CL7X 3GG2A 3LDUA 1OXMA 1KJYA 2J32A 1GYRA 2Q45A 2XOKD 3B2EA 3LNTA 3V80A 2QLBA 4A82A 4ZDIA 5DSTA 4IZIA 2EL7A 2C0PA 3LUFA 4AICA 3SXPA 1R8XA 1JS1X 3JQFC 1C0KA 2W2KB 4QPCA 4TTTS 1Z0DA 2M6SA 1ZXXA 2RFLA 3DUFA 1W19A 1XVUA 3B6IA 4OAQA 3COPA 4IXMA 4X93A 2B1IA 5DCYA 4J16C 4NZMA 2AEEA 3BYZA 3H7AA 4U7WA 5BPHA 1GPKA 3CJTA 1HG0A 2BMFA 2Z1MA 1Y4SA 2WAYA 5FOXA 1P4JA 1P5FA 2HYDA 2EFGA 3GMTA 2AKYA 2W6NA 1PYOA 5J1TB 2O52A 2PMKA 5HFAA 2I76A 5KNDA 4OXNA 4MWZA 1LK5A 4RTKA 3OPQA 3A3KA 5JHHB 1X87A 2VG8A 3DMDA 2FZ5A 4C30A 3I62A 1OQAA 3H75A 3QH4A 3EC1A 4WBXC 1NQ5A 2HGZA 4HQ0A 3N0XA 5G1PA 4KDCA 4J6FA 4MWSA 4LJ8A 5JJBA 4IOMA 3VO1A 1KYZA 3L7IA 1NNEA 4NLLA 1ZY2A 2MSDB 1XXHB 3NB0A 2ERXA 1H4SA 2XE4A 4Y2GA 4EHKA 2EQBA 2JLSA 4PR3A 1FJ2A 4GGOA 3VUFA 4P35A 2NU7B 1DV1A 3Q8MA 1P9LA 4F9FA 3FPSA 1ZC4A 2VF5X 3WRVA 2QSUA 4TLAA 4C0LA 4F5DA 1UBOS 3AVPA 2AJTA 5IT5A 3RFCA 1XZNA 4MWDA 4YCSA 4JFRA 1XWFA 5DGCA 1PHPA 4QVIA 2RK4A 4OHUA 4YJ3A 4AZ3A 1U7WA 1V8PA 4XD7D 1X77A 2IBMA 3PEWA 1FRFS 1XFDA 2YZNA 2G77B 3B60A 2RH5A 3JQAD 4FYXA 4HYTA 5IKOA 3CT6A 4BJ1A 3B8EA 1QP7A 2IIVA 5IANA 3AB7A 4WFJA 4X6YA 3OESA 1JFFA 2A59A 3CF4G 4FFDA 1LI5A 2WUGA 3M82A 3JS5A 3D8SA 4O4LA 1XVVA 3BGDA 1A8QA 1WZEA 4H7FA 4P84A 1GGKA 1VLZA 5FNZA 4DJFC 1NUUA 3KOZA 4BNNA 1S2NA 1SVNA 2P6UA 3KZOA 4Q3BA 3RQIA 1K4YA 3C4VA 2Q4DA 1YRAA 3RWMB 1NQUA 4QGHA 1XTVA 1SC9A 2ZDQA 3CLRC 1GYQA 3IKVA 4WCFA 3TAXA 5HZKA 1GGMA 1UK8A 3CF0A 5DASA 4FFPA 3R5XA 4HDMA 1K0UA 1E9AA 1S8AA 1Z2OX 2AR9A 2IEAA 1GZUA 3A8TA 2VQ6A 3HR4A 4TWZA 1LJUA 2CDRA 5IYZF 1K2MA 1PL8A 1N2CE 2EKDA 2C8VA 2RG1A 4G2SA 1XROA 3DFIA 1LRKA 1WUYA 3M4NA 1DFGA 1T1RA 3L0DA 4G07A 3UC5A 4YRBA 1QCZA 3UNMA 1UK6A 1NR5A 3P32A 1NA5A 1ECBA 4BXOA 3P94A 1F4VA 3MUFA 3CXRA 1W48A 2O54A 4EDFA 3ODPA 5I8PA 3ET5A 3QQPA 1FSPA 2NO6A 3U9LA 5HNKA 2BGJA 1ZR2A 4XDZA 3AW8A 3HACA 4UREA 2XWQA 3KETA 4RX1A 2XKJE 4PQFA 4J94A 2JBHA 3AU8A 1KYQA 3ZHUA 1Z0JA 1PD1A 3AUYA 1FUUA 5KQMA 3OPNA 4JGGA 3SZLA 3QE2A 4K6HA 1BHJA 1X1BA 2GCOA 1I4LD 1JR2A 1CF9A 4UAVA 1JFSA 5E9JA 3QLJA 3MOSA 1C9KA 3HDHA 3OE7D 3OLXA 1Z4IA 4BO0A 2AFIE 2IUYA 4W63A 2IYFA 1XN1A 3LWNA 3JALB 1DBPA 4ZV9A 1ULSA 4EA9A 5F7JA 4C4AA 1J8QA 4B4OA 3NTVA 1ONSA 3BDAA 4XJTA 2OCXA 4MMZB 1KVUA 2Z5LA 4B9AA 4MJ3A 1J0DA 1IOZA 1RI3A 2AN5A 3B3AA 3MC1A 3DHNA 4TKUB 2WJPA 1UR5A 1TT5A 4TMKA 4UAUA 3PT5A 1O3YA 3RC2A 2A4MA 5IZCC 4BBPA 1OREA 2GJ4A 3UNXA 4EKDA 1MJGM 3A4IA 5EP4A 3S1LA 3H9EO 1KWKA 3OX1A 3K6RA 4X8LA 3COYA 4P32A 3A27A 4IHJA 4F7WA 1Q74A 1U0GA 3DB2A 4BQIA 4HEHA 2V58A 1F2VA 1FRNA 1P9NA 1TF2A 4BFWA 3OOYA 3L43A 1CFZA 2BGGA 3UMVA 4BJ3A 4ZMRA 1EK5A 1ULBA 3JQGA 5HDQA 5BRAA 4IQ8A 1NXOA 1GY8A 2DBVO 2P3OA 2WIGA 3DBRA 2FFRA 3IAS1 2F8MA 1W5BA 3LQFA 1K3TA 3G59A 4RA9B 4CPDA 3F90A 5I7VA 1H22A 4M8SA 2I5PO 2WMNB 3EC7A 5ENZA 3RROA 3ZK8A 3RRMA 