4WRRA

A putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
293
Chain Sequence
KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVSNNIDAEEKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative diacylglycerol kinase
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
total genus 81
structure length 293
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 4wrrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4wrrA01
5EJGA 2QV7A 2JGRA 1Z0SA 3VZBA 5DHUA 2I2BA 4WERA 3VZCA 1Y3HA 2I1WA 2BONA 2QVLA 4HAOA 5EJFA 1YT5A 2I2DA 2I2AA 1Z0ZA 4L02A 1Z0UA 4DY6A 3VZDA 3V8MA 1Y3IA 5DHQA 3PFNA 3V7WA 3V8RA 2I29A 3V8NA 5DHTA 3V7YA 3T5PA 5DHPA 1U0TA 1SUWA 5DHSA 3V7UA 2Q5FA 4WRRA 3V8QA 5DHRA 3S40A 3V80A 2AN1A 2P1RA 3V8PA 4V24A 2I2FA 5EJIA 2I2CA 1U0RA
chains in the Genus database with same CATH superfamily
4BMPB 4JYAB 1PDVA 2XMZA 3A27A 2PANA 3UG6A 2P35A 1E64A 3C1UA 4US0R 3I01M 2XT9A 2BEVA 3SJBA 4IDHA 3OJEA 3Q8LA 3QXXA 3INGA 2PGJA 4YRKA 5BWNA 4RIIA 1GZVA 1D4OA 4MYSA 4D43A 2R1ZA 3LVBA 4KR0A 4N0MA 5KAMA 3LUPA 1EJ0A 2JI9A 2R6R1 1ONPA 4YUYA 5EIHA 5J4KA 1E4VA 1GL3A 5T4BA 2X8JB 5DEOA 1EUCA 3LLCA 2BFMA 4TPKA 3D2CA 5EJAA 3PXBA 1RBZA 3IAUA 4MW2A 3RRMA 1H2XA 4FSXA 2PUCA 2NU9B 4BNMA 2AA3A 3BGIA 4RXMA 4LMBA 4ENPA 4ZMRA 3CEAA 3PPVA 1JSCA 3FOAA 3CLTD 3KOMA 4IHJB 4TL9A 3M3DA 2C9MA 4Y6SA 3M6VA 4I9NA 3DD5A 2C00A 2PR2A 1D8TA 2I67A 4H1VA 4YCSA 5D8DA 1L1EA 4FKZA 2JK0A 1H1DA 4OMFG 1JT2A 2NXCA 1IFXA 1CY6A 4B3HA 1IBLB 4QXQA 4C2UA 3UXHA 2B25A 2BGIA 2ZI6A 2XB4A 4TL7A 3WNCA 1ZOOA 3HVKA 3GFOA 3TL2A 4LDNA 1PJTA 1QC5B 2RIRA 4LHZA 2Y99A 2A30A 4KJZA 1U8ZA 1VB3A 3ONWA 1QIMA 2C57A 3EXEA 2YXPX 5A0FA 2VZ8A 3K2BA 1JSLA 3SIXA 4RIGA 4CIYA 2AG6A 1E3WA 1K88A 4PCAA 1IZZA 5LP6C 3J7AC 4YJKA 3TCNA 1RJFA 2A5YB 4LDJA 3MYRA 4PWYA 3EF0A 5DXJA 1PJQA 4L9WA 4G36A 1SXPA 5CNKA 2HCJB 3ZX4A 2OBMA 5A5GA 3TFOA 2DSTA 2Z8YA 3ESDA 2HGZA 4IMPA 5FBVB 1VCIA 1KZYC 3EQZA 1PW5A 3KOYA 3A6KA 1FU4A 1KGDA 1G42A 3OM8A 2DFLA 2J85A 2WM8A 3PGJA 1KDYA 2HQRA 4EX6A 2FSFA 1ZIOA 3KKPA 4TUYF 4O4IB 4US1R 3UAVA 3UFXB 3E81A 4AIRA 1KEPA 2IHJA 4IGEA 4W7IA 2C83A 5JCOA 3ZS9A 4CM4B 4C04A 1YS6A 2GKSA 1EX6A 3ETHA 3QXHA 4NABA 1E99A 4FU0A 4LW8A 2ROQA 4DF3A 5FOQA 2V3VA 3ZY6A 4L7VA 3BQNB 1TIBA 2CNLA 3D8HA 2J3KA 2FP3A 3C3JA 1FLAA 4XDGA 3DAPA 1ZHFA 4FFBB 3WWDA 5E95A 2VHTA 2I7CA 3QUTA 5F51A 2G0AA 1N4DA 4XUGB 4PWZA 4CMKA 4IIJA 3IV6A 2Z2XA 3HBNA 1J8MF 1YWGO 4NH0A 4R0NA 4TTTS 1VYHA 5F5XA 3TRKA 3AONB 1QRAA 2FPSA 5GY7A 3VDQA 1C3OB 1GKIA 3H9CA 3P0EA 2VHQA 4IMRA 4Q15A 1Y98A 1H94A 4LGYA 3UK2A 2NO5A 1IQ0A 4DIBA 5BN4A 1A50B 1COWA 3HNOA 4I55A 4KQWA 1B15A 1TQ4A 4I81A 1ZAKA 4XTCS 5G53C 4B3BA 4D9JA 4EH1A 3ZIAD 3BA6A 5REQA 2AOXA 3HN7A 4QAQA 1ECFA 4HLQB 1VPLA 4BQRA 2JIRA 4FOSA 5JZMA 3AU8A 2OOSA 4YLEA 4D2IA 1CRWG 2XKAA 2YUIA 2E82A 4HPJB 4O0MA 2Z57A 1JLHA 2J0EA 2PT5A 3GCDA 5ADHA 3TG8A 4WJLA 1CY2A 2R1UA 5B1YA 2FETA 3CFYA 2UYCA 1Q7CA 4HGRA 2AMJA 1CC1S 2YV2A 3G8AA 4DNXA 2FJPA 2Y2UA 4X6LA 5F4BA 3ILYA 3SSMA 4H7DA 2X7XA 1NUUA 4A91A 2O1XA 2G9QA 3Q7RA 5IBQA 3TMKA 4DIKA 4O4HB 1Z6ZA 2XRMA 1IK6A 1EB8A 1S01A 4FDAA 5JJCA 3AINA 4B32A 5AXAA 1X8KA 1XPJA 4NDZA 3TB6A 4DR3B 1QF7A 1MKYA 4RWEA 1QFSA 5IDXA 1XVTA 3AUYA 1R4MB 1H65A 4I4TB 4MW1A 4QE3A 2CXTA 3WL5A 1NI4A 4XR4A 4O2BF 4ZHQB 5JPDA 3SFTA 3AUUA 1Q50A 5DCWA 2NP7A 1NR1A 2P2NA 2HTEA 1X19A 1XMXA 1Y1LA 3QBEA 1MHTA 3KTFA 4WCFB 2JFFA 1Y42X 4TQUS 3X2FA 2FFQA 3H5TA 3PE3A 1QLJA 2PXAA 4DABA 1B1AA 3PT9A 1E8MA 1ZCAA 1KO1A 5HIJA 4D3XA 4ARBA 4QULA 4OBBA 1FYXA 4YMTA 1E1QA 1ZK2A 4AJLA 1U8UA 4I3HA 1LDBA 4BNUA 2Y76A 1MF7A 3OIVA 1UDRA 1XYYA 1JKXA 1K7SN 4P4SA 5E9QA 5G40A 5M2QA 5H9WA 1L5YA 3UMFA 3S1SA 3LDGA 3CX8A 4DADA 4Z7JA 5TQVA 2IU0A 4DR5B 3TN7A 2KB3A 1XRRA 1FFYA 3KFXA 3T3GA 4YVFA 4TL6A 3ZWNA 4Q9HA 4B76A 4NDAA 1GFIA 3MTBA 2IZOA 3U2QA 4DSUA 2QGNA 4PHTA 1SQ6A 3R7FA 4EYKA 5FA8A 1CUVA 3FZNA 4KQKA 2ZPUA 4MVJP 3DYVA 1P3DA 1E18A 5LYYA 1Q0HA 3VSAA 4MUFA 1XOIA 3GBVA 3A6GA 4LYEA 2XHEA 1JB1A 3DBVO 4J6EA 1GFSA 3G2OA 3ITNA 4LCBA 2HA3A 2AI1A 2XB6A 1KY4A 1GM5A 4JEIA 3FWNA 1E9AA 1PU2A 3GLSA 4P7GA 5HPYB 1CF4A 3RVPA 4FYIA 3KCQA 3BILA 1FBTA 3IVRA 2I4MA 3OUZA 4H3VA 4BMVA 5ECYA 4HS4A 1JLSA 1PLLA 2FN9A 1V1RA 4IQGA 2ZI5A 3N87A 3HX1A 4MDHA 1RTTA 4HQRA 2B35A 1KI6B 3BZUA 4D8UA 3CNQS 3Q2IA 1EM6A 3HYTA 3OP1A 5ESDA 1UJBA 1QONA 1XZJA 1ST2A 3LMKA 4GPIB 3VU9A 4AF6A 3O75A 2I2AA 4ZIRB 3GLFE 1Z7BA 3CVJA 1CZHA 2HLDD 4Q7MB 4WFJA 1V7QA 3WGOA 2O19A 1HTTA 3VC3A 4MS1A 4E11A 3K0BA 3C6QA 4LFCB 3DYBA 3AJEA 1GNRA 2IUUA 1XDSA 4F4DA 3T1VA 2IXEA 5ALUA 4REOA 2MINA 1V4NA 3VR5D 4AY3A 5KREA 3D0QA 3VR0A 1JHXA 1T24A 3AO0B 2APJA 1CY8A 4MJLA 3SSOA 2IS4A 1UMKA 1A27A 1CJTC 1SCAA 2G04A 3D7KA 4CPDA 1F1JA 1TX4B 2R79A 4NYJR 5A62A 4K9SA 5KNBA 3H5WA 2X15A 2K87A 3KJZA 2OGSA 3T7CA 5JS1A 3ICVA 1H2AS 5BRNA 3L79A 3EPPA 1E4EB 2IQ5A 1XMJA 1CTQA 3GEGA 4ETMA 2NW6A 3P9ZA 3WB9A 3QBTA 3N3AC 3ZHVA 2IVFA 1YI8A 2XCUA 3O2QB 5F3RA 1JTFA 3A4NA 2MCFA 4DBLC 4AKIA 1FQJA 1FQKA 2X5XA 2VWGA 5ALQA 5FWYB 4GUAA 2Z9CA 5DWDA 2COUA 1WAMA 3PC4A 1A9RA 1BXGB 3IEIA 3GLGB 1IDOA 1P75A 2ZWAA 1E2MA 1GR0A 3U16A 5ITWA 