4WRRA

A putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
293
Chain Sequence
KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVSNNIDAEEKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords putative diacylglycerol kinase
total genus 81
structure length 293
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 4wrrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4wrrA01
5EJFA 3VZBA 3V8PA 1Y3IA 3V8MA 1Z0SA 3V7UA 4WERA 2P1RA 3VZDA 5DHSA 5DHRA 3T5PA 1Z0ZA 5EJGA 2QVLA 5DHPA 2I2BA 3V8QA 3V8NA 3S40A 2AN1A 4L02A 2QV7A 3VZCA 1Y3HA 4WRRA 3PFNA 2I2AA 2I29A 5EJIA 3V7WA 3V8RA 1SUWA 2I2FA 1YT5A 2I1WA 3V80A 2Q5FA 2JGRA 1Z0UA 4DY6A 3V7YA 5DHQA 5DHUA 4HAOA 1U0RA 1U0TA 5DHTA 2I2DA 4V24A 2BONA 2I2CA
chains in the Genus database with same CATH superfamily
2FCAA 1R21A 3LLSA 3WKEA 3P7MA 1T0UA 4BXOA 2QVGA 1GZ3A 2WJJA 2AK3A 2O1XA 4JT2A 1C4WA 4BBZA 3COZA 4LYHA 4URUR 5JNWA 2RGYA 3LYAA 1M74A 1D2HA 3NAQA 3VDNB 4FDTA 4AULA 4BEVA 1U2TA 2C4TA 2H1FA 4TOIA 4YCLA 1K3FA 2Y8EA 4Z3KA 5H9WA 3FYCA 3R3ZA 1RWPA 1NXXA 3LGXA 3Q88A 4CLDA 1YZNA 2QNIA 1OPRA 3KE8A 1G5RA 3NIWA 2NUAB 1NOIA 4XRRA 2IYXA 1WXFA 2QL5A 4O63O 4OUDB 3O3NB 3VU9B 1VKZA 2V98A 1JEAA 1VSUA 2DRIA 4DJFC 4ZI3A 4B82A 1RHUA 1P9OA 3VM6A 4CKEA 2ST1A 3ZDCA 2XXAA 3ITNA 1ID1A 4M0CA 2O6HA 4ZCTA 4E7PA 1SC4A 5FOTA 2CJWA 2Z0MA 3DBHB 3IB6A 4FYMA 4LQLA 4MPTA 4PQGA 4WOBA 1A77A 3RVJA 5F23A 5C35A 1GGVA 1J33A 4FFLA 2F43B 2A88A 4OQXA 3WZMA 1GQOA 3A1DA 3TSOA 4C2UA 1M7BA 5EIFA 3BFKA 3WWZA 2FF7A 4XGKA 3ZZTA 4PNHA 5T64A 1EZ1A 3A1VA 4I50A 4M1YA 1LDEA 2DUJA 2ZE8A 1UWLA 3NM6B 4KOEC 5M7EA 1APBA 4BO1A 3G79A 4KGDA 3WYCA 5ITZB 2Q3FA 2C9YA 1PFUA 1GSOA 4MUHA 1VG9B 3NHRA 3LP6A 2V4MA 2X19A 1U6IA 1UCFA 1H6BA 2O2HA 3ENKA 5HFAA 4NOJA 3COVA 2WSBA 3H5TA 2AKAB 3GVCA 3RS3A 4AZSA 1ZN8A 5BVHB 1IN6A 4YI3A 5KTMA 2WM8A 3OPNA 3LLVA 1OFUX 1UMDA 1YZ3A 3ST7A 5C32A 1LVHA 2CEAA 1XLWA 2PH5A 1G21E 2R2GA 1Y9JA 3B5JA 3EY4A 1T1RA 2ODTX 2GZ2A 4EHHA 2B4AA 5JYCA 3OZUA 1BC5A 5JI2E 5A9TA 1EVLA 1EFLA 1Q17A 3C3CA 3G8BA 2ID8A 4QYWA 1T0PA 2VHJA 1LK5A 5KNDH 4BFZA 5HIKA 4R05A 5JYBA 3KB8A 1IZ7A 2ZIXA 4KKVA 3I2JA 5LXTF 3R7FA 1ORIA 2VJOA 4KLCA 1LTQA 3WZ2A 4BOYA 4D42A 4LF4B 3MTBA 3TRJA 4C3VA 4Z51A 1BEUB 1R6UA 2B1GA 4QUHA 2XD4A 2M2IA 4FDUA 4O4IA 3IDOA 5JXGA 2HWYA 1RLOA 5IFLA 5CCDA 2LKCA 4WECA 1F2VA 4OHZA 3BF7A 2B3DA 1WW8A 3EDRA 3ML1A 4FGWA 3VYTB 5L3SB 4K46A 4KOAA 4NH0A 5EXDA 2ZUTA 3Q7QA 4WVFA 4EQ6B 4Q4AA 4OHUA 4GO1A 3W7BA 5JY6A 3I9V1 1ACJA 5D3KA 3UMVA 3C7CB 1GGJA 2FFAA 4ILKA 2W42A 1QIJA 4P5PA 1V8ZA 5D86A 4U3JA 1BMFA 1VKOA 1W1UA 4D98A 4ZVKA 2DYKA 3PITA 1YVUA 4QFDA 5FV4A 2CT8A 2WIGA 5IC6A 4A2WA 4CIDA 1W4BA 3D4IA 3M1YA 4QGBA 2BGTA 2FW8A 1E2FA 3T7AA 4H0FA 4GGOA 1ZL0A 1FF9A 4I3GA 2P3SA 2J0SA 1PFVA 1DAEA 4NMWA 4UQOA 1BHQ1 3OX2A 4C7XA 1YXMA 1WQ1R 2NSHA 4E1VA 4KL8S 1USVA 3GLIA 1ZJZA 3KV1A 4Q66C 3BGSA 2ZR9A 2HU5A 2PRZA 3PG5A 4TQ9A 2HDNB 4FHDA 1U80A 4LOKA 1QU3A 4I1PA 4XIJA 4KQ2A 5BQ5A 2JDID 3AIKA 3VNVA 2QXTA 2FDCA 2WWTA 1FDOA 5J2UA 2IIBA 5AHOA 3WWYA 5CT9A 3E1KA 4J9VA 5KMGB 5LN1A 1JUDA 5E50A 1C7JA 4N9WA 3T99A 1ZO8A 1JFTA 3VOSA 1PBTA 4AY6A 1W4LA 3GARA 1BKYA 2IT1A 1N2ZA 4FFWA 3VXKA 4F7WA 2ACWA 4BNJA 3FPAA 3FVVA 4DIUA 2COUA 4EYEA 1TYZA 3K0HA 3F90A 3K0KA 2IZ0A 1X7YA 2I4LA 4TYYA 4OKNA 4NDZA 4RJJA 2ZXUA 1ZUNA 3KKZA 3HKEA 2H9YA 4CKWB 2DGDA 4J3JA 1JJBA 1ECCA 1AKMA 1NXOA 2EC5A 2YJ4A 2ZRQA 3BB1A 3FNFA 3K16A 3OEYA 4LWQA 5FBZA 1J8QA 1KQNA 4D9KA 3QNWA 3I0MA 1X8JA 3K70B 1UJBA 3E4DA 1NBME 1PX0A 4I6GA 4DNOA 3FWPA 3OM9A 4M88A 1RWWA 2A0UA 2ZRDA 1OH8A 1EG7A 1GPLA 3IDAA 4ZC1A 4J91A 4HNUA 5LYJA 1NE7A 2NSDA 2DPXA 4I5DA 3HDQA 4DQKA 1PT9A 1S9DA 1EDZA 3VU1A 2JCYA 1T1EA 2ZRAA 5F35A 1E32A 5FTLA 1PR0A 5JV5A 2ZRIA 3Q8KA 1MIHA 1M7GA 4QOFA 3O4JA 2Z2KA 2CFCA 1OC2A 1ZWLA 3KOYA 3O7WA 4HQOA 2HJRA 3P2YA 1HG0A 1G3RA 5JELA 4MKFA 1G55A 5DM4A 2Q8NA 1KVTA 1NASA 1U8AA 4BTVA 1R6XA 5KHAA 4Q18A 1L7VC 5JYDA 3ZDEA 3AF3A 4JU8A 4WA8A 3T7IA 3KT3A 4AJJA 3U44A 1H1LB 1SKAA 2OD9A 2R6R1 1OLXB 4FUTA 4D97A 3GK3A 2ZIEA 1FW8A 3NIGB 4MGIR 4S2EA 1H2AS 1BEZA 3LMKA 1I4TD 2PXAA 3TEJA 1UZMA 1P7WA 1GQSA 3H6KA 3LQ2A 5HXAA 4AZVA 4L9RA 1E1LA 2HLDA 2QTFA 5IAGA 4YUZA 1ARZA 2E5FA 3PXCX 3R77A 2HPHA 4R7TA 4QPDA 3RC9A 3I9FA 4OJQA 2WE7A 2F8MA 1EGMB 1A5BB 221PA 2BGJA 3GL9A 4RIEA 5TMBA 1DARA 4B79A 3C1UA 1OXUA 2C3UA 4HDCA 5JNSA 3I8SA 3UAOA 4ZOLA 1Q57A 3HSYA 3C7AA 4G0XA 1VLJA 3M4ZA 4N7RA 1EFUA 1KI6B 2XW6A 3AI7A 4X6LA 2BFDB 3W6OA 3WHIA 4CDNA 1E0AA 4JKIA 5F9MA 5HZHA 2HYIC 3PJRA 3RYHA 2HQ1A 4FBGA 2PT9A 1OFGA 1VB5A 3EK2A 6REQA 3OE4A 3PGA1 1B6TA 2P9CA 3EXEA 4E11A 1ZLYA 3NDBB 3KKLA 3RYCA 3HY3A 2WJVA 2Y27A 4WBNF 3TDKA 3GOQA 1U8CB 3L0BA 3NJ4A 3WWEA 2YXLA 3E9CA 3RFTA 2C2HA 2V0CA 3H2YA 3RABA 1K2NA 1QO7A 2HJWA 2HOQA 2YWDA 2II6A 4LJ9A 4WFQA 3JAKA 1VJ1A 3FRIA 3JPWA 3HI6A 4WEQA 2CJWB 3DBHA 3U56A 3G2MA 2J30A 2ZI9A 5P8WA 1RMYA 5HWSA 4UD6A 3W3ZB 3SBDA 1YJ5A 4CBVA 1FP1D 1YJ8A 2A0TA 4D0GA 5L3QB 4QAQA 4UDXX 2O7QA 4YQYA 3MJDA 4X00A 1ULZA 4XWOA 4YMUA 2WM9B 1XDDA 1Z0JA 4KITB 4HAOA 4LBWA 3VYWA 4Q3KA 3EGIA 4NDNE 4QQRA 3MAJA 2XDQA 2ZUBA 4R5HA 5DH9A 2GJAA 