3L6BA 3NANA 3CO5A 4DMFA 1PV4A 5U4QA 1PF7E 4K8OA 5E4FA 1RZRD 1UOOA 4UCWA 2GBLC 4FGLA 3MK31 4MVJP 4X84A 1HE2A 1THMA 3R6GA 1VKNA 2ECQA 3GDWA 1T6YA 3U7RA 3SSNA 5CW2A 2FEWB 1EGHA 1EZZA 4Q0MA 1O1YA 1K4KA 1RQRA 3CH6A 4AYWA 2J6CA 2HA7A 3LPMA 4MLCA 1SXGA 4TWIA 4C4RA 1RRFA 4F84A 1IWBB 4QYIA 1OXKB 4BUZA 2I4LA 1LRJA 2IXBA 3EXHC 1MRSA 3EDRA 4NPCA 3OQIB 2JJ2A 4N1AA 4NEQA 2WKPA 4B6RA 5FHRA 3PDUA 3L05A 1KP2A 2HV8A 3DM5A 4GM0A 2G0TA 4RMHA 2X8BA 5J4HA 2PUGA 1S5PA 3ZTTA 4KNYA 3P0HA 3LI2A 2A94A 4XLLA 5HZMA 2DWQA 2Q2NA 1YR8A 3V32A 1FFGA 2PT6A 2ZUBA 4C2AA 3IAXA 5DX0A 3MHTA 2J9GA 3V5NA 5ADUS 2CXOA 4OQNA 4CI0B 2V7UA 4X00A 1X70A 5EMKA 4ES6A 5FPPA 5KQRA 4R1UA 1CC1S 3WWCA 3EG9A 4HDKA 3KQVA 1GPWB 5AMXA 3FGZA 1BDMA 3CNHA 3N2GA 5AO9A 2F2TA 3LT1A 4QREA 4D81A 3U7GA 1YACA 2PA3A 5EZYB 4BO2A 1Y7HA 4LCEA 4HF7A 4CCYB 2PFSA 3DP7A 1EFCA 4OD0A 4U7TB 3N58A 3HJTA 1AQJA 3ET4A 3AG6A 3IAAA 3MWFA 5HGJA 4YI5A 5BVGA 1FSZA 2CV1A 2Q5EA 1XZQA 4QEKA 1VIMA 3COJA 2YN2A 1L7RA 1XTJA 2ZE7A 1TJ5A 4X92A 2CVFA 5DGXA 3Q4GA 2IX9A 4A6PA 2Z8YA 2G9VA 4QATA 3X1JA 3X3HA 1TM2A 2BJHA 4AJOA 1EPUA 1USKA 3MMZA 3THYB 3V2HA 1OZHA 2IK8A 1JHZA 2Z4RA 1QR2A 4EJMA 4R05A 1J8MF 2BFBB 4RIIA 1XT6A 1OBCA 3JARA 2ZIUB 3CG0A 3C7AA 2H07A 3H87A 3CUEF 3ZK9A 3UG6A 5LD2B 5KTRA 1XL0A 3Q2OA 2QKYA 2IA5A 3FPEA 5CDTA 3E3MA 2PFGA 1FMTA 4RD2A 5EIOA 5EOVA 2YVQA 4OYHA 4I9UA 4ND8A 3H8SA 3WSWA 1KJNA 3KR2A 3EVBA 1JPUA 1XWWA 2P78A 3OA0A 1ZIDA 2ZK7A 4M9RA 5AM3A 3KRTA 1P3JA 1O7JA 4M0UA 4UMFA 1C2YA 2A9VA 1NUPA 1FFEA 3TSCA 3N87A 3CN9A 2XSZD 3KC2A 2QJRA 1V1MB 2ZT8A 3KHSA 5FTNA 3DFKA 4PWZA 4HNTA 5IKXA 1EFRA 5FR1A 2IYAA 3FSRA 3E23A 2Y1KA 1YJ5A 1CETA 1USUA 5K2OA 1D0VA 1RJDA 1DAGA 3E2MA 2CCJA 3DEKA 1N25A 3QUCA 1BXGB 2G5CA 1YUMA 5KVSA 3FOFC 1RLIA 2DLCX 1GXCA 5JSQA 2AX3A 4BWVA 3BORA 2OSBA 5KOYA 4EUEA 1JKJB 2QRJA 2XDQA 1L1FA 2LE0A 3MSCA 4QTUB 3CUVA 3EVCA 2BGWA 3SQNA 3OJOA 3JQ6A 4UTOA 1IN6A 2J09A 2CUKA 1F0NA 1CUUA 4ZQIA 4C0XA 4HVLA 1GFSA 2FHSA 2E7ZA 3HZRA 5SY9A 2BH9A 3V1LA 3ZCUA 1UJXA 3ZHCA 821PA 1QIEA 4LCBA 2RGNA 3ETJA 1GAQA 3N6RA 4XD7A 3KQHA 2HWYA 4UHCA 4XA8A 5D3MB 3TKYA 3IILA 4Z4QA 4JV5B 3JQAA 1RRKA 4LGVA 4IFIA 3OZRA 5IK2D 4R2LA 3E22B 1O6ZA 1Z0AA 2OFFA 2BFEA 1K3JA 1QP0A 1TJ4A 3EXFA 4KQFA 1FLVA 1NXXA 2IV2X 1PIWA 3ESZA 4ZCIA 1Y3IA 1BMFD 4HWRA 4S1TA 1EVIA 1AC5A 2NADA 3KALA 4LMBA 3AJRA 3SJZA 4DT1A 4COOA 1A8SA 5I8WA 3AOEC 4MTCA 2BFMA 3HN2A 1HDOA 1P91A 2G67A 2I7TA 3W79A 1OH7A 2H4ZA 4D43A 3MLBA 3ORHA 4NHOA 4KQHA 2UVQA 2P2CA 3ELVA 5DNAA 1JTFA 1JG2A 3WA6A 4A7PA 5FUMA 1YS1X 3UBMA 3EIOA 4HPJB 2B30A 3VC1A 4DB2A 1FYFA 1KDRA 1XKQA 2CLHB 5FFFA 5D3QA 1YAHA 2BHLA 4IDOA 2NQ2C 4B7CA 5J23A 3O75A 2HBYA 5D3ZA 2ZB7A 4AUNA 1P4SA 1D5CA 2NMVA 1U0JA 2GWHA 4KAXA 5E4JA 4ANFA 1TJ3A 1ZCFA 2F9FA 3CW2A 5E1DA 5LXTA 1COWD 4A2QA 3M49A 5M29A 