1Z4NA 3L4BA 1X15A 3SG0A 2R6HA 2VRWA 3UWMA 1ES9A 3I6YA 3K30A 4QFDA 1TMKA 3I0ZA 3O6VA 4LHSA 1QOPB 2LUOA 2AFHB 4GR4A 2FLWA 1A04A 4TWZA 3ZZNA 1ZKDA 2C97A 2IEGA 1ATIA 1WUKS 2HMYB 1H4QA 2P9HA 3P9PA 4YWJA 5E3IA 3PC2A 4G67A 2GDZA 3MK31 4BWVA 4E2WA 2G0NA 5KWEA 1YK1A 1PV1A 3I1YA 1Y4ZA 2IOHA 4E70A 1FYDA 1RE1A 5AUPB 3KIPA 1WO8A 3IQIX 4OKIA 5AW1A 2A7XA 2Y4NA 3CY6A 3IH5A 5MN4A 4F3TA 2DUJA 2JKVA 2NAFA 1MC4A 1ZI6A 1MRSA 2V9CA 2XMSA 3DZDA 5C4VA 2EBUA 4ZVUA 1GPWB 1X39A 5MFZA 3JPYA 1NR5A 1G4AE 2ZU6A 3G0CA 5DNAA 2YS7A 3CHYA 3GLRA 2QXTA 4KCGA 4LX8A 5CU7A 3TVDA 5KCZA 1DKOA 1M1NA 4GVPA 3A6PC 3LXXA 3W2IA 3KJHA 3VPFA 2VHYA 2R2AA 4DIMA 2VI5A 1U9IC 1UF9A 2F00A 1BN7A 2W6QA 4JZYA 2QMUA 4E7OA 4UM9B 1QK4A 2GZRA 1NV9A 3HUEA 1CJSA 3OT4A 4ENUA 2R87A 4F45A 2ALJA 1IB6A 1JAYA 5IDVA 5EE0A 5BNTA 4ND2A 5ITZA 2EERA 2EBFX 3HKEB 3JQEA 1Z73A 3UK6A 3S2IA 4G5QA 3ZK7A 2XB2A 2ZTUA 3HK2A 4E6PA 5BNFA 2LVBA 1CWUA 2YTZA 3RTEA 2I80A 1E2EA 2WWHA 5EEHA 5IW8A 2JZOA 1DDGA 1WIWA 4L51A 1QAOA 3P0RA 4LV5B 5CVVA 2UZ4A 4DR4B 4Q7KA 2E4ZA 4ZU1X 2QEQA 2GF0A 3IAM1 4FDTA 2MYNA 4TXJA 2QM8A 4B8ZA 2DUUA 1Z0SA 1EGHA 3BYZA 3U09A 2GDJA 4TOIA 3BL5A 4TN5A 3DJFA 4D9GA 1PEKE 2EJBA 1HRKA 2F1IA 3I73A 1G3MA 1XZMA 4RW0A 1CHDA 2VQ6A 4M9CA 3ZDZB 5BWLA 5EJ7A 3OOHA 1RHRA 3DFIA 1S9DA 4IO1A 5CDHA 5AM1A 5ALXA 3DHWC 3PUZA 5FUVA 4Z7QB 2ID4A 2J8ZA 5MN5A 4HQKA 4QXRA 2JFUA 5IKXA 4H6VA 1V43A 3PCRB 2CCJA 2DFKB 2OZLB 3ZCUA 4DDTA 5CDSA 2MTBA 4UHJA 2G9NA 1C30A 1KJ8A 5GGXA 4KP7A 4MMXB 4AJOA 2REQA 2HJRA 1VYTA 2WUWE 1VE1A 1T6YA 3B3GA 3C8UA 2HDHA 3IURA 3R6WA 2W6IA 3O4FA 1N9KA 4R40A 4PZ0A 4C7KA 1AHNA 1LY1A 5SZKB 4ZA2A 3AL3A 3IP5A 4CQMD 2GEVA 3IHLA 2J41A 4CM6A 2O52A 1NZDA 5JROA 3DTNA 1XZBA 4PLWA 1V8BA 1AK9A 3SD7A 2Q1TA 1J4LA 2VEDA 2RGNC 1QCDA 3Q40A 4OQYA 5COQA 1YACA 2OO5C 4EYEA 4PYKA 1X42A 5A0VA 1S8FA 1VMEA 1W85A 2X8BA 3SE7A 2OXCA 1T29A 2KMLA 3CF2A 4BMCA 1DGQA 4GMXA 3PNBA 3ZH9B 1EXWA 3ISTA 3ORYA 4GVLA 4RJKA 3UA3A 3BA1A 5CVJA 1ZZEA 2WD7B 4CKEA 1A77A 1TVMA 3JRNA 3R1IA 2DWCA 4OM8A 1REQA 2X41A 2QP9X 1HH4A 5ALIA 3VYWA 1XWFA 5KNCD 4RCZA 2J0UB 4HADA 1OH8A 5F1YA 2JIMA 3GLVA 4BP1A 4CMIB 2GWRA 4D02A 2PGOA 4UPDA 3R9XA 4JFRA 1DJNA 1ORVA 4OJYA 5HUHA 3C7TA 2AJLI 2H1HA 2DYKA 1CZKA 4M0LA 4JJ7A 4BY9E 3KTDA 4JI3B 2FQ1A 2P67A 5CT5A 1JIXA 2N75A 3E3LA 1WLNA 2VATA 3KKKA 2N3ZA 3GH1A 2WVHA 1AX9A 1CY4A 4UBMA 4P08A 1CFZA 3G2NA 6AT1A 2AVDA 1W2HA 1NWCA 4IR7A 4UTXA 5F3DA 3HB1A 2DBZA 4M9SA 2P2ZA 2DPMA 3LZ6A 3QVUA 3PHJA 4D1YA 3L8DA 4EITA 3HFJA 1ORWA 3LRPA 5IMBA 2ANBA 5CB0A 2PZAA 1IEQA 1K5PA 3VAZA 3ZR4B 4F84A 1XA4A 4BQEA 1Z2DA 1E6CA 1VHJA 3R9KA 4X1IA 3UOWA 1WPXA 2YFYA 2Y1OA 1XD8A 3DKRA 3WKDA 1PNQA 1T1JA 1PX2A 2C03A 3Q98A 5GOTA 2JAQA 1TMGE 1QHGA 2YR0A 1I24A 1Z06A 1C0LA 1GY8A 2FN3A 2KBEA 4FCWA 1MO5A 2MT9A 4IQFA 5A7HA 5JV5A 3K3PA 2QL7A 3EVGA 4RX1A 2FMHA 4DDMA 2ZTMA 5AJVB 4JCCA 3AFNA 2O2YA 3K09C 1JQLB 4ZCMA 1OREA 1A1SA 3BMOB 2G5GX 1AV7A 4RTMA 2Z8XA 4A73A 4FDMA 5I9NA 1Q1NA 3L82B 3OD5A 5AH0A 2NXEA 1U5AA 3RHTA 1L7VC 3X1XA 5KQMA 3B1ZA 4G1EB 4DQ0A 1V3VA 4N18A 1E1RD 1OWMA 3TNDA 4HUTA 2ZUDA 4YUXA 1PF7E 2FGJA 4RULA 3NFYA 2H8GA 3ZY2A 2M6RA 2G71A 3E58A 5EPOA 1HM5A 2HQBA 3K32A 4EELA 2X7HA 4GOOD 1WPRA 2O05A 1J0CA 4LFBB 1N7JA 2JAOA 5TARA 3MVEA 4TV9F 4U7HA 1NXSA 4J0HA 4Q3OA 1DFGA 3KELA 2GLUA 1KTVA 3DO8A 2C2HA 4XX0B 3LUBA 3QENA 3MCUA 3N0WA 4CT0A 4JI4B 4F6RA 5L40A 3OEYA 3RC3A 2VPXA 2HGSA 3AJDA 1HFJA 1R0XA 4HNGA 4KLZA 2V97A 4MWSA 1EJBA 4IDQA 1N2EA 2C9OA 3KOXA 1PNTA 3VAAA 5GVRA 4WKNA 1PWZA 2YVUA 4L75A 2DQZA 5EPEA 5ESWA 1Z26A 3U81A 1NNUA 4YASA 2O5CA 3IKJA 2B8TA 3PIRA 4RY9A 1JS1X 1M76A 1WBBA 1LUAA 4ZPXA 1VIVA 3I04A 1HMPA 4I4NA 2ZSIA 1F6BA 1DXOA 3SKVA 4EHAA 5CDGA 4IJQA 3E4DA 3QUBA 3RSZA 4E3WA 2JGLA 4MA4A 3FOCA 2E6KA 1DRUA 2AOVA 2R62A 1YBAA 1SVUA 2FN4A 3ONVA 3QP9A 3WGKA 3WLRA 3EPLA 3QWFA 2HJHA 1FDWA 1DJOA 1HLGA 2MDTA 1JHAA 3EIFA 1CNMA 2ECFA 2J9RA 5J2UF 2FZ5A 2PRYA 4MQ6A 2ATVA 3MWDB 4TKLA 4HLUA 2TS1A 1TCUA 5ETJA 1XVIA 2JH3A 5JS6A 1BVYF 1QUFA 1UP6A 2C4TA 3LT4A 2Y1FA 3O1LA 2OUIA 3O5AA 4OFBA 4UD2A 3G9XA 4UXIA 2IUYA 3RS0A 2W83A 1VBKA 1K89A 1SIBE 4HQ0A 1G3RA 2VCEA 1KIMA 5K0BA 4M53A 1A2BA 1W4AA 3WMWA 5FLXA 1K4KA 5KKCA 1PL6A 1FUEA 3B52X 4WI1A 4C0KA 1ULSA 4DN6A 3CYFA 4R1LA 3L7NA 5COAA 3BIXA 4FX5A 4UAVA 1OROA 4JBXA 2WSIA 1GDTA 3FSGD 2J9GA 3OLVA 2IU3A 4MVJE 4UFPA 3WFJA 3WGIA 1KWGA 1H23A 2OQ2A 2R00A 5C9ZA 3UQZA 2I99A 1RKQA 1F6DA 1W19A 3CN9A 3FBGA 4H3HB 4OHUA 3RODA 1K3QA 2NZWA 2ZRPA 2DHDA 3ANMA 2EFCB 4WERA 4IMIB 4KIFA 4N0QA 3JQDA 3MAAC 5FI3A 1VKOA 5FO1A 2PSJA 2B61A 3OFSA 2NVWA 4HTAA 3J80A 2NZXA 2GXUA 4WY5A 1ULAA 5BW6B 2J87A 3M6MD 2ODTX 5CH3A 3W5CA 5DCUA 1LSJA 1A96A 5T6MA 1P0FA 3KLPX 3LFHA 5E6RA 1GGNA 3ETJA 4S1NA 3UOTA 1UDBA 2R1VB 2EFDB 3E84A 3HA5A 3WICA 4C7OB 4Y9TA 1EWRA 4XPZA 4E5YA 2ET6A 2JD2A 1W9MA 3D6TB 2CNKA 4D9NA 1FSPA 1LLQA 1WZ2A 3N8IA 2FRDA 2IXAA 1G4HA 1A9OA 4IBOA 2HL6A 4RVOA 4C6SA 1L7AA 1SBNE 4LRXA 3RT1A 2EKQA 4M1QA 2C3OA 5CG2A 3TLEA 1CS4C 1F2TB 2Y4OA 5C7LO 2CT8A 4BNWA 1ZITA 2PYDA 1BYUA 2HTFA 2OG2A 4GMDA 2QVBA 3IP9A 4PLZA 1NHGA 4AKSA 3P27A 4G0XA 3OZFA 1PKEA 5EP4A 3LQFA 3IDQA 