3ZZMA 4BNGA 5I4IA 4Y9DA 1SAYA 2ZYTX 4LHSA 5B55A 5FPKA 4QVKA 4M89A 3H3FA 4HK4A 1BJRE 3LP5A 4XJSA 1RWOA 1M1NA 1AS3A 4IV8A 5B30A 2MMCA 5EHXA 5FLXA 3Q6IA 4QDJA 2EWWA 3UK7A 2Z43A 2YUIA 4M1SA 3W2HA 4WV3A 3PQEA 2OCBA 2OZKA 1JQLB 3E9RA 2OHIA 3HY4A 2XNCA 1IN7A 1Q1QA 4G81A 4LA4A 4DKXA 5FNVB 2QGFA 3CPEA 4YDHB 1UF9A 3HDYA 1MA0A 5FFMA 3KJHA 4NV3A 2YH2A 4XJTA 1RP1A 5CM9C 2FPMA 4EL5A 2NU9A 2VR1A 1SQGA 3FHLA 3GRAA 4MVJI 1IDOA 2F3UA 2JLBA 2LKDA 2W2VA 1LLFA 2ZCUA 3GDOA 3JQ7A 1UJCA 1L8AA 4G67A 3IR7A 4EB8A 5L9AA 2FR0A 1BCRA 4I5EA 5FL3A 2AFHE 4OQMA 4EF6A 2CLHB 4QPJC 3V8QA 1PNRA 4AQDA 4HXGA 4O4IB 3GN2A 1HYBA 3GT3A 4B0PA 3LQYA 4KEAA 1TXGA 4P4LA 2O2GA 3MOGA 2C4VA 2ZJBA 4MVJE 5C5DA 4EJ2A 2OUKA 2DBRA 2JHCA 3VDXA 5K3EA 2MSKA 1A5SB 1RJWA 1E2MA 5CLGA 4ZCPA 1R9GA 2WUGA 3WLLA 2R5NA 5EXSA 4ZU3A 1H5QA 1RS0A 4C0XA 1Y6ZA 2FW7A 1AGNA 1HE3A 4B4OA 2CLFB 1BJKA 1K7YA 1WSDA 1RXWA 4GIBA 3ZBPA 3P9CA 1JJIA 4OI4A 1PZGA 3LKZA 3W78A 2J0QA 5FHQA 1P80A 1RM0A 4LJRA 3AM3A 3Q3VA 2C2WA 2J5KA 1ZVMA 1EFAA 1GT91 2C2GA 1GA1A 3T5TA 1SD5A 4RDCA 3OCYA 4QT0A 5DP1A 1D2AA 1G6KA 2RBKA 4WXMA 4ND8A 5D00A 1E5LA 4DV7B 1YB4A 2VHZA 2IBTA 4FXPA 4BO8A 3M6UA 1ZSYA 5LZ4A 1NULA 3RHFA 1T43A 2CMKA 3UJDA 1LTHR 3WMGA 4TSFA 1KMQA 4LMRA 2J6BA 1T4GA 3TLBA 4QHSA 1ZN2A 1MBZA 3VKWA 4DMMA 2JLWA 1CJMA 1NYLA 3T9DA 3GDFA 2Z3VA 3I32A 4GH5A 1NYQA 4K9KA 5LNK6 2JAUA 5E2BA 1B8OA 1ZK0A 3ZXYA 3NHLA 3CR3C 3BORA 1K5PA 3H16A 3DBRB 5C8YF 5K8CA 1WHTB 1N8NA 2C9MA 4HDRB 3PTLA 4N65A 2R47A 2PV0A 3FBWA 3HU1A 3BSYA 3B8HA 4V1CI 2PBRA 1BE8A 2DFPA 5E1DA 5REQB 4X62B 2MYNA 2VA9A 4Q93A 2ES4A 1NL3A 4KSBA 5TRTA 2HEIA 5ED4A 4CEIA 2J85A 1COZA 1UXKA 1KAQA 2WWGA 5C8YA 2FF5A 3ANNA 3CC8A 3ZHBA 4BZXA 1GZ6A 4E1AA 4KQKA 2NXWA 3QPDA 1QH8A 4PX2A 5AESA 3R3UA 4K6OA 5C8ZA 5B53A 4CF3A 1VECA 3PD1A 4FZ3A 4BFSA 4AJNA 5KWJA 3I9KA 3VSBA 4PHHA 3FUXA 3KYDB 2BBSA 1IVNA 2F3TA 4MQBA 4ME6A 2INGX 2DR3A 2X0NA 3OESA 4B3JA 3K20A 3PQCA 5DKFA 5GTDA 4LDQA 3RE1A 3NP9A 5IABA 2UXCB 2KYRA 2VP3A 2XOXA 3VKFA 4WADA 4P3PA 2PSFA 3RU3A 3UJNA 3TPFA 3MS2A 4MGEA 2JIDA 3EARA 1JG3A 1I0ZA 2PRSA 3HE3A 1H3NA 1N3BA 3O4HA 4EKNB 5LIRA 3DZJA 3LUHA 4R1SA 4TLBA 2AX3A 1X7XB 3GEDA 2QAGC 4XVCA 4C01A 1Y8QA 2ZSAA 3OCJA 4HNRA 1OSNA 3LT0A 4RA9B 4NU6A 3R9XA 2IF2A 1IQ0A 5DYIA 2GGSA 2MR5A 4JEHA 2RKBA 2LCIA 2QE7A 1IL0A 5MN5A 1GARA 1JVBA 4NE9A 2XEXA 4UUOA 3KSZO 3D8NA 3OP4A 5KYVA 4B7UA 1KH1A 4R3NA 1TK3A 3PDHA 3ESCA 2QAIA 1S9HA 1LY1A 2JLAA 1I2BA 3HJGA 5CLHA 3BL6A 3IVMA 2FEAA 3AI2A 1MR1A 1NXVA 1MENA 4ES6A 1R88A 3KSRA 1F2DA 1L4UA 4OP3A 3SKYA 3AR5A 3OC6A 4KPUA 3CVOA 1A3CA 1J4LA 3MRSA 1J20A 4ZCRA 4FE3A 3HKDB 1JTEA 1KFCB 2JGDB 5JMTA 1C2TA 3DEKA 4KXXA 1YKSA 1T5BA 5BWMA 1GG8A 5LOVF 1CP3A 1FMFA 1JF8A 3GEGA 3ZBQA 2DBQA 3U7QB 4CHGA 4Q3AA 1G5TA 5KTKA 2BM1A 1CR6A 4O2AF 1XPOA 3FUTA 5IJWA 1IVSA 1SG9A 1X1SA 2QU8A 3R09A 4R9SA 3STHA 3W2GA 3WGUA 3HJRA 4F46A 4JL8A 3UENA 2IVFA 1MQAA 4LX0A 1XDGA 2XITA 3H5AA 3IEKA 3WLMA 1ZR4A 3FHOA 4TKZA 1MD9A 4AI6A 6REQB 5A3QA 3L7BA 3I9OA 3M6WA 3ZXXA 4DA8A 3G0GA 4F2PA 3MHTA 3WB0A 4DCTA 1IOWA 3QVXA 2K4MA 4A26A 4C0AC 1QFJA 2EJCA 1RYHA 2B1JA 3OTHA 4BLWA 4NNOA 2RI1A 1AUQA 1CQJB 1RPNA 4L8VA 5C4VA 3ND5A 3L77A 2ZATA 3I39X 3LC7O 1K5HA 1QYRA 2C5FA 4W8OA 3F67A 4GLFA 4MJ7A 3QIAA 1YSCA 1T4BA 5CA1A 3HFJA 4JUFA 3N05A 5CYGA 3U37A 2C5AA 4BU0A 3EQ7A 1BNCA 1CEXA 1EBFA 1UEIA 4IDEA 5L3SA 3VPBA 2Y1KA 2TSYB 4PQFA 3IQZA 2ATVA 2GA8A 1Y7LA 4FYXA 4J6EA 5IKOA 1H94A 1V5WA 2FPLA 4EVQA 5FDFA 4PLHA 1SXHA 2EJUA 1DB3A 2C97A 2O54A 4EX6A 4FCWA 2PQMA 1HORA 3GXBA 4OJTA 5EP1A 3GFGA 2OORA 4LCJA 4RHUA 5L7YA 1C1DA 1YS2X 1Q0RA 4BIIA 3VPAA 1MVLA 1EE2A 2AC7A 2ZSUA 4G01B 2O57A 3LKVA 2J5BA 2PLNA 2PS1A 4LWZA 2UV8A 1P4AA 2EZTA 4BMCA 1RBZA 2GYYA 1U1FA 1B00A 2RAPA 4ECEA 4CEHB 4FNGA 5CEJA 3KEGA 5LQDA 4S1TA 2X76A 1GQ2A 3FW1A 3RYFA 9GPBA 3TZKA 2R0QC 5AM4A 1CG6A 1NW3A 3T7KA 1MX5A 3SFZA 2NT3A 4UCQA 4HLCA 3WX0A 1CE8A 4NYIQ 1TI7A 3LD9A 2BRFA 1NKSA 1V7PC 2DULA 5BO5A 3EEYA 4JB0A 2C7QA 2QT9A 5A71A 5EKXA 2BP7B 2PRIA 5EJMA 4DCUA 3DTNA 3FB1A 4FHGA 5LYYA 3EXG2 1K06A 3I9MA 4OQLA 1XV5A 1Y8RB 1GZSA 2JIRA 4QUJA 3GJYA 2E82A 2UVDA 3BOSA 4QFBA 3GNLA 3QLTA 4ZQFA 3R5HA 5G4KB 5ICCA 3IDQA 3OU6A 2ODEA 1OLXA 2B98A 3PPIA 3JQAA 4D4LA 4UUAA 2OBLA 4V0OA 1P4RA 4RZUA 2ONKA 2AFVA 3KKKA 4UVEA 3X1JA 4AMZA 5IZ4A 4II3A 5T67A 2ONCA 1NU6A 3PB3A 1PR5A 3ERCA 3KELA 4Y6LA 2QRLA 3DV2A 3A9SA 4KFUA 4ZHQF 3FCUB 3TQFA 5ULLA 1IBLB 2P4HX 1ZMXA 2QUZA 3AWDA 3IOCA 3IE1A 3AL0C 1U9IA 1N4AA 3WGOA 1HT2E 2G63A 3BRSA 3DZHA 5CB4B 3AF1A 1Y5LA 3BXOA 3HBLA 1P5RA 2P62A 3I0ZA 4HQNA 3RK1A 2O4UX 4C0SA 3NZEA 3AKZA 1QCZA 4YCJA 4MWBA 3PC4A 4YREA 3F3MA 2RGNC 4A2PA 4GW3A 4PG5A 4FYVA 4RAOA 5A1TA 3BFJA 5LD2B 3LCRA 1CJUC 3Q10A 3R0VA 4RGVA 5AP9A 2Z30A 3ZV4A 4AWAA 1V37A 1EP9A 3R7WA 1D2GA 2MSNA 4N39A 3MINB 1UDAA 4M60A 4RXUA 3N0VA 2E5LB 1GIAA 1N6NA 5ERGB 1VZ3A 4PZYA 3GD7A 4GR9A 1BMTA 1PYDA 3RDPA 4WLFA 1DO0A 1FUYB 1DC8A 1Z3IX 1GU0A 4BMYA 5JS6A 1QJCA 4H31A 5HR5A 4OTZA 2Y6UA 3K0FA 1QORA 1C30A 1ML3A 3JQAD 2FAXA 4IXMA 3DHWC 4L8YA 2JZCA 2HA7A 1GUYA 1PZFA 4ZO8A 2XQIA 2DUMA 3T9CA 3ZV7A 1GPMA 1IY0A 1SOMA 5H7XA 