3M9LA 4NMMA 2FSPA 3FLMA 4MW2A 1AH2A 3N0TA 3VVCA 5EVCA 4RH0A 5ALKA 3U7EB 3R4VA 4UCFA 1FYDA 5IPFA 5K4AA 2WTBA 1JG4A 3EIFA 1S2LA 3RM3A 2PBLA 3OE7A 2F8TA 3SBOA 2XGOA 2GETA 2XUZA 3UHFA 1U7OA 2HNKA 2AXNA 1VL6A 2BUCA 3KJZA 4UAGA 4DSNA 2Y0DA 1KEEA 1M1YE 4CVNA 2WY2D 1S2MA 2ZATA 3U3KA 4GF5A 4LI0A 4BNXA 1HZZC 1DAOA 1OXSC 3ZU4A 3IV9A 3D5TA 1IHPA 3HUDA 4QEZA 2W71A 3OMLA 3FROA 4ZVMA 1WMDA 4EYQA 3OWHA 3E1KA 4K9OA 3UH0A 3Q2KA 4UNPA 4FHZA 2EOAA 4S24A 3PCTA 2KHZA 2OBMA 2JJ1D 1I1QB 3A6ZA 1NBHA 3TGLA 2AR7A 2W2VA 5MGBA 2C3YA 2DFLA 3M5PA 3RVOA 3SQMA 3M4JA 3H19A 4R9VA 3IIJA 1CQJA 1BE8A 4IJKA 5F2OA 2VRBA 4IJVA 1CRQA 1YR1A 3SC6A 1XPUA 1YZFA 4MB2A 3K72B 1CUJA 4JIVD 2R4TA 1KMNA 2X9NA 3GLIA 3O4IA 4Q3DA 2HI0A 3C48A 3KTAB 4TKMA 3P9ZA 1X2EA 5LLSA 3SEFA 1TPYA 2IF0A 1RZRA 1FSGA 1XZDA 1KGSA 1XTPA 4YA6A 4W8OA 2M2IA 3R3YA 4K6MA 2H57A 4RDCA 4H17A 2Y76A 3SVZA 4EYGA 1V3TA 2NW6A 1INLA 1PJQA 5GADl 2GTHA 1GUFA 1P4GA 2J5QA 4OHWA 1OZ0A 3IUSA 1Q6YA 2CL6X 4WECA 2PNJA 4XYLA 4KOAA 3UFXA 4W6QA 2FZWA 4WZBA 5GZ1A 3KPUA 1G8GA 4WK4B 4EY8A 3V4RA 1TVKA 3EXAA 3WRWA 5A5VA 4EFNA 5TY0A 4D56A 2YV3A 1QU5A 4B82A 4F71A 4FWTA 3SXJA 4KE9A 2JGDB 4JEHA 3H2BA 5TQ2A 1JH9A 4ZI7A 1OTYA 2QTGA 2OGWA 3K73O 5A3QA 1A5ZA 3IUQA 1Z5PA 1ZI6A 1R0WA 5DM0A 4PN7A 2GAJA 4NCJA 4IL5A 2DLDA 1W5AA 3DBLA 3E8MA 3TXXA 1JSLA 1TD1A 2WYOA 4BVAA 3VR5D 4F4IA 1IU9A 3KOYA 3ENQA 1SD5A 4F9TA 3KT8A 1M0WA 2FVYA 2PBRA 2BE9A 2ANBA 2Z5VA 3LS2A 4MS1A 4QTTB 5ALTA 4R7GA 4ZP1A 3PJRA 4AQYB 5I7EA 3E8XA 4XR9A 2P6PA 4DDUA 2R87A 2IYUA 2QLNA 2H65A 3QYPA 4PINA 5E95A 4WGGA 2O8CA 3AR4A 3EISA 1IWOA 2QRVB 4MWGA 5I7RA 1FDUA 4LAFA 3RC1A 1Y1LA 2IU3A 3OLWA 3UUGA 4CDGA 4DJ5X 4IIVA 5A5GA 1JKIA 2IVFA 3KXIA 3FYTA 1JU3A 2OXEA 5D85A 1ZD1A 3RUFA 1PJRA 1T6ZA 1X14A 3DBHA 3H1EA 4UVEA 5JBNA 3JR7A 1PNTA 2P9BA 4J4TA 2RKWA 3C7CB 5IAJA 3RK1A 5JCJD 4IX1A 1CS0B 3EPKA 1L7PA 4FWBA 3BB3A 2VXCA 3EDYA 5FJIA 1HDIA 3SC2A 1M6YA 3L8GA 4TMVA 5AVTA 5CDFA 1B8PA 5ADWA 4O1IA 5CB4B 3PS9A 2ODBA 4FFOA 3THWB 4QJIA 3HUTA 3EVGA 2ODWA 4E11A 1NSTA 2I80A 4D0LB 4BRWA 5JJ5A 2GH1A 4Y2QA 2BGTA 4I1VA 2EH0A 4M0EA 4LJSA 2OQRA 5HF5A 2XSZA 1RQXA 2O0MA 1TUIA 5C8YA 4QQNA 3VKUA 4PBRA 5C0OE 4BKUA 3GNLA 3EA4A 3K9HA 4F4FA 3K2IA 5IF3A 2CFSA 1ZU4A 4FDVA 4P53A 1W93A 1PL0A 4PAOA 3SKVA 3LM8A 4YRGA 4PR0A 1L7BA 3UICA 4XFJA 3UG7A 2QU8A 2ZI4A 4L0MA 4JOBA 5J43A 3KUKA 1R9NA 1HQYE 4YNBA 1BGXT 2ZUUA 1VFNA 2GR9A 4MEJA 1TM5E 4LW8A 1TCVA 3MJVA 4G2NA 3B1KA 5KKNB 1ZUHA 1BHQ1 3KNZA 1RYBA 2LCFA 3MD0A 1M8PA 2G5PA 3CEAA 3P0IA 4KWTA 4J2TA 4MW5A 4U2FA 3TOVA 5L7WA 3FHLA 3CW9A 2FPIB 3RRXA 4CQNA 4NZOA 3ZXYA 1FB5A 2AUTA 2NX2A 1JECA 1ZK1A 3VOSA 2IS2A 2FPGA 3NHRA 5BN5A 3H97A 2OZPA 1OD6A 1E1QA 1FFSA 4L07A 3BXZA 1P3Y1 2RGUA 3H83A 1GGNA 2O8DB 4HB4A 3WGQA 5KNBD 3AERA 1NDHA 5IK2A 5K51A 2J6IA 1J00A 