4WRRA

A putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
298
structure length
293
Chain Sequence
KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVSNNIDAEEKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords putative diacylglycerol kinase
total genus 81
structure length 293
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.107: Diacylglycerol kinase (ATP).
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 4wrrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4wrrA01
2I2CA 1Z0SA 2JGRA 2I2FA 2QVLA 2I2BA 3V7WA 4WRRA 3V8NA 3V8PA 2Q5FA 2AN1A 2I1WA 5DHQA 2I2DA 5DHRA 1Y3HA 2I2AA 5DHSA 1Z0UA 3PFNA 2QV7A 5EJFA 3V8RA 1Y3IA 4HAOA 5EJGA 4L02A 3V8MA 2P1RA 3T5PA 5DHUA 4V24A 1SUWA 1YT5A 4DY6A 5EJIA 3VZDA 3VZCA 2I29A 1Z0ZA 4WERA 3V7UA 1U0RA 5DHPA 2BONA 3VZBA 1U0TA 5DHTA 3V8QA 3S40A 3V80A 3V7YA
chains in the Genus database with same CATH superfamily
2LCQA 2QX7A 4O4JB 5IFKA 5KTYA 3Q8KA 5L45A 3VDMA 1C8BA 1QTIA 1NM5C 2WYOA 5BVIA 1VKHA 3UJAA 4QZVA 1OLSB 3L1KA 5JZMA 3SJBA 121PA 2RH9B 5HOQA 2BEJA 3V4RA 1I0IA 2Q6IA 1DJMA 2WU3A 4RPCA 4YCLA 2E5LB 1YJXA 4N5IX 2JCXA 4JI3B 1BWSA 4FD3A 2QRHA 4MR7B 5EY5B 2IV7A 3UMFA 3EXHA 1HDEA 1HLDA 1NMQA 3KV1A 5HVNA 1AGRA 2DAPA 1T0HB 2O2DA 4BO5A 3R3SA 2FPPA 1RKQA 2JKYA 3E9MA 4P6VF 1CNMA 1K3QA 3SS8A 1DBIA 1YXMA 2HZBA 1UM8A 1ULTA 2XXSA 2MYNA 3N8HA 4ILEA 5IWCA 1M2KA 3LPCA 1ESZA 3HKEA 3KOMA 2VVTA 4IO1A 2WVGA 1F9EA 3A8TA 1ZUWA 3FB1A 1A5AB 1LX6A 1RQ7A 3PFGA 3GLGE 5IH3A 4RVOA 1QGAA 1SBYA 4M1TA 3I0MA 4M7RA 4R2HA 4KO2S 1NQVA 5ADVA 3CPEA 4XD2A 3HYNA 4XAQA 4ND3A 3AUYA 4MHSA 1DD1A 4BMVA 1K63A 3D54D 1U8YA 3DBHA 1UMKA 3X1MA 5T57A 3WL7A 1VMIA 1ZOOA 2KWIA 3ST7A 3PDHA 4Q18A 1D2AA 1Q20A 4WN3A 4DJFC 1RBYA 3C1TA 1XEWY 1PJ4A 2WYWA 4WZBA 3SICE 3WVNA 4OI4A 4A4DA 1OI4A 1UEJA 3B6ZA 1V9SA 2R8XA 1NE7A 2KB0A 4IDEA 4DFDA 2GJ8A 5F33A 1O6BA 3H8WA 4G9GA 4MQFA 4X8MA 5GADl 1N6PA 