5TB5A 4DR7B 1ZM4A 4MHSA 3H17A 4UFOA 3SSOA 1JSCA 2ESRA 4B6JA 2BT4A 3P97A 1JDNA 1NLUA 4YRIA 1A7KA 3KJXA 5ITSA 4AKEA 3V3TA 3DV0A 2TECE 2V7EA 4EAAA 2UXBB 3FCAA 2R5WA 1YI8A 2HY7A 3T61A 4RU1A 1X15A 3SJCA 2VDVE 4O2RA 4BO6A 1MG0A 1JLLB 4GXQA 4BX8A 1SVIA 3QSYA 3ZCSA 1E5XA 1Z6GA 3CZ5A 1IJFA 3KKEA 1E9DA 3MJVA 3V5NA 2V9PA 4MKZA 3K6KA 4ENUA 4XQCA 3GPDG 1TZJA 4WNIA 1ZUWA 3K73O 4WPGA 4FEEA 3BXPA 5JLJA 2AFFA 4YJGB 5EE5B 4ARCA 2DWCA 1N6RA 4E08A 4KU0D 2QMYA 3TUJC 1QLWA 1T9DA 4WUVA 4KZPA 4AO6A 1S2IA 3FMPB 3ZK9A 2O5EA 5B1SA 5J2TF 2V3WA 3VC2A 5L8VA 2V9CA 1GV0A 3CUWA 1TVMA 4D9BA 1QCYA 3GMSA 2YHAA 3G0BA 4XYEA 4YT2A 1LRKA 3UHPA 1OROA 1N1GA 2G8NA 3EW7A 4PAMA 3KQKA 2G72A 3HVUA 4KK3A 2AC4A 4WOJA 4B76A 4CW7A 5HHTA 4ZV4A 5EZ5A 2IV7A 4CM7A 3RU9A 3IKTA 1E58A 2GRUA 4IKEA 2XAAA 1WXEA 4MPPA 4O08A 4LE0A 4KQHA 4WEOA 3VKUA 4OYYA 1JFFB 4FDVA 3RROA 1GGMA 3AKCA 2GHIA 3IC5A 1UKAA 1NJ6A 3N0TA 2FN9A 4JHXA 4RE5A 2AN1A 5ALHA 3SSNA 2OFWA 2QTVB 4QQFA 1Z47A 5B3KA 1DBQA 3C2QA 3MTEA 3O03A 5C4IA 1PVOA 3L7YA 2NG1A 3ZU4A 1T25A 4RNDB 2MSCB 3OE7D 3ZJUA 5FI3A 1NY6A 4TLEA 3I62A 3F5SA 2Q3JA 4LZLA 3NHUA 1ODKA 2MDTA 1PT5A 2PBZA 2Y0EA 5I3ZA 1M0WA 3MMNA 2IE8A 2D0OB 1PK9A 1FBTA 1ZYUA 2FKAA 4RKRA 5AHKA 2XYQA 4NZPA 4JBWA 2CNBA 1EFVA 4ECAA 4EGFA 3EUFA 3C8ZA 3G0DA 4YRMA 1BX0A 2AR7A 3R6LA 4I55F 1S3SA 1BJTA 4MO9A 3EHDA 3K70C 4QDTA 3N6RA 1U2SA 1F2TB 2ZK7A 3GFVA 3KOZA 4KFTA 3NRBA 4X3OA 3GJXC 2CYAA 5EXXA 4DQVA 1N8TA 1O0BA 5CU7A 2RHRA 1O6CA 1RM4A 1XPJA 4WLEA 3E23A 4O4HF 1TVEA 1M1NB 3ZWCA 1YKFA 5LR6A 2VH5R 4M1MA 3GG2A 3I09A 4CN8A 2CWDA 1TL7C 2YTZA 4ZOCA 1U0GA 1WM1A 1HT1E 1KU0A 4IJKA 3HV0A 4XYMA 4IIJF 3O6VA 4K88A 2UZ3A 1LH0A 2H07A 2ABWA 2W2LD 2IIQA 4XASA 2IZ5A 3EIFA 3K6JA 2RKWA 1H9AA 3DS8A 4IS2A 5E95A 2PKRA 4N7MA 4OF4A 3DFZA 1EHCA 2H11A 2NZXA 5BWLA 1WZEA 1JDSA 2SKDA 1SZCA 1H2EA 1Y82A 3JCZA 3QSGA 4CG1A 3BJEA 1AH2A 3L0IB 4N7JA 1P62B 2VHXA 4HF7A 5CDHA 4TV8B 3A11A 3JQRA 3MCAA 1WHTA 4XEUA 1FP7A 4QDZA 5AK5A 4E31A 2FN7A 1R4AA 2DE0X 4NJMA 4NX2A 2WE8A 1X0VA 4YQEA 1S7GA 1O89A 1TW3A 1YZTA 3SMQA 2ZBQA 1ULUA 1W5TA 2CZGA 4TTPA 2ZI3A 2WJGA 2ZJAA 2MMGA 2ZVQX 4GOOD 4U7FA 3UHJA 5AW2A 1XEAA 1G98A 4IQFA 4J29A 2NQ2C 3GA5A 1W85A 1K8RA 3CYFA 3CRMA 2YL2A 2HEGA 4OGGA 4LC1A 1ZINA 4I46A 5C5CA 3AUTA 1BSVA 2D8AA 4DN6A 2H57A 3K0CA 4QXMA 1PUXA 1J42A 1XCBA 2Y4OA 1CTQA 3PS9A 3ER9A 4B3CA 4IDBA 4ZVRA 2PZEA 3IH5A 4IXNA 1SR8A 1DLIA 2V6BA 2WM2A 1YQTA 3PI7A 3OX1A 3NIBA 2QR5A 3LE8A 3LTEA 1W59A 4MS1B 3P9YA 2PXCA 2X58A 1FU7A 1QNLA 4O25A 4YGXB 1IRXA 1H2YA 1LV8A 2XDWA 5IDXA 3FDZA 5IH3A 3ELSA 3Q15C 1FYDA 1BG6A 5BQPA 2Q9BA 1BWRA 5TEVA 1QTIA 2B1IA 2E7ZA 3ACCA 2UUCB 1I80A 2ECFA 2D54A 3LUKA 3I5MA 4B32A 1TD1A 4LSZA 5C7LO 3GMIA 1ZKMA 4LJ6A 4ZVMA 4BMSA 3LTNC 4F3TA 1N2GA 3NW9A 2HSDA 3LHIA 5ICGA 4LISA 3ZY3A 2F62A 2XOKA 2OAP1 5U9CA 1NMQA 1W4CA 4I9GA 3GDWA 1I3OA 3OZGA 2R1ZA 4RTSA 2Y67A 2IXAA 3I2IA 4LXUA 4F3RA 2Z2YA 3EODA 1E59A 3OKAA 4H3HB 3A1CA 4C20A 2ZBFA 5DNVA 5IN5A 3NVDA 4HEHA 4LRSB 5D5PA 4KPYA 3D7KA 2FG5A 3N2NA 5E6UB 2OB1A 2ZUEA 1QKIA 5HCUA 2GNOA 1JLHA 2ZJYA 2ACVA 3I1YA 3N59A 4YJKA 3KR2A 4ZDIA 3FTPA 1QGYA 1YUNA 5LQMA 2VHWA 1LWOA 1MX9A 2NGRA 4HO1X 4PPQA 3NLLA 4TV9B 1LSOA 3SJ7A 2ZSDA 3RVOA 3M2PA 4D0NA 4RULA 2DKFA 2Q4DA 3SFVA 5KKNB 1VPVA 3BQNB 4HZIA 1L5ZA 4A4YA 1E1QA 1FS4A 3KZVA 1YHNA 5DLPA 3DYBA 2I4OA 3L40A 1U6JA 3WG9A 3MJSA 5AQ1A 1IB0A 1ZK1A 3UJHA 4C05A 1JSZA 1EJ6A 2Z1NA 3FVQA 4HUQB 4ICIA 2JL1A 4IJWA 4YRPA 4UU0A 3EF1A 3K92A 2R8PA 5EESA 3SJUA 4GICA 2O48X 1VG1A 3PEFA 4QL3A 4W82A 1QBGA 4Y0NA 5EIWA 4EJSA 3N3AC 4G5FA 4BHTA 3PNVA 4C4OA 2HBQA 1P4HA 1J2UA 3AEZA 4U39A 2RSLA 3TL6A 1PWEA 2UKDA 3WRXC 5DF1A 2R97A 2OM2A 3RS0A 5BT9A 2GERA 2HA6A 1FFXB 4KPGA 2BW0A 2VH1A 4L73A 1KEKA 4ZKDA 1JFFA 1YQEA 1YU9A 3G23A 3MMXA 2PSJA 4DV1B 1FXUA 3AMVA 1M6HA 3O8LA 4FDMA 4ZT2A 2UZAA 3RUCA 2R6GA 4EO9A 3QKRA 1DXYA 3SSAA 5M3BA 4D57A 4DAOA 4GI3A 1NLMA 2AOXA 4JJIA 1FTQA 5G0VA 4Q4AB 4A91A 1ID8A 1S8FA 4OKIA 3TCKA 3H9JA 4MDYA 1KY5A 1CUXA 3EVZA 2CNKA 2EU8A 2QSZA 3V1TC 5ALTA 3RBZA 4AF8A 2FFJA 1CYDA 3RWBA 2EBUA 4G5YA 4DC9A 4RZXA 4F04A 1I10A 1S01A 1F7UA 4JP8A 1MTOA 1W36C 2P9HA 2X3UA 2PXXA 5FI1B 1SKYE 3U9SA 2CKMA 3CX8A 2IRWA 1RPTA 1DHTA 1DNPA 3VSCA 2IYYA 1F1BA 2B8EA 3QWAA 1DZIA 4HYTA 3UHAA 4UPVA 4YRTA 3WRXA 4EFNA 4DJAA 4PSAA 3T38A 3V48A 4AQYB 1JDBB 3D8RA 4FVTA 2W2PA 1CQIB 3GNTA 4K9SA 3WTBA 4KWCA 2EYUA 1E2KA 2XYHA 3T1OA 2ZPTX 3MD0A 3V8EA 1NNEA 2G1LA 3NBAA 3D5TA 2EFGA 4R9PA 3PHBE 2G4VA 3R7SA 2GTHA 5EKSA 1W75A 1Y5RA 3TPCA 1E9AA 2A7QA 1NQWA 2ZSEA 4U7TB 3WV5A 1L5VA 3ILSA 4NLLA 4DLNA 1XRMA 2ZRNA 3DAHA 3ND8A 2H4ZA 3VX4A 3WO1A 3EZGA 3DHNA 2NV6A 4JI0B 1HDYA 3DG9A 2PUHA 5BT8A 1PZMA 1VJCA 2FHPA 1IJBA 3DB2A 4JJKA 4BMZA 4DLUA 1QHSA 1W88B 5HDQA 1TIKA 4RLFA 2Z83A 2JIZA 3PUYA 2JGJA 3DLBA 1I36A 3CSSA 3JQAB 1M33A 1RFLA 4X91A 4FMCF 1EH5A 1QTNA 1I2MA 4A8PA 1NOKA 1WOMA 2BHLA 4D3FA 4L4YA 1UC5B 3L6UA 2OCGA 4HN2A 2A9KA 3ZK7A 3DTYA 4PCLA 4G2SA 5FLEX 2WAXA 4N3BA 5ENDA 1HSOA 1S8NA 5AOAA 3CE9A 3CWZA 1KZ1A 1Z83A 4RELA 1G7TA 2R1TB 2V6FA 4L5YA 3NONA 1ACLA 1S7CA 1CB0A 2P77A 4QNMA 1B16A 1R0ZA 2PH3A 3CONA 4B7ZA 