2OPBA 3R3SA 4QNMA 5JECA 2HADA 3JV7A 4L9RA 1BMFA 3V1MA 1I7LA 1TK3A 2ONCA 1DBSA 3NBFA 4AMGA 3S81A 3FM9A 2D2VA 4RADA 1CLEA 3D7LA 5CYPA 3ROXA 1H2AS 1PFKA 3DOJA 4B43A 3PD0A 1DQPA 2PL5A 2HCFA 4NG4A 4WFIA 5FYDA 1NW8A 4A4YA 3FCEA 4DR6B 4B6QA 1NC3A 1HQDA 4L27A 2OCLA 1ZGHA 3CGWA 2AOWA 5JD5A 3AF3A 1CG6A 5TVKA 4X95A 2G9NA 3WI7A 1I2MA 2R2GA 3ZE9A 3QLEA 3DXYA 2PV7A 4MLDA 3V2UA 4LJAA 2W2PA 4KEAA 5E0KB 3BH0A 4NENB 4UDNA 3EX7C 3N2EA 6ADHA 1X1SA 2CLCX 3QPDA 4G0NA 3HKCB 2C1EA 3QA3E 5AOAA 3FPKA 3MT8A 4HMQA 1PTJC 4AG3A 3ZHQA 5DZSA 5C4MA 1VE7A 1VSBA 2VTDA 4NK5A 4KSBA 4UJ3A 4ZHQA 2NT3A 3F1LA 4TN5A 3HP7A 1NFQA 1WQ3A 4O8CA 4D3DA 1WDWB 5EJEA 1M8GA 5EZYF 3ZLUA 3IEVA 3NIWA 2CBXA 3WXBA 3MJ4A 4RZIA 2Q5JA 4LDNA 1I6KA 4E2YA 2GDJA 3SLKA 2QTBA 3C1TA 5E38A 5BN4A 3L8CA 3IPYA 1T0UA 3CX3A 3DR3A 1PR0A 2QM3A 3WISA 3O8NA 2PWZA 3ZY2A 4I14A 2VBCA 2XA9A 3G3EA 3M4XA 1NF9A 2F43A 2VXBA 5EXEA 3CMMA 2GHIA 1TEXA 2BTEA 3A9UA 3IP3A 4ND2A 3FMPB 1JJFA 2Z09A 5F9HA 2Q1UA 3FCUB 4HJRA 1ZO8A 3G17A 1WAMA 4EPRA 2ST1A 3G1UA 1V7QA 3JVVA 2IWRA 3NBZC 4PM4A 3GLUA 2JJ1A 2EJUA 2P9TA 2PZAA 5CLQA 1SQSA 2ABWA 3TX2A 5LJLA 3R8XA 3MS4A 1EWVA 1I80A 1RT9A 2IRWA 4QA9A 1XZCA 4ED9A 1QZUA 4W5RA 2AQIA 1EZ4A 4K9QA 1L5VA 1K6MA 4C5BA 1ZK3A 5IRCD 3IV6A 3A6KA 4XCQA 4HQRA 1KFEB 4EUFA 5JI2E 3RC3A 3RTCA 1VGQA 3T7CA 3BXGA 4PZDA 4JBIA 2H2HA 4UZSA 3LKVA 1LXCA 4YACA 3WA7A 1QS0A 3EFOB 3FUTA 2O7SA 4KIJA 2OYRA 5KTKA 1BE1A 3L41A 3QVJA 3UV3A 2X1MA 7MDHA 5EJ7A 5JFOA 1ZI8A 2HRZA 1UBEA 1BYUA 1IH8A 1U6KA 3CFYA 3NHPA 3RQSA 3I61A 5AJYA 1PJBA 1EAMA 2TMDA 1WPXA 2QMEA 4KVZA 5M34A 2XXAB 4J9UE 5DTMA 4O63O 5DI3B 1M6VA 1VBKA 1IYZA 3LY9A 4PHCA 3U31A 2WJ4A 1DBIA 3ROTA 2PS0A 3HBMA 1E3WA 4L0DA 5H3HA 2FV8A 4K6GA 3L7LA 1QU3A 2DWCA 3F5SA 2DX7A 1Y7TA 4XSHA 1VG0B 4BO8A 4PG6A 4QJ5A 1QIHA 2FWPA 4ZAWA 5LCXA 3V1UA 5KIAA 3EW9A 3BT7A 4LSMA 4LVNA 1FPQA 4DWJA 3F78A 5J4KA 4CMGA 2GVZC 3AINA 1C9YA 3KS9A 1LGPA 1AUOA 1UL1X 1HEUA 4ZO8A 3ZHOA 2ZXEA 3L7MA 4Q1EA 1WUJS 2R85A 4MO9A 3ESBA 3IA7A 3BH6A 1Q7GA 1BH6A 3DOFA 4WK6A 4OI2A 3VR5A 2B4YA 1IVYA 1K08A 2G28A 4G56A 4Y9RA 4YJHB 5KZMB 2WF8A 2DR3A 2QN7A 2J3LA 4AG5A 4RIHA 2NZWA 4XH9B 2PKEA 3DDZX 4LHWA 3BBLA 3Q0EA 4BO5A 5CXUA 1AZLA 1Z63A 4DILA 2HF7A 2EIXA 3RK4A 2ZVDA 4FYHA 3WK5A 1AQLA 3KT0A 3W4IA 2VJPA 5B4UA 5AK3A 4JI5B 1AN9A 3GYGA 3O2JA 3PGKA 4JSRA 4MGHA 1JHVA 2QN8A 1H6AA 1KKMA 1Y7LA 3O3CA 3UNNA 1IM8A 1WVGA 5JYEA 3SSOA 4G25A 2YWRA 3IPRA 3HWSA 4II7A 4Z9FA 5IDQA 3FAKA 3UJPA 4JQSA 1TIBA 2ECFA 3AMVA 3K05A 3LSTA 1M0EA 2B4QA 3I6IA 3FTDA 3IURA 2YZGA 1DTSA 2GVDC 3HCEA 4DM3A 1TC2A 5JCJA 1EJ0A 5JZSA 3ZGYA 4RS3A 2BGUA 2JASA 3GIDA 4US0R 2F9LA 3CU5A 3FNGA 5AVRA 1ENZA 4U1RA 3QOYA 4RGBA 1DMRA 1MU0A 2C7GA 2IYWA 5JG7A 1DC8A 2D5AA 3H7IA 1ORDA 4RFSB 2ZRFA 2H4FA 1N8NA 2YYYA 4A92A 3PXBA 1FMJA 4CLRB 5K03A 