2BEKA 3H5NA 2UZ0A 3A25A 5L3VA 4ZALA 5C32A 4B2IA 1Y7HA 2EHJA 1BXZA 3I0NA 2A5DA 4IKPA 3UHAA 4Q21A 1AKEA 1EQUA 1B0ZA 1DC4A 1XAIA 4UM5A 3ZDYB 2CXQA 3IPRA 4DWOA 1C8KA 3HPRA 1JJBA 3VOBA 3FWZA 2P5TB 1NY6A 3MNFA 5JSFA 3A4TA 3AFOA 2YJ4A 1ZGGA 3JVIA 2ODAA 1PRYA 3SOZA 3N2KA 5JELA 1UPFA 4JKYA 1ODCA 2CYCA 3UCFA 1SCNE 4X3OA 3T5AA 1U7FA 3T15A 2NSHA 2XMDA 4HB0A 1UANA 4HDNB 4JIMA 2OYRA 3W2HA 2F7SA 4C88A 1TUBA 4QTYA 4TXNA 1ARZA 2BZ1A 3SZMA 3TZBA 4KC0A 1BROA 1T35A 3KSAC 5K2OA 4NXMB 5FWDA 4E2XA 2YRFA 4Z1OA 1FDOA 3H2JA 2QIOA 3F7TA 1KZGB 2DTEA 2V7GA 1KI2A 2WSMA 1J4KA 2UVPA 2XUZA 1OHHA 1UC5B 3CR7A 3MFQA 1ZLXA 4IIXA 4MR8B 1W6RA 3BMXA 5JRJA 4CDRA 2AFFA 3KHTA 2X1LA 3B3AA 4P7JA 1Z22A 4JB8A 1T36A 2C2OA 3DDOA 1WV0A 1J97A 1Y7TA 3I6IA 1UK6A 3EVZA 3CS3A 1GGVA 1Z3IX 1DCMA 1GXSA 2D1FA 3KHKA 4NZ9A 4P8RA 1RCFA 5HZMA 2X8AA 1JHOA 4RM3A 3DL7A 1N5LA 2QG4A 2WHQA 4BIMA 5JWRA 2IH5A 3O3OB 2C1EA 1Q11A 3PHHA 2JDID 4LV6A 3NIWA 3T9CA 2D3TA 1KWKA 1N2BA 3W3AD 4EJQA 3UMYA 4FWTA 1VC2A 2IUSA 3N58A 5E4TA 2X14A 4CF6A 4QDOA 3VU1A 4D3YA 3OX2A 4MITA 3FGOA 4WNCA 3H65A 5C4MA 1ESDA 4RIEA 1Y8RA 2FKNA 2POQX 2WUFA 3TOSA 4TN1A 5G0SA 1FMLA 2XOKA 4GL2A 3BFVA 3O2SB 1DIBA 1FSZA 5CFLA 2XRYA 3ED5A 1C3LA 1I4EB 4H9GA 1M0WA 3OF2A 5DX0A 3UJ3X 4NENA 4F96A 5BXQC 5FT9A 1Z08A 3F5FA 3AVUA 4LJLA 3TFQA 3GFSA 1G291 4QRIA 1EVKA 2EYQA 2I8AA 1PG5A 1B1CA 2PUVA 3C4JA 5ALOA 1Z63A 3OOJA 3NATA 1NN0A 4JT4A 2JGDA 1J56A 4Q4CA 4YRSA 4IPTA 1NU6A 1YQQA 4F2WA 1MAWA 1TF7A 5F23A 4H08A 4DJ5X 1IN6A 3LG2A 3Q6IA 2VS1A 3OE7A 4YMIA 1NW5A 3RF7A 4E1VA 3WRWA 2D1RA 2C31A 1OW3B 2P1DA 3X2EA 2Q6LA 1AN9A 1MAUA 3FWPA 4OKSA 1W87A 2JFWA 3II6X 4E5MA 4KXQA 1KERA 1ML4A 1C7EA 2UYOA 3AUJB 3MFYA 4MV0A 2HDNB 4AULA 3STHA 3FFWA 4KPUB 2J30A 4NOKA 2IYFA 2MSWA 1FZQA 2SKEA 1GRQA 3DMFA 5C8YB 3DMYA 2RGDA 2ZRQA 1DQYA 1TM1E 4O4LB 3TOCA 3PEEA 1PR5A 4PBSA 1YRQA 221PA 2VTKA 4RHXA 2I78A 4UBJA 5T57A 5A6VA 3KNZA 2PHZA 2ZRFA 5I4IA 3AGQA 2JIZD 2JVJA 3BE8A 1DG9A 4XI9A 4GS5A 5FTNA 5L3ZA 2GLTA 4ZDKA 4D4KA 2ZIZA 3MJEA 3ROTA 4DZZA 1K2VN 4GMHA 1GCAA 4H4CA 2V7UA 2DOKA 1JG1A 2I4TA 4JWTA 1B7GO 2YMPA 2JH8A 1NA5A 4XEHA 1QHEA 4F1KA 5I7HA 4LC9A 5ERYA 2CL6X 1VSTA 3A7DA 1WHSB 3WO0A 4W9MC 3RKRA 3DNMA 4EUKA 3UOGA 1MD9A 2BFCB 1XG5A 1QFJA 2WZDA 3ZYZA 2G6BA 1EK2A 2A88A 3P9KA 3Q8KA 3G85A 1XYVA 4D3ZA 5G0TA 2VC2B 3V8MA 3FW1A 4AZ0B 4MVJI 4A0RA 2IQIA 1SOWA 4Z0PA 1U3DA 2VEOA 2B34A 2PLNA 4EI2A 2XQGA 3TQIA 1AM4D 3ELDA 3GQBA 3ZEAA 2W2MA 4F3NA 1A82A 1OLUA 2QMQA 3QFRA 1ECCA 3EA4A 3JPWA 4QLAA 2P69A 3KD3A 4IVNA 5ALKA 2BFEA 2ORED 5A3RA 2NOAA 2XF8A 3PUXA 3EYAA 3GJ7A 2A1UB 2ODPA 3GQVA 3PPXA 3VA4A 4EMSA 3LYAA 5KOHA 3UPTA 4MIEA 2BVNA 1LLCA 4G5GA 5EJGA 1U9JA 4HB4A 3S2EA 1VCNA 2JFOA 4BXOB 4FLMA 4UM8B 3V42A 1IBRA 3FUTA 4FXOA 1RAHA 3P9CA 3B2QA 3D1VA 1Z18A 1VMDA 2B4YA 3VR4A 1T2VA 3VDNB 2RHMA 2R11A 4D9HA 1OZ0A 1ZNYA 1I4OA 2G0TA 5L3SA 2LKCA 4TT8A 1AURA 3X2SA 4LI0A 1E5TA 1JECA 2X76A 2MR5A 1ZINA 2JVIA 4D96A 4DQDA 4ZTUB 5E3HA 1U0EA 2VRCA 1KY5A 4Q4HA 2FA9A 4PLHA 3FPKA 2XT9B 1FNMA 1MG0A 2CL0X 2WSLA 1UPAA 4EW1A 3R5JA 4MPJA 3IPCA 2GCOA 4EFKA 5HK8A 5A0TA 4B4WA 4RSGA 2GN2A 3LVRE 1Q1GA 4TV9B 2IZ7A 2CE7A 1NASA 2MYTA 2WJIA 3D5QA 3QVTA 3AEUA 2FSPA 4HDCA 4PFSA 5FTKA 2FAXA 3WKCA 4DM7A 2C0QA 4H4EA 3DV2A 4AECA 5J9FA 4MCHA 1XZCA 2O9JA 4B80A 2XOEA 1EUCB 3TLYA 1NNSA 3FDZA 1Y9JA 4HQFA 3SF8B 2B4QA 4EPXA 3MMZA 3W5JA 1TJPB 3VZQA 1O9GA 4EQ6A 4RXTA 3IAFA 5J4LA 3KXIA 3QNUA 1VOTA 4X5OA 3RU9A 1UJ4A 2VF2A 4DJFC 3CX7A 3RYHA 3WGNA 3IGFA 3BSWA 3U0BA 3HY4A 1IATA 5L4SA 1M0EA 2VSOA 2QW1A 4RPKA 4KAAA 1GXCA 3GLIA 3WDMA 4LHVA 4F7WA 3QKTA 2ORWA 3JD0A 3FMOB 1I01A 5D3KA 2PTGA 1Q3KA 2BH2A 3ZKAA 2E48A 3HO1A 4LZAA 2R5FA 2ZYWX 1Z2EA 2A84A 3SS9X 4HGNA 2XQVA 1L3BA 4IKOA 4JP5A 4O08A 5ADVA 2SICE 1ZJ4A 2IYZA 4M49A 4B33A 2XBMA 3HZOA 1Y6ZA 3O38A 3ZD9A 2JQLA 1IXRC 1JA1A 3NYIA 3RNOA 5KU1A 3F5QA 1J22A 1ZGAA 3RS7A 1RLOA 1KHXA 3AT1A 2VXBA 2BMAA 4LBZA 4RQUA 1E8DA 3B20A 3GOQA 4N9WA 1KMNA 4G1FA 4WOPA 3BHIA 3LAWA 1WEKA 4G81A 4JBYA 4CV3A 3AY0A 2WNIA 4MARA 1M7BA 1ISHA 3RU3A 1AKMA 2VNJA 3TQSA 1O6GA 4WPGA 1BFKA 2JLAA 5EUBA 5CIYA 2SECE 2WFMA 3SIRA 2UZIR 4X93A 3WZ2A 3C85A 5CRIA 4L4YA 3EWAA 1LCIA 3C3MA 3MILA 1E2DA 3DBRB 1P5ZB 1S3SA 2D62A 2AD5A 2AT1A 3P9SA 5FEMA 3T7SA 3T1TA 4LGVA 3LBAA 5JDIA 4B7UA 3OY2A 3F2IA 1EKXA 2FW7A 1NFRA 4V0ME 1OAOA 1XHFA 3TKYA 4YYZA 4G0MA 2B8EA 1LWOA 5GINE 1Z0IA 2CW5A 4N49A 3RTCA 1GIAA 2OECA 3MTGA 4L15A 4NV3A 4AO6A 1W8DA 3DOIA 1P2UA 1QWOA 5KHAA 4MDFA 3M82A 1T9ZA 4JNCA 3TI7A 3C3YA 1M5RA 3HCCA 1UWLA 5JFOA 4L50A 1LJUA 3CN7A 1K5DA 1N6HA 2FLKA 4BNIA 3RWMB 2RONA 1C2YA 2RAPA 3MINA 2GYYA 1E77A 2JGMA 1WKCA 3GNLA 3E4CA 3PQ2A 2D3WA 4J2HA 2CUTA 1GFWA 5CK4A 3S27A 3U49A 5KQRA 2QMEA 4U5XA 5ELLA 1MA0A 2O2EA 5BN4B 3HBFA 3SFZA 1RKVA 1TQHA 3MCVA 4MH0R 4EATA 2RFLA 1JAZA 4CKBA 1E3DA 2HFJA 3K70D 1FUUA 5DBIA 3W6OA 1QTQA 3E2IA 4QDXA 1ZRSA 4UE3S 4G5XA 1H4TA 5G4KA 4L9AA 2JQIA 1JDTA 1N8TA 3VPYA 1F8FA 4J0JA 4QFMA 3W0LB 4KE7A 1LJLA 4ZTZB 3I9V6 1I14A 2ATEA 3A1TA 4IVQA 4P0PB 4CR6A 1HXHA 2ZB3A 4QUBA 4AZVA 1S2DA 3HG7A 3PE6A 4C3VA 3FD8A 1SY7A 4B3FX 1TK9A 4HVAA 5CA0F 1VJCA 