4CCWA 1XNGA 2N9UA 4QBKA 1ZW6A 2C7BA 3EZNA 5IVIA 3RSFA 1W35A 1R0SA 4WCVA 1K6IA 3HU5A 1LX6A 5LYJB 1LPPA 4BASA 2ZYSA 1GAQA 3DDHA 1R74A 1V16B 1TD9A 1SUAA 2Z04A 1CY2A 2BEUB 3LGSA 3GFTA 2ALJA 3PE3A 5EPOA 4YRCA 4CIWA 2YJ3A 4P4NA 2BTOA 1GL7A 1OFTA 1ZJ4A 2ATIA 3AY6A 1TAGA 5FBQB 3RIYA 3TQSA 3WB9A 1GEEA 3ICWA 3LY5A 3PZBA 4TLAA 1LVUA 4ONEA 3P4UA 5GJVC 4OUKX 1EKXA 3BBLA 2Y05A 3UJ7A 4LJYA 2B34A 3D3NA 3N7UA 4B6PA 1WXQA 3GPLA 4TT3D 1OT3A 1GFSA 2Q49A 3DO8A 4UHKA 5FX2A 3UYLA 1AE1A 1O77A 2X15A 3PRHA 4GKVA 4PC1A 3O92A 4FM9A 5BWOA 1SKBA 1Z7EA 3H2JA 1KDYA 2L82A 3L6RA 1XTIA 2XCIA 1U1DA 3L7JA 2VNSA 3LPCA 4YYEA 2H2FA 3QOWA 4F84A 2UUAB 3IJ5A 4DDWA 1XNQB 1P33A 3SS9X 4CMEA 2NVUB 1HEYA 4URZR 1Q7TA 1EP1B 2JZNA 1MA3A 1WTAA 1UBSB 3NKFA 2CXQA 2V97A 4RV4A 4DRZA 2DHEA 3Q7PA 4G5GA 1E92A 2O3SA 2ZIFA 2C4KA 3D4BA 5LCXA 3EIXA 4IOLA 1LI7A 2HQRA 4OHOA 3B6ZA 3DE2X 2Z1MA 4BAGA 4DHEA 3AJDA 1Q12A 1TQ2A 3WE7A 4X8MA 2OZLB 2QT1A 4H59A 4Q7EA 4MVJF 3AOEC 4YRNA 4B7CA 2XB8A 2GS9A 3DXFA 1ZJWA 1K1EA 3BSWA 1GUDA 2PIDA 1T8RA 1ZXBA 2FWMX 2PS0A 3TQQA 2GVDC 4ZJPA 3KHKA 1E9CA 4RZ2A 3TXXA 5DBOA 1OWOA 1SKYB 2FUCA 5DGIA 1O6ZA 1YMQA 2VJBA 4TN1A 1R4NB 3EA5A 5IBQA 4F3CA 4LSWA 4RHTA 3WLFA 2PCJA 4ZI7A 4FBMA 3LO5A 4D4HA 1T9GS 2GTIA 3E18A 1LTKA 3UY4A 3A04A 1HMYA 1YOBA 1II8A 3DW1X 3DZDA 3GJ0A 4JMLA 4K0RA 3TZBA 5B64A 4KAJA 2FDXA 1C9EA 1C30B 4N47A 4LDPA 3N76A 4LYAA 1AQIA 1Y7IA 4WESB 3RW9A 4B1FA 4YONB 2XVZA 1DX4A 3CX6A 5E6RB 5I48A 3RQIA 2GVNA 4NESA 4COKA 1REQA 1XCPA 3G5LA 1ULSA 1J1IA 3PQ4A 5DTMA 4C4AA 3FUCA 4QJBA 3GLHE 5ADHA 5AW4A 2QEQA 4NU0A 1U1EA 3OIDA 3OAAA 2PJRA 2J6CA 3KLBA 2B2XA 5JD3A 1B7GO 4TS1A 4WK6A 5K4AA 2VRCD 3BCHA 4L76A 2VNHA 4CL0A 1EWVA 3U40A 4BWFB 2R8XA 3THOA 4RIIA 3T7JA 3V8PA 5GIOE 4UTZA 3TG8A 3K70D 3C3PA 1VC2A 2OLJA 3RRFA 1Q0LA 4ML3A 1QP7A 3ZCQA 1J39A 9MHTA 2BFBA 4MR7B 1PT8A 2H48A 2ZJOA 1WW3A 5GOTA 4LXQA 4YPOA 3W4JA 5JCJA 5M2QA 2B8NA 1X7GA 3BBPA 3MC1A 4GLJA 3RU2A 4MV0A 1HH4A 2I7XA 3CN9A 3KKNA 5J5AA 4RTRA 1I1QB 1UKZA 2VCEA 2YYAA 4LNHA 1VLVA 2AFIB 3VAZA 521PA 4D9CA 1Z35A 4CRWB 4OBEA 2PGOA 1GG2A 4HY3A 4M7WA 4UE6A 1BROA 4ZU6X 4WN9A 2JJYA 1EG2A 2ZUWA 2I7TA 4ND3A 4K9LA 3AVQA 5CA0A 1B42A 1XEFA 4CV1A 1NVVR 4MJLA 1GZ5A 1TGYA 2Q28A 4G4SP 3OHSX 1LW6E 1UBEA 1F2TA 1NW7A 1KBZA 2V96A 3PGXA 2ZYRA 4BNWA 1IHXA 3N0RA 1EA5A 1OI2A 2ZRJA 2ZUSA 3VVBA 1RWMA 5KOIA 2VUTA 3CX3A 2WMNB 3IIEA 3ZVMA 1DI0A 3E3AA 3GMJA 3HYTA 2WKSA 3N2EA 3X1XA 4DA0A 1QOPB 3OZAA 4Q1FA 2ZJ3A 5JZBA 3QG5A 4RY9A 3VTFA 5JPDA 4DDMA 3RCBA 3IQEA 3EFBA 4DR2B 3ZVKA 2OOSA 1PWYE 3SBXA 3LLMA 3DEFA 1G17A 2IZ7A 4UU1A 2F59A 1R0BA 2WWVD 5AK0A 3AR4A 4XEHA 4DVGA 1ULTA 4Q3OA 1MO2A 3REOA 1I2CA 4P32A 3U5ZB 3KPYA 2JPEA 1M0SA 4C89A 1X0XA 5EEGA 2VNAA 2W2KB 3BWBA 1I0LA 1XDZA 4UHEA 3U4QA 4OGFA 5D51S 4IDCA 3OFVA 3WK8A 3FLEA 3FWHA 3M3PA 4O2LA 4BFLA 1F2UA 1T6NA 3CS3A 3D6HA 5F1OA 4YIKA 4D99A 3HYSA 3RASA 1QH1B 5CG1A 1RQPA 2DT8A 3KD2A 4CV2A 1XC7A 4BQQA 3KQPA 3QPUA 4ZYLA 4AKGA 1KQOA 5A2QA 1E94E 2BJHA 4YXFA 2DFTA 5KCMA 1C8BA 1EUCA 3JATA 5DN9A 3INRA 3G13A 4P2BA 2MINB 3ILXA 4OMDA 5ALSA 1NN0A 5ELLA 1GNSA 3GNSA 4FINA 3L06A 3WFIA 1R8JA 2QD3A 2IH5A 4URYR 2WC1A 5FNZA 5GM1A 3EULA 2XMGA 3PFHA 2FEZA 5KSZA 2EARA 1IH8A 3BX1A 4GQAA 2Z6UA 3T3HA 2R7MA 5FORA 3DFMA 3B89A 2COKA 3WWDA 4IXDA 3HS3A 4H3VA 4W7HA 1WTCA 3TTWA 5BNZA 1WCYA 1X7YB 1MO3A 2CW5A 1F5SA 1X9IA 4HFMA 4RIFA 5M34A 2EZ9A 4HRAA 4RS4A 3L5KA 4FCVA 5BOSA 3DYIA 3W05A 5J3JA 2QYHA 2GNAA 1I3KA 4KI0A 4RDXA 1R10A 1EXVA 5JNTA 1ETHA 2HL6A 4FHCA 5CGZA 4M0KA 4CKEB 2XB6A 2PL5A 5JUWA 1KDZA 1UH5A 1G64A 1HV8A 2I1QA 2UUPA 4EJSB 1H8HA 3CRNA 3LQKA 1PJZA 4KWHA 1CV2A 1QK3A 4O4JF 3C3KA 4ZT7A 1SC1A 5FKJA 4HVAA 4B83A 4QLBA 5C3MA 3AFIA 3IUEA 4YP0A 3UMGA 4EYSA 3NHMA 3ZIUA 3MT7A 3HB7A 1TJ3A 2QROA 1OLUB 1GPKA 4JN6B 2BI7A 3SBEA 1N5LA 1NN5A 1AK9A 5I47A 2HSJA 1KY3A 1EWQA 1QK4A 3VDRA 4JFAA 2V7XA 1EQAA 2FB9A 3F6BX 2B21A 1UPBA 2BR5A 1Z75A 1ZH8A 4C0KA 1VCIA 3KQMA 1Z34A 4G0YA 4R5MA 3AZPA 4IDDA 4KQJA 3R0XA 5SZKB 4AJ9A 1I4WA 4D96A 1EXMA 2QAGB 3CJQA 4ISBA 3ROFA 4ENVA 1NMXA 1IHPA 1JAXA 1YKGA 3RUFA 2YMPA 4P8RA 3ZJTA 4EMUA 4PC2A 2GEDA 3IHWA 3NEJA 4LV5B 1TQ6A 4W5JA 1K2MA 3OLWA 3KHTA 4DYVA 2F55A 1FDIA 4JK3A 2XT0A 3OQ1A 1CLEA 4KYUA 1BVHA 4F97A 3WA6A 3D02A 1DEVA 4MUNA 4ER5A 2EEPA 1NC3A 3T5GA 1PEYA 3V7WA 4YV1A 3FUVA 3LYHA 3AI1A 3HKCB 1KQPA 3GRKA 4WACA 3U7QA 1WCWA 3GVIA 2Q2QA 1NYTA 3PPYA 4P4SB 3IRUA 4FK8A 2A0XA 5D1NA 2A3RA 4CUJA 5A4KA 1Z2DA 4IGAA 1U0RA 2ZIGA 4HZUB 3KQYA 2RHHA 5G3YA 3ADKA 4P0QB 1CZNA 3BILA 5L53A 1GA6A 1XNJA 4UMDA 1E1DA 1FRFS 3DUWA 1TM7E 3L04A 4BNKA 2O8EA 3KHSA 1KHUA 2WYUA 3FPLA 4U9IS 4KAXA 4XIGS 2EG5A 1J8VA 2HMUA 2D1SA 4MVYA 1USGA 4ASUD 5I7VA 2FZVA 1UWCA 4E33A 1Z8DA 3CU5A 5I9MA 2YRFA 2X7JA 3FX2A 3IUSA 3MWKA 2OYSA 2XBUA 1X6VA 3FB4A 4MS4A 2WWFA 5DJ5A 1UFVA 3RARA 4NE7A 2JA1A 4G4IA 1UAAA 2ENUA 1DUSA 1P9WA 3HWWA 2DWPA 3LKBA 1MKYA 3UUWA 1CUWA 2HGSA 1L5HB 4BPBA 3WRYA 1AU9A 3LHKA 3E7PA 3M4JA 4M1KA 2IU0A 3PL5A 3TTSA 1FUKA 1LCIA 1KKUA 3R2JA 5L4NA 4BFWA 2O2EA 4HDNA 5DRTA 3UUEA 3GLIB 1KFBB 4UUBA 2AN5A 3D31A 5FTWA 1NJ1A 2XYVA 3K2QA 1CUIA 2J9XB 4OJKA 