4NV3A 3DITA 5CA0F 1CVIA 1A9YA 2QM8A 4CRWB 5LZ2A 4RFVA 1Z74A 5M3BA 1FP6A 4XAQA 3ZE7A 2BZ0A 1W35A 3VO2A 3KHTA 3JQ7A 3K30A 3L79A 1Q7CA 3KOMA 3UYLA 2A5FA 4PICA 1WD5A 5KQGA 1QJ4A 4S04A 1HF3A 3EN0A 2H1RA 3PQFA 5ALHA 2CHEA 5FA6A 2KBFA 3ETEA 5I7WA 2ZR8A 3JU3A 3GPLA 2G82A 4HLDA 1U0LA 3BMXA 4CMCA 3UK2A 2IOQA 5LLDA 4WKPA 4HS4A 4BNZA 3H0EA 4PSCA 3ZY5A 4HTFB 1P4AA 1IMOA 3ETNA 4B4DA 5AUOB 2CVHA 4YTEA 5JS7A 4RHUA 2RHGB 3T61A 3R6LA 1EB9A 4P4UA 2VK2A 2A88A 5LOVA 1JRLA 2XZPA 3ENZA 3QPCA 5KC8A 2FN9A 5AKGA 1GZDA 2G5GX 3RKSA 1F1JA 3L4BC 3OY7A 3G7NA 2EBUA 1Y9DA 3MINB 5LMNB 3NKVA 2WT8A 4EHLA 4I4LA 4F04A 4JUIA 5FBWB 3BMNB 2Q0QA 2FE1A 3GFBA 3TTSA 4BX3A 1WHSA 3PU6A 3I6MA 2XEXA 3U13A 1GR0A 1LWNA 4GICA 5BVHB 1XAIA 1AX9A 1GWNA 3ZXSA 1W4ZA 3GD5A 1N78A 1E59A 2OO3A 3ME5A 3HJGA 3Q7TA 4FYPA 4JC5A 3Q7IA 2I3AA 3P26A 4KQ6A 4WESB 2DVMA 3HSYA 2NO5A 4CM7A 1MHPA 3WLNA 4CL0A 3FYUB 1RRMA 2BIFA 2ZE8A 1IOVA 3GNQA 4TSFA 4WI1A 5A8IA 1L6IA 1Z5UA 3ILYA 1GNPA 2NVBA 4P98A 3H3JA 4JS0A 1RZVA 4Y67A 4V02A 3WKAA 4PQRA 2H1CA 3LG2A 4HEJA 1DAKA 2YFKA 2GN2A 1JHUA 1K75A 1KR5A 1NAHA 4QL3A 2J4CA 2M6LA 1ZOOA 1P45A 3BSYA 3T95A 5CBPB 3IQZA 1QFSA 3AXSA 1GGFA 3GFTA 2I62A 4NE7A 4YAIA 4WXMA 1ZOQA 5DLEA 1ZMOA 4UCXA 2GEVA 1OWOA 1XCPA 2EZUA 3CKMA 4GPEA 4DLZA 9LDBA 1BEEA 4R51A 2CLMB 4P0QB 1WMBA 2WAAA 4W8HA 5IF9A 2HLNA 2OGUA 1BOFA 4H7EA 1I5RA 4NQZA 1Y1KE 3DVQX 2BPOA 4YV7A 1Z18A 2WWFA 4RD4A 3PDWA 4E5SA 2JBAB 5C8ZA 3GQBA 2ZYUX 1TYEB 2FN4A 3QFRA 3H9JA 4ZQBA 3UGKA 4CEHA 2DCUA 3DWIA 4I4IA 1FS6A 1ZVVA 1JDZA 3U16A 4M0FA 4ZJPA 3MTJA 4AN1A 3K16A 4C7OA 5K0GA 4M9ZA 3MYRA 1T5IA 4XD2A 4XQCA 2RSLA 3WXMA 2BMVA 3TLJA 2G7MC 1NFFA 1XLVA 4Y0NA 5EIAA 1X2BA 1L3CA 4Q66C 2WT4A 1GUAA 1WL8A 3L7BA 2G1PA 1BOOA 3VJKA 1M1NB 2B5VA 1F0YA 3VH4A 2L17A 1W4BA 4GBJA 3Q7QA 3EDQA 4R9SA 1JMYA 3JCZA 4FEYA 3EWIA 3IQDB 4ASUA 4LE1A 4WFQA 1LF0A 1Q17A 3Q5GA 1WPRA 4CKBB 5JWOA 2VF8A 2JAWA 4PQEA 2O4UX 1MJGA 3IELA 5HIMA 3ZCPA 3RS8A 4GZMA 2B1QA 1XKTA 1R0YA 2EZTA 3FJ1A 3UFBA 2G4CA 2REQA 4OGLA 2DLNA 4ZJUA 1XU4A 4ZVNA 4BFLA 4C7XA 3H42B 2ZBEA 2J45A 5EKSA 5JYDA 5CB4F 5JNTA 2EJVA 1AF4A 3T3IA 5EUQB 3KYCB 1BW9B 2GN8A 3LBFA 4ZI5A 4EHNA 2MTBA 3TE7A 2MSCB 5FPKA 2Q5LA 4RY2A 3LA8A 5D7NA 1BCRA 3KXDA 5CDHA 5K0JA 1KDZA 3D1VA 4RDHA 2JQLA 4EKNB 5MN4A 4AMUA 4YAFA 1NMSA 3TS1A 2IH4A 5BSEA 2HA5A 1ESMA 3AR7A 3OETA 3AUXA 4LOJA 2IYXA 3TIIA 5EIEA 5KOHA 2O8NA 5BWLA 1K8XB 1F12A 2ZSIA 4BTVA 1TZJA 4KR2A 1RE1A 2X1HA 4DWOA 1R64A 5JSZA 1QWTA 3PGVA 3I12A 2HDHA 4GE0A 3MWEB 4NH0A 5JASA 2CHQA 1DG9A 3PWZA 2DHRA 3B13B 4CQMB 1CUCA 1I30A 2LGJA 4PRZA 4CG2A 4G26A 2LW7A 4G09A 4RV9A 1NRWA 2VZ8A 1YJXA 4TOIA 1PCXA 4ODIA 2YKGA 5CLHA 2ZBQA 4MVCA 1E2FA 5EWLB 4H4CA 4AUMA 2PWPA 2QTWB 3MBIA 4K26A 4QPNA 4FFSA 4UE6A 3ZKWA 4IWNA 1R4MA 1SM4A 4BVHA 1VL5A 1VL8A 2QZJA 5KCZA 