4QGGA 2H1OA 2VSXA 4QC2A 9GPBA 1XZQA 4U6SA 4DNFA 1J9EA 2W4MA 3E3OA 4E0BA 2GBLA 4EO7A 4F04A 3SSAA 4MQ4A 1EUDA 4MWCA 1QVZA 5EJ5A 1F38A 4MINA 4MJXA 1J6UA 2UYHA 1USUA 2P8SA 5K3FA 5TEVA 1MTZA 2XUPA 2VUUA 4OHZA 2VDLB 5LKAA 4DCCA 4J0IA 3DDCA 3ML1A 1DAMA 1U2DA 2Q3CA 3CE9A 3K0CC 4UHKA 1LTQA 1O96A 3KZVA 4HOYA 1XQYA 1XDDA 9LDTA 7REQA 1WZCA 4YDQA 3FGNA 3O95A 3AR5A 4LOIA 4C4PA 3U4IA 3ENKA 5JECA 5AVXA 1R7RA 2I4IA 4XDZA 4XXHA 3OBIA 3G2HA 2P9CA 1ONOA 1P19A 1RI1A 1U3FA 3PFKA 4HYEA 1JP7A 3OZBA 4HFRA 5SZIA 1JKIA 1ZCFA 2H2IA 2F8LA 2QXYA 2NADA 1FE8A 1KEUA 2EZ4A 2PZKA 2GT1A 2JW5A 3ITKA 1LZKA 4H7FA 2ZAYA 1RFLA 1W46A 1ISIA 5JMOA 5LD2B 4FK8A 3CA8A 4BO1A 3ENVA 3D6NB 4MLZA 1ZIDA 2YQZA 3DF9A 4RGVA 2GYUA 3X1JA 4V0QA 4NAUA 1YK0A 2BKUA 4FFLA 3QEOA 3FOFC 1QMPA 1Y5MA 1HE4A 1I94B 3KUUA 1NJSA 2CK3A 3H2ZA 3NHWA 2XODA 3VDRA 1KH3A 3EE6A 5E0KB 3ZVRA 4AJJA 2I7XA 1NM5A 3CRZA 4GUDA 4ZVQA 1CE8A 1W25A 2Y0CA 1NSTA 2G4CA 2P77A 2ENUA 2CY0A 2BZGA 4ZOCA 3RASA 4DV2B 1B6RA 1JG3A 1GL7A 2LTAA 1Q15A 4O6VA 4UMEA 1GCIA 1N6PA 2PA3A 3P97A 1PDOA 3Q9NA 1SHKA 4Y6LA 4HX2A 1R0ZA 4X61A 3B36A 3E5MA 3ECCA 5G1PA 4P54A 4ZN6A 2O8FB 5TDHA 1AH2A 1MXFA 2IK8A 2H1VA 5AKEA 1SAYA 3BXEA 3D8UA 2CYBA 4HAIA 5IMSA 1UXJA 4YPFA 4KVZA 1ODLA 3RS4A 1OZGA 1CQZA 1NKTA 3T94A 3D1JA 4MKHA 2J0QA 4CMAA 3MERA 1OFUA 4I36A 1ZD3A 1SB8A 1Q1QA 5KS2A 2YXNA 1C0KA 2ONJA 1IBMB 1R1DA 2F9LA 3A32A 3JYHA 1J23A 1DX9A 1IZ7A 2HHJA 4ON9A 1YAHA 3EC7A 3KQLA 2XKJE 4QUJA 3OHPA 1L7XA 3I6MA 4LI3X 3AJRA 3LPMA 5AWFC 4MS1B 2PQ2A 4PYNA 2H29A 3FYSA 2HT1A 2C20A 4RJTA 3Q0TA 2J7PD 3H3JA 4KG7A 3K5IA 1DKUA 1NVTA 3SBOA 4F21A 1ZN7A 2SKDA 4KW7A 4IIFA 5FL3A 4AKGA 1GKKA 5JFTA 1RI2A 3O2NA 2A67A 4EY4A 2VTBB 3WGUA 3HUUA 1G5QA 2BISA 3ND6A 2HXGA 2NXJA 4D98A 2R7KA 3F5SA 5IDYA 3FUWA 4FZRA 3V1NA 3PSHA 3DB2A 2HSDA 3L1UA 2BDTA 1ZXBA 3KT8A 2FUG6 2I7DA 1LI4A 4HH4A 2NTJA 1Z13A 1Y33E 3MJFA 4DCOA 4M9RA 5KVVA 4EL0A 1TA4A 3IJEB 4D81A 5HJ7A 2C0PA 2DQSA 5DT2A 2OLJA 1I4LD 3DT9A 3F1KA 2XT0A 4CLHA 5D7NA 3LY8A 4JN6B 1OWLA 5B12A 2XYPA 4FDLA 4JNKA 1GNPA 3VNRA 4MS3A 4DBZA 1U3CA 3M81A 3THWB 1V5FA 4S1VA 4WESA 3PYMA 2R8XA 2VYVA 4ARAA 4Q39A 3B1VA 1V47A 1OV4A 3LBYA 5LL6P 1M2JA 5KZMB 1XV5A 5BN3A 3J81A 2DJIA 1L5ZA 1SUIA 3F6BX 1OY1A 5KI6A 4DLKA 1P6UA 4DSZA 4M1ZA 3ST7A 3M5CA 3D0RA 5T6BA 5TQ2B 3O2JA 4UVHA 5BUZA 2AQ8A 1SZDA 1BCSB 3CUKA 3RSFA 2V0GA 1SXJD 3MELA 3UC9A 4HGQA 2R47A 3CMCO 3H05A 4R5HA 3RNLA 4WT7A 5F76A 4BQQA 1N25A 1CZOA 3FDIA 2QTGA 1DZ3A 3AR8A 1X7XA 4NBTA 1ZHHA 1TZMA 3G2QA 4QUDA 4CTMA 4YMHA 1N6NA 2PZGA 4TMZA 2JI7A 4CMBA 2QJTA 4FWIB 1GEEA 3O7MA 1CDOA 3C24A 1AHIA 4V03A 5LJLA 3RJZA 1IYZA 1ZGZA 3IOBA 5AXBA 1WD7A 1YIAA 2ZBQA 3VC1A 3UMZA 1OT3A 3OE4A 3CPSA 1IOWA 1G2PA 4JQOA 3NJ4A 1JHRA 2GAOA 1KYVA 2H1LA 3F5DA 1H6AA 1VJ1A 4CCWA 2L17A 4JODA 1AK2A 4ONEA 1KBQA 1TIPA 1FHQA 1B8NA 1HEYA 3WZLA 3PCXA 2GBFA 1IZ0A 5DM1A 2FSGA 3KV3O 4CLOA 4LWOA 2Q21A 4FHCA 3PGKA 4L16A 2J3LA 1CQIA 1GYPA 1YT5A 2EKLA 2H17A 3EPJA 2QRVA 2HLNA 3ZCVA 3USES 1ETUA 5AI4A 2H65A 3ILSA 3M2TA 3H9UA 3N2YA 3AHHA 3GA7A 1P3Y1 5L7WA 2XHZA 1VA4A 1ITZA 4R51A 3VNSA 1RHKA 3C6MA 3FPLA 2JKDA 1QIIA 4OJMX 1U8EA 5CT9A 5TJ9A 5M7EA 3IKTA 1UADA 2Q9CA 3G5TA 5EPUA 4EZBA 4JI1B 1YMVA 4LBWA 3KM0A 4MQBA 1AG9A 1BWQA 1XKXA 4FPXA 5C3MA 4BWFB 4GM0A 4RZ2A 5AIBA 1QYRA 2QL6A 3A3NA 3D2LA 3TJMA 1I0LA 3USCS 2E1RA 4DCSA 1CJBA 1M34A 4M1KA 1TL7C 2ISQA 1AK1A 4IIBA 6ADHA 3H6HA 1M9NA 1NU8A 1XN4A 2PRSA 2VT3A 4RTOA 1ADCA 2Y71A 1VKZA 2VLIA 2BHNA 1MHPA 3ZW8A 1GPBA 1ZNQO 3NPMA 1KI1A 2OAEA 4IEFB 4NNJA 5I4KA 1JHYA 1C30B 5FP0A 4GEGA 5HIIA 4R83A 3X1MA 2KKLA 1QANA 4C0SA 5CVCA 2NUAA 3QHQA 3RS9A 2PX2A 3E53A 3P96A 2EG9A 3F96A 2FEOA 4CCSA 5I01A 2BRUC 2Q5CA 2C77A 3F7MA 2HN9A 1IAQA 1L4EA 4PG7A 1OLSB 4BFTA 3HU2A 5LMCA 1CS0A 1GU1A 4Z1MD 1HBJA 3H0CA 3JQ7A 4A1OA 5BYKA 3GLTA 3TIIA 3RTAA 1SKUA 1USGA 2VJOA 3LCVB 1QAMA 1VECA 2FPWA 3LL7A 4QG3A 3EPHA 3FPJA 2ERCA 3GCGA 1VSUA 3RPEA 1HE1C 1Y6QA 5JPCA 2PFSA 3U3DA 2JLCA 2KPOA 1FTYA 1W85B 1UBCA 1WSBA 2R6CA 4G5RA 4PNPA 3MIIA 4KOEC 2AX3A 3CG4A 4OLFA 4V3CA 1CETA 2C88A 3WAJA 1FCJA 4L5IA 5TB5A 3ZIAA 4B4VA 1IVSA 2HEGA 3FPEA 3QKWA 4H4DA 2Q8NA 2A9KA 3PB3A 1KAGA 2Q1YA 5K0FA 1H5NA 4G07A 5JOQA 2GPTA 2ONCA 3Q11A 5DGCA 3C8MA 2I2WA 4J0FA 7GPBA 3KUCA 4ZQGA 1LW6E 3X1WA 5B58C 1XN1A 4Q24A 3AUSA 3BIJA 2FZVA 3KTAA 4LFAB 4IF6A 4D0RA 1GWNA 1I9CA 2JD0A 3OKFA 4F60A 3FPHA 3R3JA 3C7CB 3EXG1 4PX2A 1P6XA 3K1AA 3N75A 2GJ9A 4G89A 3SMVA 3DDNA 1XNJA 4BASA 5LOVA 2FEAA 1NYQA 1CY0A 3CNOA 3KSRA 4V2UA 2CWDA 2IX9A 3FFAA 3PDUA 2XQFA 2AQHA 4X8OA 4JJ6A 3T4PA 3AY3A 3IAEA 4Z4CA 2M6LA 2DPYA 1HT0A 2CHFA 4OHMA 2IGTA 3QVVA 3UUGA 2RDMA 4HH1A 1X2EA 3PHGA 1G5RA 3JX9A 3OM9A 4YAWA 5DBGA 2H5IA 4HPWA 5BRJA 2BR4A 3EXHA 1E6LA 3IT1A 1N3BA 4NMHA 4JV5B 2AV6A 1QU5A 4K46A 1AMUA 2JFZA 3IALA 1BU8A 1M75A 1E58A 2DULA 2OHGA 2VAWA 4O8CA 3WYEA 5K4HA 2PM8A 3EPKA 4Q1EA 1FFXA 1W29A 2I0FA 3SMQA 4DV1B 1FSSA 2YVQA 3UJ6A 1Y9AA 3JASB 1GTSA 1VBNA 1SK8A 2JL1A 1SVMA 5BORA 5HIAA 4H3SA 5IXSA 5JG7A 1K7YA 2Q0XA 3FNFA 3GUUA 2QVCA 2BY4A 1V7ZA 3L7MA 2EARA 2NO4A 3UGJA 1RPZA 4GXQA 3JZAA 1R6AA 3BFPA 2Q41A 5DYGA 1YDGA 4N0DA 4EMUA 