5B4VA 3R5FA 4HDSB 2IUTA 3PR2B 1JDZA 8ATCA 3USCS 3PIIA 4AZ0A 1CRZA 5AJXA 4X84A 5EHIA 4EGSA 1IK6A 4YFYA 4KNYA 4PSDA 2ZJ5A 5CM2Z 4J8PA 1I4EB 2C7VA 2Q5JA 2LV8A 1RYZA 3EISA 3OPMA 4WLVA 4MW7A 2GN9A 1PNVA 4FWTA 3KUKA 2VNIA 3E9YA 3PRKE 4BLVA 3ICPA 3KJNA 2FFBA 1AM4D 1FS5A 3PF9A 3OOHA 4E2WA 5IT4A 2XUOA 5LQCA 3ZS8A 1UBRS 1WL8A 1LSSA 1ZGZA 3K09A 3RAEC 2V0GA 2B7BA 1CHDA 1JEOA 2NU6B 3BWYA 4HWGA 2QQ5A 3GEMA 4E6EA 2O2CA 2ZKLA 3HLKA 3Q7SA 4C7VA 3RT1A 1UBKS 3CEPB 3V8NA 2NMVA 4CMAA 4X92A 4ZCQA 4GMHA 1ZCZA 4INZA 4BBPA 3TNFA 2AJLI 4L22A 5CFRA 2GK7A 3FG9A 2QRNA 1F38A 1E7QA 2NO4A 4KHZA 5D3ZA 3ZR4B 3BREA 3LP8A 2NZ8A 4KC0A 4WZAB 4MNTA 5H70A 3FTFA 2A1TR 2Z9CA 5KTSA 1YV9A 1PR1A 3PHLA 4JQYA 4X54A 3ZPXA 1COWD 2PO5A 2ZE6A 1WBDA 2MYUA 5DNYB 5JNUA 3R7DA 3VV2A 1ONPA 1BVRA 1JKJA 1Z6TA 3GMDA 4DNPA 3IA2A 1DGQA 3NAZA 3QMVA 3QLVA 3D0KA 3OAAD 2RGUA 3O73A 1UJXA 1TZBA 3LW8A 4JD5A 4MR9B 5AJTA 3UTDA 1MOZA 3IAXA 2H06A 3LQ4A 4A8HA 2XDYA 1OXBB 2XQVA 2RI0A 2ZJ1A 2ZJFA 4C4ZA 2XH8A 3B1JA 1HXHA 3ZDBA 2IUYA 2Q5LA 2XCQA 5CFLA 3NOOA 4ZGGA 1C0KA 1H66A 4L6AA 4NMHA 3PWSA 1IXZA 4A0EA 1Z68A 4NHEA 2XD9A 1IBSA 3FPJA 4DA9A 4DMLA 4BGDA 1QGZA 1QVVA 3DMGA 3HDGA 3ZE2B 1Q84A 2RAVA 1YQGA 3UWOA 5DT9A 5K9ZA 3EA0A 4H1TA 4A2QA 1QRSA 4C7MA 2QTWB 3H2SA 1POXA 4IH9A 3MQ4A 1CULC 3IIKA 1P7YA 4PBRA 3B6MA 5A7HA 3RG2A 2I8CA 1YE5A 3IHLA 4EW2A 3OPYI 2H6EA 1G6GA 1O0SA 1ONOA 4PX5A 4W63A 2C59A 2J3KA 1U7ZA 4KQ6A 1T34A 4G5OA 5D8DA 2B4QA 1VRWA 3FI0A 3OE7A 3T5MA 2EGGA 4P31A 1WUKS 3G2LA 3SXJA 3UKJA 1XTJA 1A88A 3IEMA 3MSCA 3DEYX 2GN4A 1N6IA 3ODPA 4QYXA 3FLAA 2CB0A 1X1TA 3COWA 3PNPA 4ILEA 3IBFA 4M98A 1RYMA 5F33A 1WZCA 4HMPA 2YWHA 2A1UB 3ZHCA 4AP6A 1E9VA 2CNDA 4J7UA 4MZXA 4E94A 5GADl 4NICA 3U26A 2BMWA 1A4IA 4EELA 5T8KC 3AF4A 3JU3A 5JWHA 3CN7A 4BV8A 2JFXA 5G0UA 5H5JA 5CK4A 2AT1A 4Q1DA 4NJEB 5I7WA 4JP1A 3P52A 4NQRA 1ZHHA 1W93A 4N41A 2JD2A 2NTNA 3IHKA 2R5FA 4Z2YA 1YCGA 4J75A 3ITKA 4PYNA 2CFSA 4AXXA 3UMMA 1Q92A 4Y2VA 4J0QA 1CQPA 1RRPA 2IOHA 2RHMA 5J4HA 5GVSA 3CVWA 4JDUA 2OBNA 1Y80A 4DKJA 3AX6A 3NWPA 5SICE 2MWMA 3K1ZA 4MO2A 2ZR7A 2WHXA 1SGWA 5K3FA 3U2QA 2Q62A 2RGBA 2QYSA 3LK6A 1C3VA 1J4OA 1X7DA 5EVJA 4QXAA 1HOXA 1E2HA 2GAOA 3NX4A 3RTCA 2VQDA 4N1AA 4M53A 3AUJB 2O3JA 4N49A 1X8KA 4ZK6A 4UQLA 4AQ7A 3SG0A 4EJMA 5K1ZA 4HQ0A 4RE6A 4XB1A 3DR5A 4QSHA 3DULA 4AUKA 1X1AA 3E8SA 1JLKA 1ETUA 2ZIXB 1HE2A 2GKGA 4R2IA 3W79A 1K88A 3CZCA 4OFZA 2IOFA 5AHRA 4JYPA 5AUNB 6Q21A 3AR3A 1RYFA 4IS3A 3TS1A 2JCGA 3V97A 4C1BA 9LDBA 5JZVA 4QECA 3E35A 2BE9A 4JGGA 4IV5A 2FCRA 1PJBA 4IP0A 3AQ4A 4PAQA 1JBKA 1R27A 2QTTA 1MHPA 1VE7A 2MT9A 1DKPA 2EJWA 3WOVA 3G17A 3F5QA 5AM3A 5LZ9A 1LBTA 2EIXA 3DAFA 3R4VA 4XGQA 3RS8A 2I7VA 2W6ID 3QITA 2HJHA 4D4KA 1YDMA 3LWZA 3P0HA 3S1AB 4DT1B 4MVJM 3MEQA 3FR7A 3O1LA 1G5FA 3OIGA 4XWKA 5DULA 1J00A 1KKMA 3FDJA 3MN1A 3GCGA 4RANA 1Q1EA 2WMOB 1GUZA 2CFTA 2C95A 1WDLA 3BKWA 3QUBA 4WBNB 4YS6A 2AVDA 3DMDA 1YRQA 3NHPA 3QE9Y 1CUCA 4IICA 2VI5A 4ZZ2A 2Q27A 2ZBPA 4AG3A 2XGSA 4AD8A 3T8YA 3ZY4A 3FNGA 4QOEA 4TS9A 1VGRA 1VJTA 2PK3A 5EQJB 1VKHA 3DMNA 3IKJA 3JQ7B 3W06A 1DEOA 1NURA 3GFRA 2WY2D 2GLUA 2W58A 2VUIB 4WNYA 2HA4A 1T2UA 1U90A 2ZB4A 1ADYA 5DYNA 4G09A 4ERXA 3PEEA 2CDCA 3UJ9A 2IEIA 2W2TA 4BO9A 4Q9HA 1E20A 2XRMA 2PMEA 3MB5A 1NAIA 2GCOA 2GMWA 3RAPR 1SBCA 5FADA 3ADBA 1GG9A 2C99A 3WIDA 1LJLA 2H7VA 3PCXA 3TOVA 2JJ1D 3L92A 1YJMA 4Y2GA 3RSSA 4ETWA 2ZIAA 5G1PA 1AGXA 1QP8A 1ESCA 2VXCA 3KRTA 4JQOA 1DAHA 1X86B 1F14A 1NPDA 4YP7A 3ZDXB 3H8JA 4D82A 4AKHA 2LXNA 3PPWA 2YQ5A 3GR6A 4GOLD 1JAZA 2MJLA 4L7QA 1GQYA 4F56A 5ISMA 5IMBA 1NQTA 4ZAXA 2EBWA 4HC4A 4A16A 4B47A 2IHVA 2C2ZA 1L4HA 2GZSA 5LZ7A 1O9GA 3VR3D 4NF2A 2AOUA 1MAUA 2HAEA 1DRKA 2CLCX 2CLDX 4Z9AA 1CR4A 1DDOA 3SAJA 1I5OA 4I4TB 2C03A 4F11A 3EE6A 4YMHA 3HXOA 4QXQA 2VYFA 1V1MB 3D6TB 3SHWA 2AL7A 4IVNA 5EKDA 1KGSA 1EFHA 3F6PA 1NVGA 5HKLA 3K35A 1Z33A 1KHXA 5FQOA 3YASA 2DLDA 4MKXA 3L5OA 3D2CA 2C1EA 2EP7A 1E64A 3NANA 3WL3A 2FR8A 2EQAA 2X41A 2O4CA 1JIJA 3QMMA 1Y3IA 2E85A 3BGIA 3KBOA 4DIBA 3DPUA 3ORFA 4V03A 3DKVA 1R0XA 1KO1A 1JQ3A 2HIAA 3DBRA 2B83A 4MUFA 5F51A 4CQLA 1EINA 1KR5A 4G25A 4PG6A 1J8DA 1MAAA 1A0OA 2V58A 1RXEA 1DTWA 1T6BY 3CMMA 4IYRA 5CXQA 2VDNB 5EZSA 1RZVA 3I83A 4IX1A 3RM3A 1PV4A 3FFWA 4LRQA 4D4IA 4BNYA 2AIRA 3VPHA 3PX3A 3PXBA 1XFAA 4MUYA 4AO7A 3TOSA 2BFWA 5F9FA 2Q50A 2RK4A 3JVVA 4FGZA 4RGYA 3VZRA 2F8TA 4DIDA 1BWQA 3GIWA 4YALA 2YW2A 2ZSJA 2X2EA 3O75A 4U6QA 3KL2A 2WAAA 5KYGA 2F43A 2Q3BA 3ESQA 3OJXA 4ENSA 1JILA 1Q1NA 5HGJA 1GFIA 4AJ2A 5FWXB 2N3ZA 2FSGA 5L4SA 1NQ5A 2FY8A 3FMFA 3IKLA 1EDEA 1M7HA 1VPTA 2JAQA 1XAHA 3KETA 2J3QA 3DAGA 1WMEA 4XIFA 5LDHA 1SVLA 3BJZA 4JX8A 3AU9A 5KNCH 2I6SA 3HKBB 1JU9A 3WHLA 2JLZA 4HEJA 1HEUA 1Z22A 4PW0A 1GZVA 3A4YA 1HOTA 2GHQA 3N74A 4TZTA 3CVJA 3ZHTA 2QRQA 1XRSB 3F2IA 1GKLA 2Z9BA 3JQ9C 3LNTA 4N8EA 4RCVA 2OYCA 4JV5B 1TJPB 5DHQA 1JDBC 1P9RA 3INNA 3IVRA 1AXEA 5TV2A 5JDIC 2H5LA 1ODCA 4ZZ1A 4CEJA 4M6WB 3R6WA 4BV9A 2DH5A 3DH0A 2WG2A 4JLUA 3HHPA 1RAFA 4OB8A 2RBGA 1QBKC 3G9ZA 4QZVA 2WNSA 1YTLA 4RY2A 3U5TA 2JLQA 2R85A 1V4VA 2WWWA 3ZNPA 3ANYB 2ZYDA 5DTRA 4XOUA 1TEHA 2JATA 