2BMWA 4MP3A 4MRNA 3ESQA 1TMKA 3S2SA 1UBJS 2ZSKA 2C5FA 2C29D 1VRCA 4MPRA 2HMUA 4FJ2A 2ZIFA 1CJTC 2BHTA 1PNVA 2VJMB 4ZVTA 3KV1A 1CZOA 1J2FA 1P44A 3HBAA 3DQQA 1FNBA 3MCWA 4OSEA 4US1R 3TGWA 3I4CA 3OM1A 4IIGA 4YRMA 5C18A 1TZ2A 2UAGA 3MJRA 4WZ6A 5HIIA 3JRNA 3N7TA 1I4DD 4YY3B 1KZ1A 4YLYA 1G2PA 3LQRA 1EE1A 3HBLA 1OUMA 3KT9A 5DM4A 5ELMA 4X44A 2AJBA 5A4DA 4RVFA 5HUQA 3S2GA 1LX6A 5LQSA 3GZ4A 3UMYA 1F48A 1TUBB 1AOXA 3DDUA 2IQIA 3FDZA 3MWDB 3AEKA 4LQ4A 5B1IA 3S1AB 3SHOA 1QIMA 2PEZA 4AJNA 4WNCA 5DHPA 4BFZA 1M10A 4BNTA 2A1TR 3D6FA 2QT0A 4HWOA 4BX2A 4BEWA 1GRNA 3NRJA 3U7HB 1V8OA 3OFKA 2JLVA 2PT5A 2OXTA 4OLFA 5BSWA 5REQB 3THXA 2QQGA 2PX5A 1K68A 1NUSA 1OLOA 1ZG3A 3AL2A 2I4NA 3AV0B 2C5AA 1H2YA 3IVXA 3QVTA 4FYKA 2BMAA 3MGKA 3SR3A 3G2IA 1YHZA 4ALKA 2B6HA 1LH0A 1GVNB 2C84A 4LBWA 4AECA 2FZKA 1T8TA 3CPHA 4WA8A 2XODA 3F7NA 4KKXB 4N7MA 4LZLA 3ZD7A 3X1MA 4DRZA 1E63A 1P39A 3WL5A 5M2QA 1EUCB 4MO2A 3WLPA 2AD5A 4HG2A 3UAYA 1WU7A 2FEMA 3DLHA 3KTDA 5F4ZA 1FYVA 2FR0A 2GAAA 3QLVA 4L73A 2CDBA 4V0QA 1C3OB 3H5VA 5DFAA 2AD1A 2F3SA 3FCXA 5D1NA 1F2DA 3NGLA 2BDEA 3PKIA 3JYHA 1UOEA 5FD8A 1XTZA 4OTZA 1NF2A 2IS4A 3RS3A 3NJ8A 5KCMA 2LDXA 4U3JB 4F72A 2VAXA 1KERA 2CLIB 3KJFA 4MIEA 1OF1A 4Y6SA 2YBEA 1DJLA 2JGRA 1A9XB 2H1LA 3AHJA 1OXBB 3LC7O 1DEXA 4L5CA 1L3BA 5DNWA 5EERA 3RS5A 3MD9A 1DRJA 2ERCA 2QI9C 5CB8A 4M1MA 2BOVA 3LFUA 4FFBB 4S1NA 3C8HA 3VR0A 3HWX1 2FVXA 3NNSA 3OKAA 2QV7A 1Y34E 4UW9A 1GCAA 1KI3A 1L5MA 3E7DA 3FE2A 5LP6A 4Q7LA 2PL3A 1NR1A 4JYPA 4R9UC 4M1KA 4TYYA 2HH9A 4ZYLA 4MVJF 3BWVA 4PYJA 4EHDA 3C8MA 3IP6A 3P2IA 4ENTA 1U0TA 1R4NB 2X4IA 4FYIA 3CZPA 1KJQA 4HO1X 1TTQB 4HQLA 3KSAC 5H7XA 4NH4A 1V5IA 4OYRA 1TX4B 4NNOA 4Z5XA 2DBQA 4OQEA 3BSWA 5J2TB 3DTVD 4N7RA 1E5XA 3A0UA 4A0SA 2FI1A 3EFHA 4WJKB 1LZLA 2H85A 1KP9A 1H6DA 4I1SA 4OREX 2I3DA 3HXPA 4B6GA 3U5TA 1MAAA 2RGCA 2WV7A 1SCUA 2I6SA 5KYKA 2CXSA 2Z58A 1CBUA 3HU3A 5AKHA 2P8SA 1H3NA 2QNIA 3PQEA 5DBGA 1O4WA 1XN4A 1CZRA 3HXTA 4NBTA 1STOA 4KE6A 4WVFA 3D3QA 5EKTA 3C5WP 5DGIA 1POWA 3DO6A 1EU1A 2YMLA 3O2SB 2ZP1A 5CPBA 4Q6WA 5AKEA 1GP2A 1FQOA 3L0BA 1SC1A 2HLPA 4JSTA 1O97C 4PBTA 3LQKA 2Z2KA 5KINB 1XYGA 5EWMA 3NVMB 3RNLA 2Y66A 4DBLC 5P8WA 3HB7A 2H59A 3B48A 1ZITA 3GT0A 2QJFA 5HK8A 3I5XA 1E7WA 5AJUA 3AETB 4TXNA 1QG0A 3AR3A 3E9YA 3ML1A 4KXWA 5CAEB 4BUCA 2O3UA 3DT9A 3JWPA 1SHZA 3LW7A 2OYCA 1EVQA 1N6KA 1Z88A 3Q3JB 1C7QA 3NM6B 1YH3A 4FNMA 4E5MA 3TMKA 4EZIA 1R6XA 5LQUA 1VCIA 2BKAA 2CB9A 4R5HA 1SVWA 2EERA 1KZGB 2YRFA 4J1QA 4BU1A 4BVJA 4EEXA 4FU0A 1JQJC 2CJYA 1BFKA 2O19A 3ST7A 3DYBA 4A23A 2P4SA 2P2GA 2Z2JA 1H93A 3B1VA 4IJ6A 1HGXA 4JBYA 4PTZA 4BOYA 4BNGA 4OIMA 3O8QA 3QLUA 5FPSA 4MWCA 1UJ6A 2ZWPA 4JCOA 1IRIA 1TF5A 2JPDA 3C5CA 2C5GA 2HWKA 5EI5A 4GI1A 5TS2A 4J1SA 2C9ZA 3UUWA 2IV3A 3AJDA 2VP6A 2P2ZA 2Z9DA 5DBIA 