1H1LB 2X5KO 3ESYA 4GM4A 2FZEA 3VHQA 5B7QA 1SRRA 4C5AA 1F2TB 3IX7A 1E7YA 1O2DA 4QNRA 4OHXA 3WX0A 1MLDA 2FUCA 1SQFA 2AB0A 1IHPA 2DPHA 2VL7A 3BGIA 4RLFA 4IINA 2JLWA 2HPVA 2BHLA 1OT3A 3MRTA 4GRDA 2V97A 3A10A 3WB0A 1E2NA 5TLSA 4PFJA 3UPDA 1PYOA 1M2VB 4KRXA 4KPGA 4V0QA 4DVGA 4NZOA 5H3HA 4EJSB 2OENG 1FX1A 2JEYA 5CDYA 1P80A 3QPBA 2JD0A 5JMPA 2C2HA 3OQ1A 2ZSJA 3EZ9A 4D1YA 1Q0SA 4CF6A 4I1OA 2ETVA 1U2SA 4HDCA 4NU5A 1PUJA 1IQUA 3P32A 4GL4A 4AF8A 3QG5A 5G40A 4EJ6A 2BP7A 4Z4QA 1PQ4A 3PUVA 4K5QA 1WV0A 3AUJB 3ETHA 4TMKA 5INTA 1TGYA 2CSWA 1W4LA 3M4JA 2AC7A 4MGKR 3U3ZA 1WNTA 3OEWA 1M1UA 4RENA 3PJEA 1KFBB 5KYNA 3ND7A 3OJLA 3BMNB 3ZCRA 1PVDA 2Q4OA 2QRQA 1ZX1A 5C7YA 1M34E 1ULAA 4LX0A 4NCHA 1V8FA 3EEYA 5J2TF 4KDCA 4IFBA 3RW9A 1JIIA 2ZSFA 3A31A 2C84A 4G8DA 2D54A 2AJCA 4MULA 3F71A 4N0EA 4WMLA 4WT7A 4P32A 5AK3A 4BBPA 1EWRA 4H9GA 3M4NA 5G4LA 4B7XA 3R5TA 3C6QA 2NIPA 5CLJA 2ESRA 2JFUA 4EQ6B 5A7FA 2C2MA 3R8CA 1HWYA 1PBTA 4O4IA 1YUNA 2FI1A 3OQHA 3EVCA 4Z0TA 5K0FA 5IASA 2UZAA 3HWRA 4I1SA 2KYRA 4BGEA 4BFUA 4HI0E 4MCHA 2JFPA 3DE3X 3DFMA 5C4VA 3MSCA 1DC5A 3A04A 3V2UA 1HYQA 1XDDA 2V3VA 1XR3A 2N3ZA 1STOA 4QARA 4PYQA 3OU2A 4M53A 1B14A 4DG9A 1WMBA 2IW3A 1LBTA 2RBGA 3P96A 4FLFA 3BBPA 4GZMA 3UMZA 4H0CA 4Q3KA 3G9UA 1DZ3A 3IH5A 3STXA 4BQFA 3ESZA 5EZYF 1B6RA 1Y8RA 2G25A 3H0EA 5AK6A 1C1DA 2AMYA 3I45A 1TJYA 1Z4NA 4KMMA 2VDLB 5A4KA 1KKLA 4ERNA 3MAAC 1A7KA 5U4QA 3GH1A 3SGLA 1R6AA 2RHLA 3KXIA 3WJAA 1J4PA 1H1TA 3CO5A 4LHVA 4LOIA 4GM1A 1RRFA 1A9XB 1ZD8A 4WA8A 2L0XA 2XUKA 3TNDA 4EGJA 3SSAA 4F5WA 4R1SA 3KZKA 4BX9A 2WHQA 5LMUB 1QHYA 2GM4A 1OTHA 2OB1A 5IKOA 1BN6A 4KSYA 4M76B 1E32A 4IHAA 3VDQA 4X85A 1E5QA 2Q5CA 1SUFA 3UG6A 4KZPA 1ND5A 2C95A 4E12A 1OKKA 2QGFA 1EFDN 1L3BA 3ENKA 4DWJA 2IU3A 2OZVA 3GLIB 3KYDB 1NQAO 4MINA 1HYEA 3I6MA 1GKYA 4IJUA 2V6IA 5DHPA 4IMIB 2WF9A 2ZRIA 3GX1A 3ILYA 4PZZA 1HT3A 1DIRA 1DIHA 3DOHA 4M1QA 3FSGD 4JL8A 4G1MB 3UA4A 