5LVAA 5SYMA 1H8HA 2IYEA 1PZEA 1XTSA 3ESBA 1RJDA 3G79A 3PCTA 3H16A 3PDCA 4LQLA 2O8CA 1P33A 2ZSEA 4UW9A 3NHAA 4KRFA 3OC6A 5DNDA 1J39A 5JWOA 1ZXLA 3NS7A 5J58A 1RHJA 4LBYA 2CFCA 1AGYA 4RFLA 4JC5A 4ZAGA 1IEXA 5AXDA 3K0EA 3RFFA 1E89A 1R8QA 4GKBA 5D85A 4ML3A 4DS3A 3DUFA 1S8NA 2J6IA 2ZJYA 1LC3A 1T0PA 1VLVA 4MI6A 2X0DA 4CEIB 4IOMA 4QBKA 4QYMA 7ADHA 2AUMA 3FCOA 2JLYA 3BTUA 4IIEA 4DFDA 2N1BA 4E09A 1TM2A 4NV0A 1WETA 2H1IA 3O1IC 5AOBA 4JT9A 2A0KA 4OIMA 3L49A 2XQKA 1QPBA 2YHAA 5CAEB 4C4ZA 4ZJYA 2DPLA 1H2FA 5DYWA 2J32A 3MWYW 2IV7A 1UPTA 4J3JA 2PUTA 3FF1A 3OWHA 4HDRA 2VJQA 3D2BA 3NTLA 2HRDA 4DGSA 5TS2A 4BLVA 1R3UA 2PLWA 1P5HA 2XQIA 1Q77A 3ETGA 1KMHA 5KBYA 2HLDA 4M46A 4EYOA 1PIWA 1FY2A 2WTBA 4P93A 4XWOA 1A8IA 2GEDA 4IIGA 3UGQA 3BWXA 1O94A 4P4GA 2V6FA 1TQ8A 4QUIA 3HJCA 4ARZB 3PRJA 4DW8A 2C7RA 1A8HA 3GDOA 1O97C 2X77A 1THTA 3HY6A 1JT9A 3VR5A 3QQPA 2VAXA 1J5XA 4B6OA 3EVNA 3VUFA 4U7DA 5ELXA 1UDCA 4LIPD 2JIOA 3VYVA 3T1YB 4K6KA 5F33A 4PPYA 2HJWA 1XFDA 2COKA 1K66A 4R3UC 1KYIA 1D1TA 1OZFA 1VHDA 2WNHA 1NAIA 3HRKA 3PSAA 2I3GA 5K0LA 3ZQ4A 1KDTA 1RJGA 3DW1X 4B47A 1TTTA 3U9SA 1E5QA 1HG1A 1YZGA 3KU4A 4L72A 4Y2SA 4NKRA 4AF8A 1JFVA 5AP9A 4A3SA 2JARA 3IOEA 2W43A 1LPAB 4G1BA 3EIOA 3BWBA 1P4RA 5IK2D 3VR1A 4PYIA 3H5LA 2AXNA 2BEWA 1H5UA 2E3JA 1E5XA 1YSCA 2JAUA 3I1IA 1UJMA 3QVGB 3TDMA 2N1MA 1IUKA 3BBPA 5GQSA 3RI3A 3T61A 3UAGA 3AR3A 4NR0A 3CNEA 4KQXA 5H59A 1RLJA 5BUSA 1J0DA 4JL8A 3JR7A 4YJFA 1AT1A 1SBIA 3W2EA 4YXFA 3W90A 4AUEA 4DQLA 1HZJA 1YZYA 5HKOA 2PH7A 1KFBB 4PHHA 4DR7B 5CK5A 4R2XA 3TQCA 1VJGA 4I6JA 3W9YA 3I2FA 3EZGA 5DLEA 1GDDA 4BMDA 1G38A 4JI2B 1VPEA 1PO7A 2WZQA 4EYGA 3BEDA 4WCDA 1T5LA 3F78A 3I2YX 4DJTA 4R0VA 1M54A 1DKRA 1WS6A 2IU4A 3O4GA 3MJHA 2ZRBA 1ZWKA 1R37A 1ESCA 1RDFA 3NHJA 4V1CI 5SYAA 1KJYA 4MWTA 4AYTA 1JJVA 3AF3A 3OZXA 3V3KA 4C7XA 4DCUA 5D51S 5JJ5A 5LBUA 2PLRA 4UU7A 1PEYA 4JI7B 2QR3A 1E1DA 1IHOA 1K4YA 1LX7A 2FPGA 1EK6A 1GPYA 2MU1A 3SZ3A 4AMZA 2QSUA 3O84A 4GOLD 4OO3A 3O73A 2JCBA 3LW8A 3AHJA 4OK3A 2BJVA 2RH8A 1ENOA 3EDRA 4G41A 2GFQA 4DMCA 1BCRB 5HS4A 1HNWB 1TVCA 2OO7A 5C7IO 2LWIA 3UZUA 5JNVA 4PC7A 2I71A 2GEFA 3F9CA 1QHSA 1YE8A 3A1UA 3IEXA 4MGKR 4ENSA 3CZQA 5KNBH 4QQ8A 3U4AA 3MS2A 5LP6B 1JALA 1PJSA 2ZSUA 2CV1A 1D2AA 1FMJA 2AOUB 3FNIA 3GCXA 2NVBA 4GQBA 4JJEA 3V9PA 4B6RA 3AM1A 5EUCA 4M7PA 3RTGA 1T15A 3KVOA 3RYCB 2XCRB 2XIJA 2PU5A 3N0RA 3SQOA 1W36D 2JLVA 2WU1A 3M1YA 4KZKA 4HAYA 4NRDA 4MR9A 2Q6VA 1QIFA 2A5LA 1WWKA 3BZWA 3DT6A 4IH9A 1E2KA 3IUSA 4GP6A 3HU1A 1YVEI 2QUHA 3NVDA 3F3MA 3U3XA 4JY7A 3P19A 3S2GA 4D9IA 2KB4A 1J8DA 1KP9A 1X80A 4MYCA 4X64B 2DCUA 3H1TA 1JDJA 3A0UA 3B9RA 2C2ZA 1W5SA 2BLNA 1WU7A 1U7FB 1S2NA 2Q3MA 4ZXFA 5AO9A 4F6LA 5EKDA 2QX7A 3P5BA 1J99A 1JR3D 1DWQA 3LCUA 5BRAA 3W2FA 3HCRA 3E0QA 2VBFA 2GJ4A 2EBHX 1KXJA 3NEPX 3FGZA 5HF9A 1PVOA 2AKAB 4ARSA 3SQWA 2VDUE 4A0QA 2QJFA 2AS0A 1FYVA 2XUQA 1OWPA 2I3ZA 2LKDA 3ILXA 4FIZA 4S24A 4BB9A 3ECSA 5JAPA 1F6WA 1D0IA 3LQ2A 2X8LA 1WCV1 4CF4A 5KC8A 1QK3A 2XCSB 1SBTA 3V8NA 4C0HA 4RVFA 4OQPA 5E7JA 3ROFA 5H70A 4KIUA 2JNWA 1TM3E 1B3RA 5DT9A 1XDWA 1QV9A 4H1WA 4OHVA 1QFXA 5KYYA 3P2KA 3K1TA 1G6Q1 2FPMA 3SC2A 2VP6A 2A7QA 3PL1A 1ZMOA 3QLTA 2O6HA 1O77A 4MUJA 3PS9A 1AKVA 3S28A 4M3NA 3UV0A 4UDNA 4I9FA 3VKHA 4CQMA 4H7EA 5EKTA 1D03A 1SQFA 1G41A 4W1RA 4PCVA 4WK0B 2RAFA 3CX4A 1EHYA 6CHYA 4F72A 3IP8A 4R31A 3GROA 1HFWA 3QUSA 4A9AA 1EAYA 2AYYA 2XADA 1Y8RB 4MUNA 4UVEA 1FVXA 1XYGA 3T54A 2O8NA 5DTMA 5TGDA 1D3AA 2H52A 3Q0EA 4PTLA 2FPRA 2VRBA 2F9MA 3KYDA 5C4GB 3MWJA 5IUKC 2VDJA 2NUTA 2IZZA 3CLUD 1KFKB 3QOWA 3M3HA 4I9GA 9ATCA 4NENB 4K86A 2SCUA 3Q1LA 3EFHA 1YKSA 3EIQA 3G5UA 4JCOA 1E3LA 1TE2A 4O33A 2PJZA 4H31A 3GJZA 1GT6A 1HE8B 1C1HA 1KP2A 5F5LA 1NW6A 2X5NA 1XCJA 2VPPA 4JYMA 4LDAA 4FUQA 2AN9A 2JGDB 3QEMB 4RZ3A 1RYHA 2DBQA 1J25A 2IYVA 1XDBA 2ZDHA 4NYIQ 4P86A 3JQGA 3IMEA 4QPPA 1ZH4A 3U39A 5JPIA 1C3JA 3JVUA 4B5LA 2QROA 1GQYA 4LJ6A 3HLKA 3SYKA 4UULA 1MT0A 3IAS6 5EE5B 1CNEA 5AXCA 1Y5NA 5A5FA 2IHZA 1L5HA 2C9YA 2FUKA 4DV7B 4U7PB 1UFOA 4EHBA 1R5JA 4P31A 5A9TA 1RRPA 1GZHB 2BHRA 2WJ3A 3HH8A 3MM4A 3OOSA 2OB1A 3ED1A 4U2FA 3TIGA 3ZU6A 3B7WA 5HRAA 2RARA 3QVLA 4X94A 5KNDD 2RMKA 3WTCA 1EM8A 1QFZA 2Q2OA 4EX7A 1WE2A 1HX7A 4GWLA 1DINA 1PJ2A 3NIDB 3OY7A 4KRYA 3OKCA 3QY9A 3A4YA 2BFFA 4NYMQ 1H5QA 1MT3A 4QXAA 3AEKA 4DR2B 1YHYA 4QQRA 5IVHA 3VPCA 1A9YA 2OCDA 3JAWA 4WK4B 4AZSA 4HPXB 1QHIA 5T8KA 1KKLA 5CYGA 1MH1A 3UJ9A 1SKBA 2PX8A 5LIPA 5TSDA 2O8EA 4MGHA 4MMYB 2Q07A 4C0WA 4JUCA 1HQDA 3AHEA 1WABA 4FYMA 1B41A 4MIKA 1P2TA 4WZAA 3FRIA 1E1RA 4KR9A 3H1GA 2AHOA 3WO1A 2HREA 4UHEA 4H18A 5J1TB 1YS2X 2GEBA 3O90A 4HEQA 3MWKA 5F7ZA 2OXTA 1NKSA 1Y5IA 2NTYC 3EY9A 3OFND 3PFIA 4G8BA 2K2WA 4WV3A 5EWLA 3TSCA 5B6PA 4KDRA 4M54A 4A23A 5HJEA 1JFSA 3K1JA 1VIMA 3B3FA 2ASEA 2ADOA 1WUTA 1XTUA 1RAFA 3I4FA 4M8NE 2QRQA 3N8HA 4BE9A 5C8VA 4M1YA 3E5NA 5EAIA 1V8DA 1LLUA 1P7VA 4FONA 1N0VC 1OMOA 2P6OA 4FNAA 1HYGA 4GI1A 4Q34A 421PA 4MRMB 2YL2A 1AXGA 2LRHA 1Z56C 1GUYA 2NTEA 3MMSA 3V3TA 4YI5A 3RV3A 1GKUB 2C4MA 1VCHA 2ZRGA 4X44A 1IZ8A 1JU4A 2BL4A 1KOGA 3GJYA 5DNUA 5HM6A 5L3SB 4R6WA 3T5DA 3ZBPA 