4AIRA 5AUPB 3C7KA 4IMPA 1CDZA 3L7JA 4KQ9A 4N5HX 1AHIA 1E2GA 3DLCA 2VDUE 2I4RA 1OWNA 4IIJA 4MYCA 4TV8F 1Y1PA 4WL0A 2ZSAA 4K1LA 1DXYA 4X6LA 2BYTA 3EIWA 3TE6A 3VOTA 2C96A 4KXVA 3RIEA 3ORRA 1AGRA 5T4FA 3VH1A 2HJSA 4LOHA 3R8FA 3F3MA 1ARZA 4U7HA 2EXXA 2R48A 4UNSA 1A77A 1T1SA 1Z26A 3ILXA 4UTXA 4F6RB 2VZ0A 1P1IA 2WYVA 4HZUB 3MGCA 3N2LA 3BJMA 2VJCA 4CQLA 1P2FA 4I1PA 3M1IA 6Q21A 3IQIX 4DMMA 3OLZA 4WUTA 3H13A 4BKPA 1QIFA 2KKLA 3D7RA 5ADVA 1DQZA 4ZCSA 1W5SA 3W6ZA 4PZYA 3K0EA 5A71A 4PLVA 1C7IA 2OV2A 3OEED 1E89A 3PNPA 3T1OA 3UV7A 2FW1A 2ZS9A 3PB3A 4JGIA 5ED0A 1PJTA 5FIUA 5HOQA 1C1YA 1G8FA 1E3DA 2Q6IA 3IAM1 4PXAA 1KE1A 1QVVA 3TD6A 2KQUA 3SYNA 1V4NA 4PFQA 1T2VA 1UBKS 5E6UB 1HT0A 5EJ5A 4PYKA 3VDMA 2FPUA 3GLIE 3A7DA 2FZLA 1H2BA 2XD9A 2VPXA 4IFBA 4MUXA 5A05A 2H8GA 3ECSA 3OIDA 4ESHA 1G8JA 2FMFA 4WOCA 5HBRA 3K6KA 2IODA 2PANA 4S2UA 3WLOA 1HWYA 1RJ9A 1ZQ1A 2ZVJA 2A86A 3NWBA 3RH0A 2IU6A 4MPJA 2FPPB 4IMIB 1ZINA 2VP3A 4LRYA 3VAZA 4MEAA 3BERA 2I3ZA 1I6LA 2NXJA 4BN0A 2VAVA 3GARA 3HS3A 2AE1A 4DYHA 1K6XA 3SIPA 2I7VA 4JJFA 4I08A 5EHGA 1JEQB 1BKSB 2E4YA 2HK7A 2YIMA 3F8SA 4N9QA 5CIWA 3VFDA 2XQGA 3WRXC 1JDBB 4WZBE 4ZC8A 4HGRA 3KIPA 2BKEA 4RD3A 3VSCA 1XE3A 1J2RA 3GT7A 2VDVE 4O1MA 1J6UA 2E5LB 4CT4B 5G4LA 3GP8A 2ARKA 1PT6A 3TOZA 6LDHA 4TTAA 2BONA 1JHAA 3OVMA 2HU2A 1QTNA 1NMEA 3KU1A 2C4MA 2KE5A 4N39A 4OBEA 4GPAA 2PE5A 3VH3A 1AS3A 4IIBA 2PAAA 2Y0EA 4DSOA 3QKRB 1KH3A 1H42A 2R7MA 3E81A 4J6EA 4R3WA 3B6MA 3A10A 1WDKA 4BB5A 4NATA 5K3OA 1N7IA 1ZZGA 2CD9A 1G2OA 4GECA 2NNWB 1VMKA 1L5WA 2YJ6A 3H1TA 4LRTB 3A1EA 4P7GA 2BFDA 4P83A 2WOOA 3P19A 1EUDA 3T41A 3I5YA 1TJYA 1EH5A 3OC6A 3LP6A 2N46A 1AKMA 1QTIA 2X5JO 4GVLA 3ZE6A 9LDTA 4CMHA 1XMJA 1TAQA 3NYRA 1NVAA 1Z6QA 2Q9BA 4FOLA 5CLLA 4G63A 2GARA 1KH2A 3CUWA 2ZAMA 5CXQA 4RF3A 3CZQA 3ELBA 2M6KA 1W36C 3UJ3X 4P31A 5FNVB 2QLFA 4RS4A 2W58A 3DKRA 4Y2HA 2WHQA 2ZYRA 1IFXA 5IBPA 4AZWA 3L0IB 4YMLA 1GZ7A 4TSKA 3EPLA 1X1CA 4RFLA 5ALIA 1I13A 2R8PA 4KX5A 1MQ9A 4JJEA 4K9RA 1DRVA 1L5HA 1W4AA 2YVAA 3DT8A 3HLTA 1U7VA 1SVUA 3KE8A 2VA8A 4CUJA 4TRMA 4YPOA 1QO0D 3LD9A 1ZMTA 4G1VA 3NORA 4DUYB 3EGIA 1UZMA 1A4XA 3GUYA 2CZQA 1CZNA 3L8FA 3VPAA 3F6SA 5JIBA 3EQZA 3K9QO 5CDFE 4DL9A 2YXPX 2D0PB 5ERGB 3ZE1B 4XWAA 1FP2A 2IEGA 2R97A 4OPMA 3M4ZA 4B0OA 1N6OA 2BEJA 5K8JB 4JJZA 2V9ZA 3PYXA 2P9EA 1NBAA 5KB3A 1CY1A 3ZCXA 2FGJA 3GBSA 5FTLA 3T7EA 3W9UA 3CVUA 1KWGA 2F59A 3KOXA 2C61A 3E3LA 2FQYA 4Z9YA 1VE1A 2ERYA 4OSPA 4EHIA 5B7PA 3IULA 3OM0A 1H66A 1L9KA 1WR8A 3CLTD 1D7OA 4RVSA 4P5DA 4TTIA 5PNTA 1IULA 1PYGA 2H1HA 1MO4A 3A32A 1JBQA 1D6NA 3RS0A 1Z8NA 3Q12A 3N53A 2CLKB 4KJZA 3FDXA 3LV8A 5EHXA 3KUCA 3FI9A 3QPAA 2W2XA 5CH5A 4F8EA 4YDHB 2V8OA 2P9JA 4R2MA 2FGKA 2X1VA 4D9FA 3DTVA 2XCIA 1PX0A 4GKJB 1D4FA 2VJQA 4CF3A 2BE7A 3TL6A 4QGSA 3OT1B 1LY1A 1VJTA 