3BD8A 3SC6A 5IJZA 5KJCA 1K7CA 3KLOA 4CQMB 5KQGA 3A1SA 1XLVA 2BE7A 2PNFA 1Q15A 5FL7A 4D0RA 1L1EA 1JI0A 3M9WA 3PP8A 4J7AA 4MCHA 4XVUA 1JFSA 3FKSA 3C24A 2I1WA 4PM4A 4P81A 3L9WA 2C3OA 1E7RA 3WLHA 4NCHA 4U9HS 5GVRA 1L7MA 3ZG6A 3HKCA 2IA5A 3HZHA 3MBOA 4P53A 2D0DA 4DHWA 4E5SA 3TW0A 4QCJA 3SHQA 3MWYW 3OOSA 4FSDA 3UJAA 4D9NA 1TLLA 1O94D 2C83A 1XBTA 3VR5D 3A2MA 1M8GA 2QAGA 2IEYA 1ZH6A 1YUMA 2BEVA 4KGZA 3IOEA 1YB5A 3QK7A 4YBRA 4UVIA 1JG7A 4AZ3B 3S8YA 3HB0A 4A7PA 3GLQA 1GITA 1JWLA 1C4OA 1H42A 1NLYA 4BKPA 1MRNA 4CNBA 4E5YA 5HOEA 5HX7A 1KTIA 4Z3OA 2BHNA 1MX3A 3FIUA 3TD2A 4R8SA 1XZCA 4AZ0B 3EBLA 1O96B 1TKAA 1XLTA 1KR2A 4TV9A 2PYDA 1WHSA 3KHUA 4MJXA 1IBMB 4S1VA 3KFXA 1PVVA 3EGDA 3H5NA 1SQFA 2R00C 3HU3A 1G4UR 3M4YA 4XRGA 4C03A 2CC2A 2FZ4A 2NACA 1SCBA 3I73A 4P7KA 1FXWA 4P0PB 1ZRMA 2WU4A 5EZQA 3OLVA 4MA4A 4Z53A 2CL7X 2QGNA 1T8YA 1DCMA 1M6EX 5FUBA 4DV2B 4M0EA 2FU5C 2BONA 2PANA 3FJ1A 4IHQA 1FW6A 2XXBA 4Y6QA 3CX4A 5BQ3A 3EZXA 1Z6YA 4N7BA 4RSRA 3WP0A 2PUWA 3KYJB 4KQEA 5DIZA 3ZEAA 1MG5A 1NQOA 3DMHA 4YMTA 5JO0A 4O3FA 2PQ0A 4M9RA 1OFIA 4LHXA 5BQFA 3OQHA 4Y6GB 4DGSA 4W5TA 2V03A 2HCTA 1SVUA 4DFDA 1UP6A 1W4ZA 1C7EA 1JIIA 1UMBA 2HZ7A 4P1ZA 1HE1C 3B48A 3GUYA 4IIUA 4Q9IA 1VRCA 1RYDA 1WV3A 3PYLA 2NIPA 4FUQA 4ZQBA 4US2R 4XB6B 4OXRA 1IONA 1SCJA 5DNEA 1F4PA 3WLNA 5EWLB 3C8UA 2XKBA 3OJFA 1HLGA 5AW6A 1L5OA 5C1DA 1NTRA 1L0BA 5A3RA 1DQRA 1VDMA 2JRCA 2WWIA 3JQGA 3K8OE 1OFUA 1QR2A 3QKSA 5I4BA 3MVEA 1XX6A 1XTZA 2C84A 3HJAA 5JD5A 3DUFA 3HM9A 5FOSA 3R8XA 4UUMA 1DXQA 1RWVA 4K8OA 4IZHA 1XGKA 1RNLA 1SIOA 2X8WA 1K27A 2WSSA 2DPGA 1VHDA 4Q01A 3KWFA 4EJ6A 2CSXA 3KKPA 4WK4B 3GRUA 1IIBA 1G8HA 1TU4A 2QK4A 4WXYB 1PL7A 2PYIA 1SUBA 4IFIA 1EIWA 4NNPA 2LGJA 5JCOC 1Q77A 1Z6AA 3DZFA 4R6WA 3F98A 2XTMA 3QPBA 1C0IA 2EKPA 1DBWA 4ZANA 4L7VA 3FCSB 1V4BA 2O8CA 5GP1A 2WHRA 1CWUA 1UFRA 1EGVB 2JI4A 1H4QA 1BMDA 4W7SA 2HU7A 3TNYA 1C3EA 2GCEA 5A5FA 2P67A 3U17A 4QBTA 2C4NA 1PU2A 3OZEA 2GPBA 4E3ZA 4ZI2A 1JMVA 5DEOA 1DOHA 1EYZA 2YW9A 1KAOA 2ZUCA 3DF9A 3WLRA 5FUQA 3OD5A 2DR0A 3LF2A 2YVQA 1K3UB 4I66A 4J3FA 4K6MA 1MC4A 1Z16A 3C3XA 4G37A 4K6HA 3ZGVA 2GN6A 1V8PA 1KFEB 5J43A 3WGJA 4F8JA 3EZLA 3GH1A 2VWHA 4FYPA 5B1IA 4KDEA 4C87A 2H5JA 5KI6A 5DNCA 1C1HA 2VLBA 4J7CA 1Z8NA 4PANA 5B3LA 4RPHA 2HV8A 5JSFA 2EL7A 4Y67A 5ALJA 1G8AA 3GGJA 3ICQB 4ZRMA 3U0BA 3R7WB 4J0IA 1ZIDA 1G3GA 3V4SA 2FTKE 4GBJA 4MVJP 3M34A 2WT4A 4G1MB 4BX9A 4E46A 2ZBGA 3GAFA 3OCZA 1XVVA 3Q3CA 5C8VA 2EZUA 2PV7A 1Z2EA 2IYRA 3AGQA 3D6MA 4GPZA 1DPFA 1OGJA 2X2OA 3NTXA 1JSLA 1KAGA 1XZNA 1Q0QA 4JBNA 1PTJC 1UKBA 2DHCA 2FWBA 4C3UA 1SH7A 5F9HA 5HW0A 1N1EA 5D6OA 1SPXA 1E79D 4I5GA 2LIPA 1OTYA 3GLGA 2GHTA 2W2XA 2I34A 2N1MA 2L18A 5DLDA 1J1ZA 2V5UA 1CT9A 1HT3A 4LF8B 1H1LA 1JG4A 8AT1A 3RK4A 4K9NA 7MDHA 2VJPA 2FPSA 5JAPA 1JH8A 1L7BA 5CLLA 3U3JA 3GH3A 3OQMA 4MKHA 3AEKA 4XZ3A 3TAXA 2IYSA 3V7UA 3R3HA 1WW2A 5IAKA 3GQBA 1JLLA 1GFWA 1NBMD 5FTJA 5JPIA 1JTVA 4KUEA 1TYEB 2YJZA 3HR7A 4MLPA 4NV1A 4EPVA 5B4TA 5CDFE 5J1SB 3RC8A 5AOVA 2H1LA 2FP4A 2YR0A 4YAGA 4BQPA 1RHMA 3PHHA 4JVLA 5AIBA 5L51A 4QWWA 3MJEA 2I0FA 3HA5A 4N4AA 3TDNA 4PSUA 1U5BA 1HTBA 5TJ9A 4OU5A 4BNMA 2BKXA 3V80A 3H2ZA 1M34A 2FMKA 1R0YA 1ZMOA 3C8DA 1Q0ZA 1RRGA 3T9BA 1VJGA 3TTUA 2YOGA 4AP9A 1RKUA 1T15A 3Q98A 4UUNA 2HREA 1Y5NA 3CT6A 4WZAE 1ZR2A 3GLHA 1XMIA 2X8BA 1LSUA 3C4VA 4DSZA 1RVV1 1UP4A 5TJHA 3W5CA 5JERA 1MEOA 2QXUA 2WF8A 3TFOA 4WY2A 1EB8A 2D5CA 4YJDA 4F5ZA 3CB4A 1WXHA 5H02A 2ZUFA 1NIPA 4KLNA 3IAS6 2FWAA 5IANA 3VO1A 1FCJA 3PC8C 4HWSA 4L78A 3RIXA 1V8BA 2MYPA 4JI5B 4LXYA 3TUZC 3WLPA 3R44A 3ACDA 1D3AA 2F17A 3ZUPA 1CUHA 3ETJA 1LUAA 2ZYHA 4N9QA 4ZDJA 2WUDA 2R60A 1Q7GA 1W4RA 5FJJA 1MJNA 2FFQA 4RPLA 4TXNA 4RCZA 4CDGA 1KKLA 2GEBA 4BNIA 4QU9A 3E03A 4JLOA 5DV9A 4OI0A 2ZQZA 4TKLA 1UC8A 3DFKA 4CF6A 1FUUA 3N70A 2FMIA 4L5IA 1X7WB 2Q1WA 4JR2A 4G84A 4IMIB 4MINA 4FMCB 3IAS1 5ERXA 3VH3A 3N39C 5TLSA 5LOVA 4YCDA 1Z56C 3AR7A 3RBXA 4AZWA 4LK2A 4NABA 1UP7A 1H2ZA 1JFLA 4NFSA 3FGPA 2BF7A 1R16A 3UAYA 2HO5A 1E9FA 4KXYA 3FPGA 4M8LA 2QYOA 3BJIC 4N8SA 1SC3A 3NXSA 3IP1A 4S1OA 3V2GA 3FOZA 1BXZA 4AY4A 1GYQA 3VKVA 4DZRA 1AA9A 1ISHA 1HE8B 2HLHA 4XFKA 2IUFA 3LXUX 3OKPA 5KU7A 3KUCA 2IU4A 2QGZA 3KJZA 1EZ4A 3O3OB 5DFAA 1GHTA 3RHZA 1J9EA 1EX6A 1PGJA 1KVRA 1ZIPA 2GLTA 4RVCA 3TIXB 1QONA 5CJPA 1KH3A 1J0EA 4IZ6A 4EPWA 3PHIA 4L5JA 4UDYX 5DTIA 1M2VB 3O8DA 3T5BA 4M8SA 2D06A 3ZCTA 5CCXA 4AYXA 3AEYA 3D8HA 1DFHA 5JH7B 5LPNA 2REXB 2IYUA 3G3EA 1XKTA 4PG7A 3BD7A 1RQGA 3FKJA 5CYPA 2BGUA 1UBHS 4DDHA 5KYYA 1WETA 3ZWVA 3CMCO 4HWPA 3ROKA 3VV3A 2AZXA 4PRKA 1OFVA 3EWIA 3G7SA 4YCBA 4AJIA 1Y8RA 4E5KA 2NYRA 3LIIA 4ABTA 1IM8A 1GG5A 4GP6A 5BORA 3H8SA 4YJ2B 1D7AA 2ZS8A 4EGAA 2JS7A 3V8RA 3I52A 4QHYA 4KN5A 3DMRA 3CLUC 3JASB 3N28A 3DQQA 4ZMSA 1OKKD 3KXPA 2GPSA 2BKUA 3FNHA 1T5LA 2VDPB 5ALDA 4BN4A 2W6NA 4ZMBA 3KEMA 1T6YA 1ZH4A 2AUNA 1W581 3PYXA 4MK4A 4RKFA 4YVFA 5E38A 2NVBA 1QE5A 2R87A 4JJFA 3P2IA 2F8LA 4L07A 1EFRD 1YCFA 4JMPA 5K6TA 3WDSA 2PFGA 1L6RA 2PWZA 4KO3S 5E4TA 3BDAA 4GMKA 5GJCA 4KBYA 4PTLA 4P3KA 2A14A 2YWGA 4NK5A 1Y6JA 2VT7A 3Q3EA 3HDVA 4ALLA 1CUSA 3WBKA 3HVIA 