2DHCA 3PENA 4TYMA 4YP6A 2MSDB 3HXOA 2GB4A 3M9LA 5DTRA 4NU0A 3UXYA 2P78A 1O4VA 5JXJA 4Q4HB 4F5ZA 2FUG1 3WR5A 3EW9A 1EVQA 2EWVA 1DC7A 1NXVA 4UCWA 1C7JA 4MTLA 1KOLA 5BR8B 4W5QA 2PMFA 5JBNA 4B3IA 4MVXA 4KUGA 3H75A 5F4ZA 4MYUA 4WRRA 1QG2A 3ACCA 3ZTYA 1E7WA 4HDAA 1BX0A 1TYAE 1FRQA 1IXKA 2GHQA 4N82A 1RCUA 1A2QA 3I53A 3R3VA 3K20A 4C2AA 1WHTB 3FDZB 2XZOA 5EZYF 4OYRA 4UDOA 5J4HA 4WZ6A 1B14A 1LSOA 4F38A 4EQ6B 3RDPA 3DPSA 4PIMA 1ZD9A 2DPXA 2GPNA 4Z4QA 2O57A 2W6JD 3PFHA 4RVNA 3L92A 4UVDA 1NF9A 2E2WA 4R2MA 4EK9A 1M2VB 4IKEA 3K0AA 2IW1A 3WFIA 2OHFA 4MOWA 1R8JA 4FUTA 3GLIB 3FSGA 2BUBA 5IN5A 4YRQA 4M83A 4MGZR 1IRIA 1D2MA 3T8YA 1JIIA 4MEBA 1MPXA 1WUHS 2C78A 3ZLBA 4TLEA 1NN1A 1V95A 2J45A 2YY5A 3KEQA 4KQ6A 4NONA 5H1YA 3OQHA 3TI9A 4OQEA 1R4NA 3WNVA 3EXIA 4DTIA 4MIYA 4Y2QA 5D3ZA 2XDYA 1EEXB 1K6EA 5JDIC 1KDRA 2H9YA 1Y4UA 4G0QA 1FJGB 3H9QA 1G3UA 1DAIA 1M1YA 1ISJA 3DTVB 3NAZA 1TA9A 5EZQA 3JVVA 3D6MA 2W2PA 3GMDA 4KKVA 2ZEJA 4TWJA 1VGQA 2XSZA 4DY6A 2Q4OA 2YZKA 5E9JA 3TPFA 4C4AA 5IT5A 1P5FA 4YXWD 4PLFA 2IHNA 2QA5A 3H99A 2Z4TA 2AJ8A 1UJCA 1YR7A 2V55B 2ZSBA 2D4AA 3A1VA 3PICA 5BUQA 2I4RA 3FUCA 3L1JA 3SZGA 2DUMA 2C7GA 1YRWA 4D9BA 1OXXK 3UFBA 4E2FA 4O2RA 4TMTA 3FCYA 3VPGA 2F3UA 4DSNA 3QPDA 5DYIA 1IY9A 1JDVA 1PYDA 1K3TA 2XAUA 3U4QA 2ZG6A 5JHGB 1EFAA 1N2GA 2OHVA 3CMMA 2AFVA 3H1EA 3UT0A 4IZIA 2XTNA 2CLCX 4ZANA 4D92A 3PVSA 1WB5A 2ZIXB 1YB2A 3GOHA 4KSBA 4OIFA 4U7FA 1Q0ZA 2QRZA 4TWBA 5HFNA 1ZH2A 3LUCA 1B6TA 2IEZA 5KYKA 2OORA 4IJWA 1KJZA 3NC0C 1Z7WA 1MJSA 2KJQA 3FE2A 2YWRA 1NMEA 3C3DA 4AQDA 4EY3A 1P81A 1RYFA 1U7UA 4JDPA 5SY4A 4QPNA 1Z83A 1WUYA 4GI7A 1EZ4A 4TTJA 1KFEB 4TLLB 1MTOA 3U19A 5DK6A 4IJMA 4V0OA 1FTGA 3ZWXA 4PIVA 5GIPE 2EX4A 1T2EA 3MINB 3PR1A 1EMDA 1XJ5A 1CQPA 2ZVPX 1M2EA 3MN1A 4DUPA 1V71A 3DLTA 3FCXA 1MW9X 1I1NA 3N5KA 3PKZA 4M0KA 3VSBA 2PMEA 3A11A 1CLEA 2CXOA 3H1BA 4H15A 5G41A 4B6GA 1A5AB 4L8YA 4YRBA 5IBCA 3C6YA 4CKBB 1RPTA 4JLBA 3SJ7A 1JLLA 1NW9B 3C3EA 4I50A 5TMPA 2DXIA 3PKIA 4MRAA 3QG5A 3OAAA 1PJLA 3GP5A 1Z6QA 3BK7A 1AMOA 3IA7A 3QUAA 5D00A 3WWOA 1RWKA 2ANCA 2NVOA 4J75A 4CR7A 1J7KA 4LRWA 4XX1A 4FQ7A 5CP8A 5K3AA 2C5HA 2KLHA 2FG7C 3R76A 3TNYA 3QVSA 2JJ1D 2Z08A 5ILGA 1T4CB 5TR9A 3G9QA 1NG1A 3MW8A 2FPOA 3GCZA 1N2CA 1EAMA 1GGHA 4DR1B 3RIHA 1G21A 1JJ7A 2G09A 4FNGA 4RAOA 2AJTA 4LNUB 3WGGA 1T5SA 3AFIA 4PHFA 1IDN1 1VFNA 4WIAA 2YIMA 3T0GA 4HEHA 2P4UA 5KQPA 3A9SA 3O3NB 3KT9A 1BDJA 3TPCA 1MX5A 2W37A 1Y3AA 2W00A 2JDIA 3P2IA 4OOEA 4NFHA 1VHTA 3FVVA 4MKRA 2W22A 1JIQA 4JP2A 2ZI9A 1X1TA 1W4RA 1WP9A 2ZKIA 5IJWA 3OPYI 2C4WA 4GPAA 2CZGA 4QPJC 5JZOA 3UM9A 7REQB 1T2DA 2PRZA 2QHXA 2NUPA 3WIUA 1E0SA 2VBGA 4UM9D 1A9XA 5LNK1 1UAYA 4II2A 1I4TD 5FFNA 2YVLA 1XXHA 3O9VA 3ON5A 5IC5A 4DNPA 1U1GA 3N7UA 1SVSA 5AHKA 2JJYA 4E5UA 5LN1A 3LX6A 1GZ6A 4UATA 2EFYA 3D4IA 2WICA 4K1LA 1YBVA 1BW9B 5FORA 1PFKA 1V1MA 4X8MA 4WK6A 1P5RA 1O5TA 3L4SO 3M9XA 3LOPA 4CT4B 1YA8A 4Q02A 3LSYA 4NCJA 1JI3A 4YCNA 3AQIA 1KPHA 4FGWA 3RAJA 4NZNA 1W5BA 4LXIA 3ZQUA 3ZUPA 4LBVA 4MHSA 2EKBA 3B89A 4KQHA 5IASA 2K7FA 3M4JA 2Z5VA 1DJQA 3OA0A 5BQFA 4UQPA 1K3FA 4HWSA 4FJ2A 2Q49A 3HKDB 1XZAA 1DKQA 4MW5A 1NVBA 3SHTA 1JXAA 2VA9A 2JQJA 4WUVA 1WVMA 3F67A 1ZUIA 4H6WA 4WBNB 2I6UA 2XT6A 3L8CA 2PK3A 3CUEF 3DULA 4FC7A 4QTXA 5E6UB 5EP1A 1T0BA 4YV7A 4N41A 1JW9B 1VP9A 4JVSB 1E66A 4UCXA 3T9FA 3GQSA 4DIOA 2G06A 2H16A 3GJ8A 5SZHB 2C2KA 3ELUA 2JEYA 1CT9A 1W5FA 1AF7A 2IXBA 2QI9C 4YP5A 2P9YA 5EL0A 3DYIA 3JZMA 3ZDCA 5EYPA 2J6CA 4NNOA 3OT5A 4Q9JA 3ZOZA 1TJ3A 3KB2A 3NGMA 1JFLA 2WF9A 3RKSA 3IAAA 2JIZA 1J9GA 3LDHA 5BQ5A 5EMLA 1BEUB 3I72A 4CM8B 3N2IA 4N6NA 4LYGA 1TTHA 1U1FA 4CN9A 1UC4B 3E8MA 5E7QA 4M9XA 3SFVA 1BS1A 1NYTA 4OYHA 1NJ8A 3GRAA 1L4YA 5E3JA 4C1NA 1MA3A 5L6MB 2GD2A 2XKKA 3LXUX 2PKEA 3DLHA 5MHTA 1DAHA 4MW4A 5DHQA 2Y0PA 2Y27A 5F77A 4JUAA 1FYWA 1XRMA 3OIUA 3P1JA 3ZWMA 1U7OA 2NUBA 1JEQA 2VPZA 3EBLA 2CVPA 2WAMA 2ZK7A 1I2AA 1RABA 2REBA 1QYDA 4LSMA 2WHPA 3D8BA 4HD8A 4NG4A 2QTZA 3R5SA 2IP1A 3LXMA 4FT2A 4XWGA 1KSHA 3ZNQA 1AC5A 4TQGA 4L02A 1FRNA 1H2BA 2FF7A 2W8BA 2INGX 4ODIA 3FYTA 5DV9A 2BYTA 3KR2A 3K8OE 3FIJA 3BE5A 4NEGA 2GN4A 3L02A 4GMFA 5K45A 2DETA 1ISMA 4R6XA 4RL4A 5KYWB 1BHSA 4HEA1 2XX3A 1DHRA 1MOZA 1OXMA 2GCGA 1A5TA 3B53X 4B3JA 5EFZA 5DHUA 4HL6A 3TDNA 4PV7A 5JQWA 1M8KA 4XFDA 4P3OA 4ZEVA 5A4AA 4D46A 1E92A 2H5EA 5EN4A 4J4HA 1QS0A 4Q37A 2GRAA 1R6BX 5TIIA 1RZUA 2F59A 2JKYA 3BXZA 3BXFA 2XXJA 3L0BA 3LE8A 4FMDF 1KAQA 2FCRA 4ND5A 4UTZA 4AROA 3I8SA 4QVGA 1JIJA 3HCOA 3NEYA 5BN3B 1QGUB 1EQ2A 4KU0D 1BJTA 3CLTC 3S2SA 4ZI3A 3B12A 4HNUA 2GM4A 1KC3A 4ZOEA 2W6ZA 4IIJF 2XJ4A 1JDPA 3T3HA 5K6AC 3CKKA 2XA9A 2PMCA 3PDIB 2HMSA 4MW7A 4C7VA 1V3TA 3DP7A 1KE1A 4BUZA 2YNMC 2A0WA 1LPSA 1JXMA 1V8PA 5JAIA 1AKWA 1L8LA 3A2LA 3A3KA 3WFZA 4G1CA 3KTOA 3PFFA 4QU9A 2WFZA 3ZI0A 4QGSA 1B8VA 4FW8A 1LNZA 1QDEA 1SUFA 2I1LA 3A6ZA 1RPAA 2RC6A 3JD2A 4NMXB 5JRZA 1JSRA 1SHUX 2EL7A 4DLUA 4JU8A 1M5UA 4QDUA 4RYDA 4YUWA 3NZEA 4HT3B 3OOWA 5K8JB 2VH2A 4HXYA 1KORA 2FPXA 3DD1A 4TVBA 1YB6A 5L3QA 3GFQA 2YV1A 4IZOA 4QJ3A 5J59A 2XVMA 3GZNA 4XRRA 4LYAA 4XYEA 3R7DA 3V1TC 3ZQJA 4OGFA 5KSZA 3ZW9A 