3NU1A 1XHLA 4S0XA 1KF0A 1OYVA 1US8A 1G3GA 3AGPA 4S1OA 5BSMA 3FI0A 4QQKA 3MILA 4G85A 4EFLA 3PQ8A 2E1RA 3BWCA 3N05A 2E6UX 4HH3C 1GTG1 3FM8A 1O94C 2ACEA 3DAFA 4JI6B 1D8AA 3TGPA 2NG1A 3TG8A 1TQDA 1UBUS 1HDGO 2IOFK 2K4MA 2MHCA 2WM9B 3AVTA 3HGMA 2AZDA 2Z95A 5TQ0A 4JI0B 3R3JA 2FMHA 1B3RA 4HAIA 4DLAA 2EFYA 1NRIA 3IDQA 3LO8A 4UEOA 5LA6B 1FPMA 3WR5A 5B6IA 3JWJA 3ZE8A 4MGIR 2MT9A 3L7DA 4CLOB 3GGGA 3A05A 1T3GA 2GUWA 2YICA 1RWWA 3T4PA 2ZYTX 1JN0A 4AIIA 3IHLA 4C4TA 2DY0A 4CMJA 3RSZA 1FDVA 5JT1A 2CMKA 2XQVA 1NN0A 1UBRS 1UM8A 2OM6A 3L1JA 5E6RA 1RLUA 4RU1A 3O3MB 1CUGA 3AQIA 4KVGA 1XD2A 3G23A 2BTOA 2X77A 1H94A 2Y1FA 2HZ7A 1EFAA 1J20A 2WWRA 2JZOA 1KTIA 3SIRA 1NXVA 2Q4EA 1L6RA 3OMXA 4L6IA 5EE3A 1VBFA 2WJZB 1UMCB 3RU2A 1VPLA 1AD2A 2BEVB 2JCGA 5A3VA 1FFYA 5BMVB 4MUFA 3ZXUB 4LRXA 5ILOA 2ZWIA 1B76A 4B33A 4Z2AA 1NVGA 2PX4A 3EXG1 3IKLA 3HKBA 1KO7A 1ZC3A 3DCIA 4IIFA 1SY7A 3URMA 1Z6PA 4KQWA 3W2FA 1GAWA 1GCOA 1FUIA 2Q5CA 3ITNA 1OLSA 3M34A 3DZ8A 5FKJA 4YS6A 1FYXA 2WFLA 1T3HA 3CCBA 5AESA 1EK6A 4YAUA 3QHAA 3RYFB 4RTRA 1MO5A 4DUGD 3PQCA 2B4TO 3DBOB 3INGA 3TFOA 4XB1A 3EMVA 1YKGA 721PA 3KZKA 1T4DA 4KBGA 4MRPA 3DWEX 2VF4X 4D82A 1P6QA 1QFZA 2CL5A 3KQMA 1VFPA 2XWJI 1GPNA 5B1YA 3RBXA 5MN6A 3VPFA 3HLYA 2OKGA 4GLBA 4Q1FA 2BFOA 4M21A 1SU8A 3JQBA 1V2GA 1EFKA 2ZRGA 5KYUB 4EEZA 3TM4A 4KHZA 2JI4A 3HM9A 1T13A 3LPLA 4O08A 5IJZA 1MXFA 2PY6A 1F2TA 2NSHA 3HY3A 4HUJA 4LQDA 4OU4A 2Z56A 2XAUA 1JB9A 2W43A 3RC9A 5F77A 4CIAA 3W8RA 4LJ6A 4GR4A 3FDFA 2VKQA 2RH4A 3I04M 2Q6TA 4U8HA 1QYWA 3V97A 3H05A 1R66A 1ODLA 1RYHA 3R77A 1JDSA 3AB3A 4CMBA 3E15A 1UT8A 3KFXA 2HRQA 5K45A 5DLYA 3Q41A 3I52A 5HFNA 1SK8A 2MSNA 4DMLA 1B8UA 3OIWA 3FRIA 1NVXQ 3JVIA 4JDPA 1G98A 4RLFA 3JZAA 3P9YA 1I5OA 2K87A 3AHCA 3L4KA 2XUOA 4W5NA 1TJPB 4UXIA 1OGYA 5EIFA 3V4VB 3WGOA 2WNIA 4FUQA 4LFCB 3R7FA 5K8CA 1XWIA 2I2FA 3C6KA 4ZIRB 5AI0A 2MMCA 5SZHB 1O03A 2WVAA 5AUQA 4UVIA 1NWCA 2XADA 4I8IA 3IUEA 1LTHR 3KFLA 4OVKA 3GR6A 1G4UR 2WJVA 4LXYA 5KHAA 3U4GA 4KDFA 3FHCB 1USIA 1GZ4A 1KZ4A 5FUVA 4ZVOA 4YAGA 3EGDA 2ETXA 1Y1QA 1R0LA 1OFGA 2ZRIA 4UD6A 4M9UA 2JKDA 3COSA 3RIHA 1RFLA 1ABEA 4Q4CA 4QODA 3LLCA 2REBA 5DHAA 5TGZA 1W0JD 2D6FA 1PVOA 4ENWA 5TMDA 3RLFA 4Q93A 5J2TF 3BXXA 3G2PA 5JV5A 3AVYA 3KB6A 4EQ6A 5A0VA 4TZ6A 1K7XB 1P8AA 1AM4D 1M83A 4WN9B 1ZN2A 4UTRA 4JSYA 2OLEA 3LQ2A 1HYEA 1N2OA 1YBHA 4K6FA 3C43A 4JJ4A 3UHOA 3V34A 1HI9A 1QOQB 3CHYA 2PFKA 3LUCA 1X9GA 4URHA 4ZGBA 3R0IA 5FL7D 4C20A 1JT2A 5JOQA 1QF6A 1PI3A 1BA2A 1JXOA 4BKMA 1YUNA 4UZEA 5GJWC 1ZHOA 1XXLA 2F1KA 2C88A 2WJYA 4F46A 5IZ4A 1BDHA 1ZHFA 1U0SY 3R3HA 5B7GA 2NZ2A 4MGZR 4RJIA 1OFUA 4V2IA 4ZT2A 5CG2A 5BOVA 1KI7A 4AT1A 3HJRA 1G6KA 1XXHA 4PZEA 5IBRA 4DNPA 3H4MA 2RDMA 2JB9A 1ZMBA 4XQ0A 5H02A 2CEKA 1C8LA 3IQEA 5KHLB 2RGGA 2PRZA 4AM8A 4F3TA 1D3AA 2P9ZA