2PUFA 2A9PA 2QUIA 4BFUA 1OJ7A 4ZEXA 3SVTA 3M9XA 1QH9A 3B1ZA 5NLLA 1XIVA 3M4XA 3AUKA 4D4JA 1DC4A 1EB9A 2FZWA 3MINA 3MILA 2IDKA 3AW9A 4NBNA 1GA4A 5KDDA 621PA 2V7GA 1BH6A 5TF0A 2Q4BA 1X80A 1NMYA 2G1JA 3K0CC 5E2IA 4ZI7B 4RZQA 1F9AA 2CMHA 2ZULA 4MIKA 2VPQA 3QUAA 4HYYA 1TCUA 1IYZA 2ORIA 4LXHA 4Y2RA 4Z3DA 2NN3C 3SI7A 4ZHQA 4D9GA 1OLUA 1KMMA 2O3QA 3R6GA 4Q4CA 1A5ZA 4MQMA 4WNAB 4RF5A 4KIFA 2GAJA 4I1IA 3QY9A 2CV1A 2BMEA 1RD4A 4QOHA 2WQ6A 1XELA 1QXSA 1X13A 2HIGA 5DSZA 2CJPA 3GEEA 2BUCA 2FLWA 1T0JB 1H0HA 2CXTA 2FDRA 2OZLA 1P9NA 2YIDA 4LRXA 2A8YA 5BQOA 1Z28A 4TL6A 5B7PA 2VQSA 2WWRA 2HTFA 3RC3A 1O03A 1KI6A 1FLVA 1FFDA 2C29D 4MQ6A 3Q9LA 2ZQ5A 3U80A 4DUYB 5EE3A 3TKLA 2I2BA 4H7EA 4YASA 1UMCA 1O96A 1CVRA 2DY0A 1PSDA 1H4VB 1M3SA 1QB7A 1C9KA 1V5FA 3CR8A 3WGLA 4B6EA 2GYWA 2XVYA 3TNJA 2ZRBA 3NRCA 4R40A 3SE0A 4GYKA 4IG4A 5A9RA 1Z5OA 3U7FB 3C48A 2I2FA 4EYQA 2OWEA 4JJGA 2FPGB 4Q6BA 1BDHA 3RRXA 3WL6A 4C08A 1BE6A 2QTRA 4DA6A 5J4YA 3H75A 1N5KA 1DO2A 1ENZA 1RHJA 3MUFA 4V24A 2LW7A 5A5VA 4P4TA 1YD7A 5DYTA 2H4JA 2ZB2A 1A7AA 3FLBA 1AIPA 1B93A 1U8XX 4BV2A 2O2IA 1LF0A 2V55B 2IYTA 2CXSA 2H18A 3FWZA 3M5WA 3EWSA 4DRXB 4F4JA 2C2BA 4M0LA 3HUUA 1YC2A 3ZD9A 2FWPA 2TMDA 4CTJA 2W98A 2ZJ4A 1ZA2A 4OBXA 4TS4A 2X0FA 5LDDC 1H65A 4PZEA 2F9FA 4QC2A 3BRQA 3M82A 3DWIA 5F1YA 4TLCA 4F12A 2IUEA 3FTDA 4DG5A 1CCWA 2GXUA 3LC1O 4L2IA 4CFZA 3CO5A 4LYFA 2EW2A 3SVZA 3LVBA 4NCNA 1BFUA 2GRJA 1PQUA 3T06B 3DDZX 3HEAA 3K0BA 5H81A 2PWBA 5IM5A 1KZHA 4DREA 5IUJC 2CJFA 2FWJA 3OCCA 3R3XA 4H7HA 4IDGA 3ANLA 4CL8A 3NXKA 2Q5QA 4V02A 1D8AA 1N5MA 2YY5A 1WV1A 4CI9A 2NUTB 4HSEA 4UNRA 3IL2A 3DEJA 4EHAA 5K7SA 4RTNA 1KVUA 1CDOA 3RAJA 1XRLA 1U2QA 3M33A 3A28A 1H69A 3HC7A 1R9JA 3N8DA 2J0UA 2JI6A 5DGDA 4ZAFA 4Z2AA 1LPBB 4Y0VA 5K0SA 3CPHA 4Z4FA 2YJNA 5JH7F 3GJTA 1E5QA 5EMKA 2ZRCA 4AG5A 5BV0A 1VZ2A 2Q2NA 3C7TA 5LJLA 2G9UA 1HF3A 1XXHB 2G4CA 1FXSA 3Q40A 1ZRHA 3ZH9B 1TA0A 1W6UA 2P9EA 1CQWA 1QYWA 1DAIA 2ZT7A 3C98A 1QS0A 4I5FA 4NARA 4PNZA 1IZZA 4R4JA 3H9GA 1RJ9B 4J4BA 5I8ZA 3WY9A 4FZJA 1JFRA 3CRRA 1M1YE 5CW2A 4C4RA 1KDTA 1NVAA 3HB1A 1DZ3A 1D9XA 1FL9A 1T91A 1CSEE 3WTCA 2IGBA 1IWOA 4OL9A 4C6TB 4P9NA 1DV1A 2F4NA 1NM5C 5ALXA 4CUZA 3T7CA 4Z7OB 3GUZA 3HBFA 4BKMA 3G2OA 2PZGA 4I4CA 5F78A 4BZWA 4JBIA 2YV1A 3KOXA 2OMEA 5A05A 2DCMA 4LE2A 3HA2A 4LJ7A 2VP5A 1U5CA 4QJIA 1N9GB 4ZAWA 3Q8XB 3UK6A 1WXXA 2WPDD 2IW3A 1E63A 2Q3DA 1JIXA 4TTIA 2NO7A 2J3HA 1UR5A 4I4LA 3LUJA 3QPCA 4HLDA 4QQKA 2PZFA 4W9RA 2K87A 3MMZA 3PUVA 4FOPA 4BNNA 3JSXA 4PYQA 2X1VA 3EBOA 5JXWA 4MSUA 2FOLA 4I1OA 4P80A 3ICCA 1AS0A 4XQ9A 2C58A 2ZREA 1U5AA 3V00A 2CZCA 4DMRA 5HQ3A 3CIFA 1KEZA 3NHAA 1LLCA 4JDPA 3DNMA 3EJ6A 3OOYA 1ABFA 4B5KA 1T0HB 5JZOA 3ZDQA 2BP7A 2FA9A 4WFKA 4ESEA 2C4HA 2NSJA 1K63A 4ITRC 1KI8A 1SKMA 1CRPA 1N2SA 1MFPA 1QE3A 2HRCA 3OSZA 4KR0A 1Q5PA 5B1EA 3ZW7A 2IHTA 1A4XA 3H0CA 3MFQA 1DC3A 1X80B 2W2KA 2PMKA 5JW6A 2FJPA 4CEHA 4CYMA 1JHOA 2NAPA 3MW8A 2AEFA 3QG1A 1TO6A 3FGNA 2SCUB 2Z8ZA 4FNAA 4LN1A 4WLNA 1C2YA 4B3HA 5KX5A 5GMOA 1YASA 1RRKA 2P2CA 2FMFA 3UKOA 1LEHA 2XF2A 2GCNA 1QPBA 3BKXA 1V2GA 2YINC 2CNNA 2W6IA 3A6ZA 4IIJB 1GDTA 3MZ0A 3Q3HA 5F5LA 4Z49A 2FFRA 1EFTA 3GNQA 3I61A 1BA2A 1Z5GA 2IHJA 3MT9A 5MN4A 3ZLTA 4GYJA 4JONA 4C43A 2EP8A 4DLRA 2IS1A 1MLDA 4OQQA 1YMVA 5KNLA 2UYHA 3BHIA 4RSHA 4WZAA 4HNVA 8ABPA 1MH1A 3K32A 4O5OA 1YS4A 3Q85A 3UB4A 3LBFA 4M0PA 2V65A 3RVDA 4BZQA 1K3QA 1OCEA 1Q3HA 3PDWA 2GFHA 3B1XA 3B2EA 4IJQA 2JLXA 2ZIZA 3D1LA 4ZYTA 4D45A 1FUEA 4AROA 4HQ6A 4R0NA 4EUEA 1T2CA 3UFBA 3HKEB 4C76A 1M2EA 3M9LA 1N5DA 1RRMA 2PG3A 3NOVA 5E4JA 3WL4A 2Q4RA 3GZJA 1KS2A 3NTOA 4LNUA 5DDIP 5E1BA 3W2TA 4CIAA 3CE6A 4UZSA 1V71A 3EGCA 3WLJA 4Q05A 3N86A 2OG2A 2ZBEA 2OBXA 1MPTA 1QIKA 1RKQA 1U8ZA 3SNKA 2O3TA 4A8JC 4YRSA 3IPLA 4N03A 4LVUA 5CVEA 2CBZA 4H1UA 3AT1A 4RM3A 5SY6A 1OOEA 5KSPA 2D59A 2OOKA 3A3NA 4FP9A 3AOEA 5KOHB 5FA8A 5FNVF 3TMAA 4FI3C 2WPNA 1R5JA 2ZSBA 4ZHQB 1AHPA 1CZHA 1SXIA 3ECAA 3VR2A 1KY4A 1RC8A 2FZ5A 3HRKA 3JD2A 1MXFA 1F12A 1XNHA 5JJCA 3AEKB 2VF4X 4UXJA 1NTOA 2WJWA 3BSFA 3PXGA 1NBOA 1AF7A 3EVFA 1NDUA 4JKOA 4TMVA 1XD8A 1XUOA 2JVJA 2UAGA 3ITDA 3P0RA 4X6XA 3ED5A 4QXPA 5HF6A 4L08A 4EG8A 5ADVA 1F3LA 2Z8XA 2ATCA 1O6GA 3IP9A 4Q24A 2I4RA 5SV2A 3SF0A 2AOWA 4GX1A 4EABA 4J16C 1YR8A 2Q46A 4TRRA 1J90A 1QRRA 4OQ4A 1A71A 1G5PA 3JRXA 2QZ4A 1CX9B 2IYQA 3M1IA 1O58A 2XODA 4AZTA 4A9AA 3F71A 5G1NA 4YXWD 1HYHA 2ECQA 2X14A 4XUDA 4UFPA 4P7GA 3RQSA 5FBRB 4IH4A 1HX7A 1HI9A 4L4RA 2HBRA 1WBJB 3B6IA 1ZVVA 2BSXA 1NVEA 2XE8A 3ICEA 5J63A 1RJ9A 1Z6QA 2H08A 1KYZA 1U8YA 1V2HE 1L5YA 2P5UA 4GQBA 3RKRA 4CIBA 5K8IA 4S0XA 1OC4A 3LOPA 2QTVA 2V7PA 2FNAA 3G68A 4BN0A 1RWXA 2GB4A 1YZQA 1Z08A 4NBVA 2IPXA 4JL5A 5BR4A 3V6MA 1AG9A 1ONNA 3MTAA 3ZW8A 3COPA 1EUDB 1MCZA 4WUTA 5DBFA 2XWQA 3GUVA 5KZMB 2XVAA 3LBNA 2O0MA 2Y1FA 3BEDA 4FJ0A 2KB4A 1YR6A 2PLAA 3DOEA 3AFGA 4FZVA 2KMLA 1A7JA 1H0RA 3PFIA 3H42B 4OFBA 4X60A 3TQOA 1DQPA 2YVLA 4BVBA 2IE0A 2O2XA 3MWEB 4IH1A 4UTVA 2Q3HA 4WBXC 4ZVPA 5HFNA 2H92A 5FCDA 1RLTA 4PS1A 3KQQA 1ZEJA 5JFTA 3R8CA 4YK7A 4CM1A 2J9GA 1K8QA 1D1SA 4IIYA 1N1MA 1P72A 4GBMA 4JLSA 1H5UA 