3FI0A 1JI0A 1EVEA 1RI4A 4LXQA 5G3ZA 5B7NA 1OGYA 2WDPA 3R44A 4JL5A 3FYHA 1N92A 1GTJ1 4R9RA 4CM3A 1TQDA 1BC5A 5TEWA 3NNNA 5IYZA 2VKQA 4KO2S 4NV1A 2GZDA 1DLJA 1V37A 3DVQX 1CQIB 1W1WA 1ENZA 1QORA 2QRVB 4Y2GA 4ZYWA 1DRJA 3D8NA 4JELA 4KN9S 4X3PA 3VR4H 4FEAA 1LS1A 3JAKA 3U9LA 5HTOA 2BUCA 2WYIA 5KNLA 2L82A 3L4JA 2AC2A 1TCBA 4BQNA 3U1BA 2QOEA 3W9SA 3V8BA 3BERA 1V7PC 2ZRDA 3JQQA 3Q88A 4IIVA 4A2WA 3FCEA 2JKZA 1MB0A 2VQ3A 2YVAA 4BU1A 2PMBA 2UZ3A 4PICA 1I6MA 2D1QA 1MEEA 3LQYA 1QVWA 4MO2A 4R2WA 3I1FA 3IESA 4Q0MA 1KDVA 3RE1A 3BB3A 1QNFA 4N8DA 1LJ8A 3LP6A 1M34B 3TQFA 1WF3A 1TT7A 5LPNA 4MUEA 1YZLA 1X7ZA 4A16A 1V16B 5D3QA 3S1AA 2WVGA 3NIBA 4PBTA 4YCJA 2IWRA 4L5YA 4ZT7A 5CITA 2QUZA 3VHRA 4DV0B 3BD7A 4RH3A 1JQ3A 2PR7A 1U0SY 2ZUEA 1Q16A 2COEA 2AG8A 3E05A 3H8JA 3NM4A 1Z34A 1TADA 3GELA 4L95C 3JYOA 4XVRA 5ALYA 3ZD7A 1PD1A 5CVEA 2X9QA 7MHTA 3G7UA 3CNLA 1DDOA 3BCSA 1MAHA 1KU0A 2NTNA 1EBUA 3KJQA 4EOGA 2Z6QA 4UAJA 3B2NA 4YMVA 2AFRA 3RTDA 4L0DA 4KRGA 3E3MA 1TKCA 5AK6A 4ZEOA 4AC9A 1QRRA 1ZN2A 3NXKA 1B2LA 4E2ZA 4F86A 1CRQA 3ELVA 2FEWB 4C4TA 5IWAB 4RBNA 2ZAGA 1VJ5A 1P45A 3D7LA 2C2BA 4FINA 4K9RA 4Z54A 3GT0A 1PR4A 4S1OA 3WK6A 5DNCA 1SXIA 4X65B 5FLEX 4EA6A 1FXWA 2C5BA 2K5UA 1USIA 3K6JA 2QVLA 1LFDB 3K73O 1NRXA 4PO3X 1LS6A 1NUQA 5DU2A 1HKUA 2ZFUA 3KEGA 2YX1A 3PNQA 1FDIA 4IDAA 1QU3A 3BAFA 5HRUA 5JBQA 4INAA 3F1LA 3VJRA 2OAGA 4MCAA 2IOFK 3ADKA 4O2AA 4Q1CA 2X5OA 2LIVA 3A4VA 4QFCA 3GR6A 3GZJA 1NW4A 2KW5A 3U3JA 3MD9A 2J3IA 2R7LA 5EXDA 1JDNA 1UFKA 5B7PA 1MJGA 2QDXA 4YP0A 1DOAA 3B48A 2HWWA 2O3RA 1XA3A 1US8A 2FZCA 3JQFC 2GHIA 1W94A 2HDWA 3HUDA 1UJ5A 2NV6A 3MWGA 4J49A 5E1BA 1T9GS 4PGHA 2PD6A 3W06A 2BM1A 4GMKA 2AYZA 2YHBA 2I76A 3GGCA 3QYFA 3FI9A 2XUOA 2QR5A 2OESA 4P2BA 2HK7A 1VGRA 3WLEA 2XA2A 3A14A 4AG5A 2BMFA 1RAAA 1ZICA 1OV6A 3AVQA 2KSQA 5EUMA 3UANA 4AZ3A 2WFLB 3R09A 3D3EA 4H2DA 4L6CA 4Y67A 3NHYA 2EP7A 2F1RA 1EXDA 2HA4A 1I2CA 2HJVA 1W73A 2VK1A 4D6XA 5KYXB 1UWKA 1G4UR 1NMXA 3RANA 1OYYA 4EJSC 1BXRA 1KH2A 2H4HA 3T4UA 5KKNB 1X1RA 2DCMA 2PMKA 3MEQA 1NVAA 1ESNA 1GQOA 5LDDC 3SJAA 1GG9A 3KLNA 4G4SO 1S02A 1L4BA 4K9NA 1A76A 4G5OA 5DVZA 3ZVKA 1TCCA 1UM9A 2RCNA 2I54A 3OE5A 5GONA 5KTTA 2GQ0A 2HM7A 3A0RB 2OXIA 2P9TA 5CBKA 1YFLA 4R8KA 5DYYA 2JEOA 2XNSA 5CXSA 3QVMA 1PD0A 1HMYA 4IRXA 3I28A 2GAAA 3WJAA 4I6EA 4PLGA 1L5KA 3WLTA 3IUBA 4LWZA 5CLGA 2Z5LA 2C4VA 2DQKA 3OH8A 4TZ0A 3U1TA 2YWDA 1SIOA 2BEUA 2Z5FA 3AI1A 1I51A 5F2EA 4J1SA 4DC1A 4P7BA 4AM8A 4PRZA 1PR0A 1ISRA 2A9PA 4QATA 5GJCA 2QRKA 1NQXA 2X6TA 2VT6A 2DBYA 4PAQA 1Z28A 3I3OA 3DUFB 3L0IB 3QKRB 4CMEC 3IDZA 5AJUA 1L6IA 2PWAA 2AIRA 3T5TA 2LCFA 3L1IA 4JROA 3RLFA 1I2DA 4IS3A 4MUGA 3RHSA 3GLHE 2IDMA 5DOZA 3ZJYA 2F3QA 2F4VB 1B43A 1L3IA 4NOJA 2QAGC 1GLNA 3EDQA 1LD3A 4YFYA 3RHFA 3JYQA 3QMWA 4HNVA 1J4PA 4KQCA 1ML3A 2UU9B 2EVWX 2H7CA 8ABPA 5U4XA 4HGYA 1DQRA 4ALIA 4QTUB 2CUNA 1GCGA 3K6SB 2GPAA 1KMHB 2AR0A 1QWSA 4YYEA 4OLBA 3QPCA 1UWCA 1OF1A 2A5GA 1YZQA 4NEQA 4FHFA 4TMWA 1HOTA 2FG6C 1A8PA 4KH1A 5FX2A 2YHSA 2OC4A 4M0UA 1LRKA 2Z1DA 1FYFA 1TMOA 5BOVA 2ABWA 4FSDA 5ARCA 2O4CA 2XY4A 3KT0A 3GP8A 2ZCJA 4C6HA 5ES3A 1FF9A 1I6LA 4YONB 1OC2A 2G36A 2NPIA 2WVAA 3PDJA 3SU8A 1YZTA 4LVUA 2P6NA 3QX9A 2BHSA 1GV0A 4IJKA 2RH4A 3FWYA 1ZJYA 3CVOA 2FF5A 1SURA 3HDYA 3QPWA 3KPVA 2RE8A 4ISBA 5DPMA 3BOSA 1LBIA 1NQUA 4FD2A 4HNHA 4E5KA 1P7CA 1TXGA 2A3RA 3LX4A 3KE8A 4IWYA 3DBOB 2ZRHA 5K51A 3TINA 1PT8A 2C94A 1SXHA 2P7IA 3D6VA 4X91A 4A6EA 5CJPA 2V7WA 3AZOA 4ZDWA 3VOTA 1GSOA 1L5VA 1U02A 2QBYA 2JI6A 1G20E 2EX1A 3D2AA 3WRVA 2YQ5A 3OZIA 4FX2A 5ICEA 3A77A 4CN8A 5M04A 4PANA 5FAXA 4G84A 2I8LA 3QXGA 2HI0A 3AR7A 4D74A 4YJFB 3GHYA 3WKEA 2OHJA 2B6NA 2PZLA 2I1QA 4C4XA 4QYTA 4J43A 4RSMA 5EIBD 5K7SA 3HNPA 4LJSA 1YJQA 1Y1TA 2BDEA 2NWQA 3G82C 1QIHA 3NHLA 4J7UA 1DTWA 5CW2A 5H5JA 4EHIA 5KO2A 4RVSA 4MVJF 4FZ5A 3JATB 2Y1XA 1SXJA 5TT1A 3FMIA 1ZY2A 4XJVA 5HDBB 4DY4A 5JDCA 3GLFB 3B2EA 3BRSA 4QEKA 1IVNA 1Z38A 4PNHA 1GUDA 1XKLA 2C58A 3RSQA 3BWVA 2WT9A 3HZHA 2PUAA 3R41A 2O0LA 4OQ4A 2CF6A 2WWWA 2HU8A 3LBHA 4NU5A 4K8RB 2RK4A 2O2IA 4BO3A 1GPDG 2XZDA 2ZB8A 5DXAA 3ZDEA 1DC5A 3EA5A 4GKVA 3ZKWB 5I7OA 4CE6A 2Z4RA 1WD5A 2QU7A 2AEFA 2VT2A 3NNDA 3T7RA 2FVXA 1Z39A 4QOFA 2ZB2A 5DHFA 3PUYA 5D84A 4E15A 3DMGA 3GEHA 2VYFA 4CL0A 4MV3A 4DSTA 5E2BA 2QE7D 4WY2A 2IKSA 3A1EA 2XGGA 3BWEA 5JQGA 4F9GA 3FM8A 3R20A 4JJ8A 2OK8A 1KZ1A 1E69A 3U62A 2JLWA 1C1YA 3DM5A 3P0JA 4RAQA 4MV9A 3EDCA 4YAIA 4FMDB 1YI0A 4W8GA 4OYYA 4N3GA 3K9QO 1WX1A 1IONA 3IDAA 3S2UA 3OT1A 1WW3A 4L22A 2D1YA 4GOXA 4F4IA 4YV2A 2VJBA 2DHEA 1RKUA 4F4FA 2OXRA 4YS6A 2HXSA 4MX8A 2W2NA 1XLUA 3EPRA 2F8SA 3HBAA 4R1NA 1K5HA 2B7LA 5IANA 2CHUA 5JH7A 2XE8A 3ZWOA 2GTHA 3ID6C 3AETB 1C2TA 4R3NA 1U63A 2ZDQA 3DBLA 1L1RA 2GK4A 4LSGA 1RYMA 3VAYA 4FP9A 1NPYA 2GS9A 4LF9B 3FOEC 1OXSC 5THKA 2J4CA 1QRDA 2GK3A 4YJGB 3FHCB 3C97A 4KFRA 4CEJA 1KO4A 2ADFA 5DIZA 3KD2A 3ZXYA 3AKYA 4WQMA 1YBHA 3IOCA 2UUBB 3BKWA 5DP2A 3GFFA 4X54A 3PEVA 3PJGA 1I7QB 3HB5X 3UAOA 2GJSA 1AQJA 2V6IA 2GCEA 1J2TA 4NAVA 4D8VA 3BBLA 4OFZA 4IDOA 3IDOA 4FYHA 1M2OA 3I4CA 1CR2A 3BIOA 2RKBA 1E3TA 3AJAA 3UAYA 2WE8A 3VX4A 5KYYB 3AF6A 4QSMA 5FRDA 2BKAA 2ZJAA 3FOZA 2MIIA 3DITA 1QQ6A 1D1SA 1ZOSA 1XQ6A 3NASA 3VVLA 2JS7A 2FSSA 5DGDA 4UAGA 1J24A 4UNIA 1OT5A 4MI3A 1Z07A 1IMJA 3EWNA 1Z5ZA 1C4WA 4Z1MA 4AX8A 4HVCA 1YA6A 3HJNA 2IDJA 2Z1NA 1UBFA 3AK4A 5DGIA 1ISFA 1Q14A 5KYUA 4A8HA 5HMMA 3Q8XB 1GPAA 1JILA 1BO6A 1KZ9A 2O0HA 4BFXA 5AMXA 2IYAA 2DERA 1K5GA 2KM1A 3GG2A 1SOMA 1TFRA 3M6FA 3S7ZA 3QKUA 4AL4A 1C7QA 1F8XA 1WZEA 2WSYB 1XHEA 2O7NA 2WD9A 2B83A 1ZDMA 4ASUD 1USKA 2ZWVA 4PG6A 4GPD1 1R4AA 4EKEA 3B51X 3KZOA 3UHJA 1DQPA 3UWDA 1U7HA 4M1TA 2RCYA 4RY2A 5GWXA 3PLAE 4KXYA 3Q6NA 3DL4A 4FS8A 5A4JA 2MHCA 3LP8A 3TIXB 4KO1S 3E2PA 3V4LA 2AN4A 2Q5QA 2PGIA 3IB3A 2Q28A 4O4JA 2IUEA 1H3FA 3EEQA 1NZJA 1YCDA 1Z74A 4HUQA 5E1MA 1XCPA 3KOUA 5DNEA 3UAXA 4NU8X 5D6NA 1PHPA 4B45A 1PWEA 3B6KA 2WWXA 1V41E 2FDXA 2IBTA 3ZHRA 4K6MA 2H9IA 4Y7DA 2JGRA 3JQGB 4J6FA 2F2TA 3R7WA 4CF3A 4GPZA 1HE3A 1U6IA 4GDFA 1C3XA 1O6ZA 2R6ZA 3NEAA 3KFVA 1E96A 4L74A 1HQYE 4DWVA 3GU3A 5KVCA 5FWXA 3SQXA 5A4KA 4JC4A 2N9UA 2FWMX 3TL6A 2V6MA 2BMWA 3M4XA 4RE5A 4TX1A 1S9HA 5TC4A 3IQEA 4PYLA 4EPWA 2VYND 3DWIA 4IL5A 2WU4A 2V45A 2UZ1B 3E5HA 2PPVA 1BKDR 3VTZA 2HD4A 2QYSA 4FQ8A 4JFAA 2BFFB 2HX1A 1KF0A 4ZO6A 1NBAA 3EMKA 2CUZA 1P2BA 1LH0A 3EGDA 3JAWB 2WYUA 4OUDA 5CLJA 2Q1XA 1PQ4A 2Y6UA 2OZKA 3CKYA 4KACA 4MYTA 4ZAZA 4YWHA 3HHPA 2TYSB 2O8BB 4Q1DA 5CDUA 4R1MA 3INRA 1FU7A 2O8EB 4RENA 3KEFA 1J21A 1QRSA 4HHEA 3DPUA 4PO9A 1WSWA 1KJWA 2I7TA 4Q47A 1RQXA 5JU6A 3FOWA 1PWXA 1UFRA 2WBLC 2FR8C 1SRRA 4FKMA 4GQAA 4GKAA 4UMVA 5IXJA 4JA0A 4TTVA 4AF7A 4X3CA 1KNXA 3PI7A 1LPBB 1M6VA 5L7YA 4KLRA 5EE1A 3TIVA 4D42A 1RRCA 4E22A 1RQPA 5BR7A 2FWBA 3OLQA 4MV5A 6GPBA 1COWD 1CUIA 5DI3B 3MJSA 3PNYA 5CYPA 4LK2A 4EA9A 3H2SA 4BP9A 2FRVA 1C8VB 3PKJA 3PLRA 2B2CA 1W6UA 4OJQA 3C6KA 3WQHA 3AFHA 1Z7EA 2WHYA 4WGFA 3ZV5A 4F71A 2JLSA 4W6ZA 2ASVA 3C1AA 3TD9A 2WMNB 3W5BA 3LKDA 4OF4A 5FADA 1T2UA 2Z8ZA 5AK5A 4YRDA 1PQYA 5BURA 5K03A 5L53A 4RZIA 1ZRMA 2CHGA 5L4NA 3THXA 3G5MA 2XW6A 1G8KA 1X70A 3WBBA 2DFVA 4HRAA 2C95A 4DZTA 5FI0B 3UMRA 4HDSA 1OVGA 2TRSB 4NE9A 5I7AA 3KZ1E 3CLVA 4HAUA 3RJ5A 1XZHA 3FR8A 3OZUA 3JQ9C 3R77A 1N7HA 4Y9DA 1Q22A 1O3YA 4AJKA 1T5IA 2HBQA 3DXXA 3Q5DA 4JEUA 3FDFA 1LBQA 1MVNA 3KXDA 2Q27A 2G4VA 3GN2A 3HV0A 5BWBA 5EJ4A 4W5HA 4OFXA 2R8EA 2PD3A 4ZQFA 4B3TB 3IMCA 1XEWY 3FCUB 1YDMA 2HLHA 4FGUA 3WNZA 1ZU5A 3KJGA 4L4RA 2WWRA 3ZDBA 3R3SA 1Z5VA 2FP4A 1OX5A 3AB3A 3FTDA 4QOHA 5TGTA 3U31A 4A8JC 5BMVB 2ZZMA 1R15A 3ZHTA 4FZVA 5DBFA 3DZCA 5JCXA 1SBHA 2WT8A 4U0KA 3BHJA 2WVJA 3M34A 4XTRA 1NX9A 4XSGA 4CU2A 5IJ9A 3I32A 2H11A 2XYHA 2OCXA 4YMUA 1L8XA 3S5JA 1EX7A 3D4PA 3E7XA 4XM1A 2ZJ8A 1TEZA 4YMWA 1R9JA 1S7CA 1KBZA 1VYVA 2G1JA 3NYRA 4YLGA 5H3CA 3RUHA 3TXXA 4B81A 1X2BA 3R9WA 5B7QA 1JBKA 3K0AB 5IK2A 2F9FA 1Y5RA 5TMEA 3UJCA 3S0JA 2IUTA 2B7CA 5FBKA 1SVWA 5K1ZA 1MDFA 1HA3A 3ORFA 4MP8A 1KJIA 4LZWA 1ZIXA 4O02B 5ALPA 2RI0A 1Q19A 3K16A 3C6ZA 2PCLA 1S3IA 1SB9A 4MXDA 2Q99A 2V7BA 1ZMRA 4KX5A 3PT5A 5ENVA 2HC9A 5EJEA 5CPBA 4NULA 3KUXA 1BYIA 3KS9A 2J0SA 3LL4A 1RI3A 5KSWB 3GUVA 1NY5A 2OXEA 2RAVA 3KQVA 3LLMA 5FUBA 2QTCA 2Z83A 1I9GA 3QKSA 3RCBA 3ANLA 3TE6A 3V4VB 4Y3UA 4YGYA 4CETA 4FMBB 4MQEA 2I4OA 3QLUA 1U99A 3T4XA 3UF0A 1KMIY 4QU8A 4IEEA 4B87A 3DWEX 4RHFA 3I62A 3UJPA 4MV6A 1U7VA 1P17A 2EZTA 2YOHA 5AM5A 1G0OA 3IUJA 1HORA 4PZLA 1RYDA 5LSAA 2XB9A 4GX1A 1FJHA 1MLDA 2ZSHA 4L4UA 1M83A 3ER6A 2YIJA 1H4VB 4H59A 1BWRA 3PRYA 3NDIA 1VI2A 3VR5H 1G2OA 3ZDFA 5JEDA 2QT1A 2FB9A 2ZT7A 3INNA 2DQ4A 3U4QB 1N5IA 4D4JA 3GGDA 1TGYA 1OX6A 2J9FA 5L6LB 4BNLA 1A0OA 1FDRA 3C4VA 3PQ8A 1SU6A 4JS0A 1XGKA 2GJ8A 4RANA 2W7TA 2IJGX 1EDZA 3AY7A 1YRBA 2OQIA 1ISSA 2WJHA 3QYAA 4B3GA 3UK0A 5M3BA 2NVUA 1OXBB 4HX5A 1WEHA 1DKNA 3Q72A 1O4WA 3TIFA 4YV0A 1VBMA 3F4BA 3JCZA 1U0LA 5CA1A 1RWQA 2OBYA 1SKYB 2NPFA 1ZC3A 3SBDA 4E51A 2C5FA 4EY8A 3SIPA 2JGNA 5KNBD 1LV8A 4DZRA 2PS3A 3PQFA 3RYIA 5LBTA 2BT4A 1Q21A 5KMGB 2YKGA 4BTLA 1ADGA 1ABFA 1NUAA 1Z5PA 2QLFA 2HIHA 1ZK4A 3CZ4A 3QOXA 5FWAA 3TB4A 4RF4A 4Q1VA 2OLKA 3ZJUA 1SKQA 1UC9A 4EKNB 5KQGA 1MV5A 5H9VA 2DFTA 3TWOA 2PA0A 2VDVE 2WU8A 4BLRA 5TMDA 4BKPA 4ZCTA 4CXMA 1JR3A 1XKQA 4YQEA 4ERNA 5FPKA 4NK5A 5AW6A 4QBIA 4Q7QA 3K4PA 4H0FA 1Z47A 1PQUA 3F97A 3FH0A 3LC1O 1X7WB 3RIGA 3IEVA 1V1JA 4ANFA 4JX9A 4POAA 4XVHA 2P4QA 1FFDA 1TA0A 4UDXX 1CSEE 3NALA 5LXTB 1V5IA 3QMVA 3KKLA 4NJMA 1SEPA 1B0AA 3K0FB 3CBQA 1XROA 3QLVA 1PEAA 2WP0A 4WKOA 4HFMA 4ZPJA 3C3KA 4LY9A 1BWSA 2NZYA 2Q9AA 1KI7A 2BC9A 2LW7A 3CEJA 3LDUA 1GQQA 3FTPA 4DUZB 5I8PA 3MGBA 3OURA 4URUR 1VLLA 2ZUVA 4NHEA 1OR8A 3PF8A 3RV4A 2ZCUA 1QLHA 3GAFA 4NSNA 5KYVA 4FEEA 4I5IA 1AQLA 2OL4A 7AT1A 2LE0A 5KKAA 4D56A 2OE2A 2VF4X 3P9IA 2GWHA 1KL7A 4LWPA 2HJSA 1QZTA 4Z2AA 4Z6KA 3GJ3A 4YDRA 4BECA 2HYDA 2OMKA 1R10A 2GNPA 3GRUA 3H3XA 5DLQC 1VKNA 3OU2A 4GPEA 3FHTA 1QP4A 4P0TA 1F8YA 2QN8A 2ZIGA 3DDUA 1SU7A 4HGPA 1OFHA 1QHXA 4IP0A 1XP5A 1ULUA 4X92A 4ZEWA 3WY9A 4BIIA 4A1FA 4ZYTA 2ZRAA 3UAZA 4MAMA 1QV7A 4JKOA 2VXYA 3TBKA 4HNRA 4LQDA 4M6WB 2X0EA 4D8YA 4KFTA 2TMKA 4WASA 4LZNA 3O8LA 3OWXA 5BSTA 3WJ7A 1P44A 1M2FA 4HX9A 3TZ6A 1K3UB 2HOQA 3WYAA 5ECGC 4Y2YA 3N2GB 5CFMA 1GSIA 2X8WA