3NBKA 5CLQA 3DKPA 3KTAB 1D1QA 3PKIA 3C43A 4INAA 3S4YA 3GO4A 5CG2A 3WBBA 1M2JA 1NXWA 2ECPA 1U2DC 3BF8A 3QU5A 5JD4A 3BWXA 2ZP1A 5TVKA 5FH9A 3KAQA 3TGWA 4AXBA 2WNIA 1SCUA 3WL5A 2QN8A 2QD1A 3IYLW 5AW8A 3F7NA 4RIGA 3P9IA 4UBJA 4ABYA 4ERNA 4RL6A 1YTUA 2EBHX 4I8XA 2QVBA 3MJ4A 4L57A 4N5MA 4R83A 1YULA 1Y7TA 3B3GA 1G3UA 3NT5A 3QY0A 3QVTA 5AI0A 5DP2A 1YC5A 4OFWA 4S12A 4J2HA 2GWHA 3TR6A 2HBZA 2DQYA 1XJCA 2VYVD 5JZ9A 4X66B 4G86A 1GQQA 1VBKA 3IMKA 4PFQA 2D3TA 3H11A 1L8OA 2JFZA 1J0DA 4U2KA 1OLSB 3J7TA 4FZ5A 4IMRA 1K8ZB 3CNQS 4RVSA 5CUQA 4EI7A 4R1LA 4B3SB 1PGNA 2WTBA 1GY8A 1JPNA 2FPOA 5MN6A 3ZX5A 3WGMA 2PH7A 3PGLA 3ONDA 4WASA 4WVLA 1DKMA 1U3CA 2ZT6A 3M5PA 5A0VA 2VS1A 2OV3A 4JEUA 3ND6A 5IT0A 2YNMC 2GD6A 4HPXB 4IIVA 1MXHA 2P78A 1JHYA 3I3OA 3L6OO 3CNLA 4OI2A 5EJ8A 5GGYA 2XCLA 2YV3A 2B25A 2FWNA 3DZBA 4CKCA 4BQOA 3PKJA 2DOKA 2KB0A 3RWOA 3D8SA 1GEGA 1OAOC 2DBYA 3JD1A 2JD1A 2NSYA 3O1IC 4I19A 4OI1A 5JDIA 4O2BA 1ZS9A 5LJIA 2HT6A 4U7PB 2IK8A 5AICA 4JU9A 5KYUA 1BOOA 3BE5A 2QD2A 2M6RA 3W9YA 3VZDA 2ARKA 3F78A 1J56A 1XCGB 4JI8B 4KHPB 4FHEA 3L4JA 2EJVA 4I1SA 3ESAA 3JZIA 5L40A 1QJ4A 3IQIX 3D43A 3THYB 4M9SA 2XZPA 2X5OA 4I50B 4MTLA 2PL1A 4I8DA 4X85A 1IZ8A 1RZ3A 2MCFA 2D7JA 4OHFA 4ZTUB 2EFDB 3CLSC 1N5IA 1V96A 3VR1A 1FRQA 4HRVA 4MRRA 1T5IA 5JYEA 4KGXA 1M2NA 1DBPA 3UPUA 1OXVA 4ZOLB 2BGIA 2C9OA 3QM1A 1MZVA 4MOWA 3FSRA 4PZLA 5I9BA 5IU6A 3ZV3A 4HPWA 3B1WA 3W77A 6ADHA 2XNDD 1UMDB 4GPD1 2BGNA 3P5BA 1DJLA 4RM2A 4W99A 1LKZA 3BA6A 3OWOA 2VZ0A 2WU1A 3ANXA 3OOWA 4KMOA 3WWPA 3DWEX 2AXNA 1NJ5A 1XPUA 3S2FA 4CIYA 3IVCA 4W1QA 4W1SA 2IV3A 3V8BA 5JCXA 2O2SA 1RLJA 3Q7EA 3E15A 2O23A 4EPYA 1MO6A 4KAAA 1LC3A 4NC9A 5JIBA 4IJ5A 1A72A 1UK8A 2WD7A 4B35A 3G7NA 2LTAA 4EY4A 4NP6A 3H18A 2ZE5A 1XA4A 5BW4A 1KEEA 4R8RA 5C4GB 4PU0A 1R6BX 5K3FB 5JMPA 3F49S 4IDQA 4GR5A 4LFCB 1UOEA 2BUBA 4MI6A 3W8DA 1RRVA 3CF0A 1ZK2A 4KMSA 3V8MA 2OTCA 1WR8A 1NT2A 2P79A 4BQSA 1JEYB 4OOFA 4QGFA 5DN6D 4GZ6A 1LLUA 4NFLA 1F60A 2FUKA 3I2HA 2WP8J 4KXNA 4RCYA 5CA0B 4D9FA 2IYFA 3WGIA 1XQVA 4HNHA 2G0TA 4YV7A 2HN9A 2XUGA 1E1RA 3NO4A 5DNUA 4BVKA 4DUGA 1J7JA 3K3PA 4LECA 1NVFA 1DINA 1RQRA 2AF4C 4CQNA 1S2DA 4QFCA 3EIUA 3LGAA 3DITA 3QI7A 3ZDRA 1E9SA 4NBKA 4Y98A 1SURA 1XXLA 1XZEA 3HWRA 3EIEA 4HCJA 3TL3A 5BUZA 2WHYA 4D8WA 4HQKA 5HGXA 2ERCA 3GIDA 3LH5A 4O3MA 3G2NA 3R4CA 3OPXA 3QOXA 2GBFA 3SQLA 1M2KA 1QVAA 4JFRA 3EGXB 4ALMA 2NZWA 3OZFA 1WA5A 2ZAMA 3AJRA 1QAQA 3ABIA 2XKJE 3K72B 1WZ2A 3UJBA 1PL8A 1U6KA 3LQQA 4PRYA 2DTXA 2P9GA 4Z8XA 4MP6A 1VBFA 5DOVA 4ZAZA 2GJKA 4CNQA 5IXSA 1P8JA 1G8FA 4DNQA 4JT8A 1SBQA 4AMUA 2Q5CA 1LBEA 3L6BA 2O8CB 2JFFA 3CLVA 2DAPA 2RCNA 1JLMA 4LDNA 3ROXA 5BW5A 5JSHA 3Q8MA 3AM4A 1A1SA 1D6NA 3FUWA 4P58A 3PR3A 5AW0A 2DEUA 1UBFA 4RY8A 3E53A 1ZNWA 1OWMA 3K94A 4NYMR 4C7KA 3GAMA 1XZFA 2VJMB 3ANSA 4BKRA 4OATA 2G08A 1GN8A 2MINA 4BMOB 4PYLA 2I80A 4URWR 1MORA 4OQNA 1EA7A 3EJWA 5KREA 4QODA 3L43A 2FK7A 2P9QA 1DXHA 5FRDA 5AXBA 5AOCA 2M1XA 5GWXA 3EDQA 3L7LA 4YRAA 1ZM2A 4S1NA 3LRXA 3QI2A 4HH4A 2WTEA 2I2WA 2NPOA 1U8UA 1P2FA 3JQ9A 4XSHA 2EQBA 1BGWA 1LA2A 3IALA 1N0IA 1PEDA 3QVWA 1E2LA 1RR6A 2P3OA 3RTAA 4DLTA 4DCSA 1GAXA 4QTTB 3D4NA 3VPDA 3EPHA 2BUAA 2M6LA 3A6PC 1NFFA 1DMSA 2IDJA 2VF2A 1F4LA 1X19A 2AOUB 2G76A 1F8FA 1J2RA 5JS8A 1J0XO 3H2IA 4K40A 4MUAA 4TZ6A 1JJAA 3S1LA 1I4LD 1N34B 3H0KA 1XCOA 1J21A 2PO7A 4H87A 2BFCB 2XV1A 1SHJA 3FOBA 1XOIA 1U04A 3RIHA 5THQA 2N0SA 4CMGA 2BKAA 2WKWA 2YHIA 3L7OA 5ALGA 4CLHA 2C54A 5A5DA 2PZBA 4D81A 1COWA 1GZUA 4RFVA 2PM8A 3SY8A 2AI2A 1UIRA 4YUYA 5HS4A 4TVKA 5MGBA 1KI3A 2AE2A 3D8BA 3PT9A 5KYUB 1ZGHA 5LQRA 3BFXA 3AR9A 3T1QA 1Y98A 1YNOA 3A31A 2DG2A 2PX0A 2GSDA 3UXYA 3ORYA 4B84A 4NE2A 4HXEB 2B35A 1FMCA 1KEPA 2NT4A 4XGIA 4C2TA 3HFGA 2Y6VA 3M5DA 2X3FA 2GN8A 1JHDA 3UH1A 4E07A 3ABRB 1SBIA 2Y66A 4DCVA 3SS8A 4NIMA 4QBHA 3U9LA 4ARBA 4G5XA 4MV8A 2CF5A 1L7NA 1UEJA 2GARA 5B6PA 5CVDA 4OHMA 1QHYA 4S04A 4L5BA 3EIWA 1IEVA 1N0WA 5A4DA 5DYWA 2PUJA 3E4CA 4EWLA 3KZKA 2V0NA 4U5XA 3LAWA 3H4VA 5EZYB 2UU9B 1GCGA 2QVZX 2IC5A 4NAVA 4Q4HB 1LX7A 1XQXA 5BNFA 1L2TA 2CJYA 3EXAA 1SMKA 3I45A 2OAGA 2G40A 5K99A 3EVGA 4BLPA 3EEQA 3KAPA 1Z0UA 1AX9A 1WRBA 1ZIOA 2AYXA 3C3MA 4JLBA 3OMLA 3B36A 4PYJA 5B5SA 3CLRD 5DHUA 5K0EA 4LOHA 3OLYA 1FDTA 1X38A 2I2CA 3OU2A 3QW4B 3ZHZA 4X6UA 1MABA 3F4BA 1YBAA 4G4GA 3UANA 2H4YA 2J33A 4ZYWA 2FW9A 1P0MA 4ER7A 3EAFA 1ELOA 3SN6A 2P7IA 4UNSA 4E2XA 1YFLA 1KYTA 5JLAA 3S29A 4WTOA 1OHHA 4LQDA 1ENYA 5E6RA 1D0IA 3AF5A 4M6WA 5ED0A 4BNDB 2V5AA 4LF6B 2X7XA 2IXBA 1FPMA 3A1WA 1AHIA 4YY3B 4N6NA 5KJ1A 2G7ZA 2HJ9A 2RI6A 4HFRA 4P92A 2ILTA 2KHZA 1JE1A 3D3WB 4NULA 5CVUA 1C8LA 3BDVA 1WSWA 1EPUA 4J3NA 1TJ4A 1JQJC 1LGQA 3JY6A 1YB7A 1PJAA 2RJ3A 2WFLA 4QTUB 4TKUA 4B31A 1JHQA 2CLOB 3K1YA 5ECGC 5PGMA 1L7AA 4E32A 2G6BA 4BJHB 4LAFA 4ZTZB 5DM0A 3VZSA 2HU2A 4G5SA 3OUZA 4J1QA 1OYYA 1G3QA 4ZEMA 2AMLA 5BMVA 1B0AA 1IULA 2D0PB 1A8SA 3G1UA 4OK6A 2QVLA 2WICA 3DBOB 4EPRA 4RLSA 4FHZA 1U3DA 4EQZA 1Q19A 5IDQA 2VRNA 5CPFA 1JMKC 1YB6A 4Q3LA 2JI9A 4M99A 1CIVA 1R8QA 3ZNOA 4HEA1 1P1IA 3G85A 1G9SA 2P2GA 4HWKA 1S1MA 1U2DA 4MJ3A 4AJEA 3ROTA 3IVGA 1DAFA