2X58A 4IHQA 4WXYB 1QHFA 3CF0A 3SKXA 3DE1X 5KTOA 2EEPA 1DIGA 4DSNA 1JFSA 4NCAA 1BCRA 2EP7A 2QRLA 2VP5A 4HQKA 1JHVA 4HVCA 5JW6A 2VPXA 2RGNA 2OE2A 3K9HA 4R0MA 2BFFB 3HXLA 1W19A 4FSDA 3CKYA 4IH4A 4AROA 2NWQA 4DG5A 1NUAA 3DC2A 4JDUA 1NVAA 1Q22A 2ZVDA 3EEIA 4KSCA 3FMPB 2E37A 2PLAA 3BREA 5DGXA 5DV9A 3F78A 2BM9A 1R4NA 5CVDA 4MAAA 1AA9A 1NY6A 2BM8A 1SCUB 1T5SA 3JTEA 3NV7A 4ZT4A 1A2KC 4QGAA 5A3QA 4PVDA 1R9NA 5I7SA 3TDKA 4DPMA 3GMDA 1JZTA 2RHCA 1GG5A 2JS7A 3BILA 2PL3A 5TXGA 3U49A 8ADHA 2DXIA 1ZOSA 2ZTVA 3PWTA 4G5RA 1IM5A 3GB9A 3OZSA 2OV6A 3FBWA 1L6RA 3NW9A 2EQAA 1KJNA 4DABA 4BXOB 1Y9DA 4HEHA 4BOYA 2HF7A 7ABPA 5DH9A 3EGDB 1SUCA 1NVVQ 3E9CA 4DIOA 1SIWA 4PQRA 1OIVA 2D3WA 5FTLA 2PT7A 2J5BA 3DP7A 2PMDA 4UUOA 3C6ZA 2R8RA 3K4HA 3TZCA 3HLYA 3DLTA 3K92A 2B2NA 3QHPA 3BWEA 2Q45A 1V1RB 4GQIA 4W8OA 2JFOA 4IEEA 5LIPA 3HXQA 2ORIA 4IQ4A 1JAYA 1TEHA 1OAAA 1P4JA 4GEGA 1FYEA 1KMIY 3AJDA 1SBIA 2A0WA 4GX5A 2A0TA 3D4LA 4V3CA 1HUQA 1Z0SA 1EVYA 2VH1A 2BZSA 1VLQA 2CHVA 3HU5A 1KDYA 3OECA 5KYWA 1LH0A 2QLMA 2ZRQA 1KEZA 3N28A 2XAAA 3IXQA 2VNAA 1YI1A 2X8LA 3BF8A 2O8EB 4XWTA 2PYZA 1VPTA 1MNQA 4M1YA 3GJRA 3HI4A 3TLGB 3ZH9B 1ZC3A 2CUTA 5KYVA 5DIFA 1E9RA 4X93A 1UDAA 3TVYA 4BPRA 1FVXA 1QYRA 1C29B 4FU0A 5FUMA 3SY8A 3C24A 3TL3A 2PEYA 1EWYA 4LOKA 1SUWA 1UXIA 2ID7A 2EX0A 4OAPA 3HKDA 2I2WA 3G5TA 3RH0A 4YJ3F 1PFGA 1YE5A 2IYVA 3VH4A 1THGA 2DYKA 1XAIA 5EVCA 1V7CA 2WIAA 4IHJB 2ZRKA 1O6CA 3UTCA 1QO0D 1BZYA 1MEEA 5A4JA 2I6XA 1LSSA 2PV7A 1RU3A 2Y2UA 3HYCA 5LZ5A 1R6XA 4OLHA 1ZY2A 1J6UA 4JI6B 4EG0A 5C5CA 2R9VA 3O3OB 1QLHA 3EPKA 4RVHA 3EMVA 1MA3A 1U6JA 4IAOA 2C2ZA 3QHQA 1WXQA 4ER6A 5JNWA 3BIOA 3ZOKA 4HMPA 3FNEA 1YAJA 1IVSA 4BVBA 1G21B 3X43A 1EJBA 2JA2A 3NT4A 3PQ5A 1J33A 1HBJA 4FOTA 4OTZA 1FNMA 4ZYTA 1N1DA 2WUGA 3VAYA 1W581 2UZ0A 4FFNA 5LLSA 3U5TA 1QLWA 4QTZA 2E87A 4EVSA 4RIFA 2QROA 2Y1KA 3LUFA 4TKVB 5H83A 2ZLBA 3LWNA 3L7NA 4DWOA 1NPDA 3P4UA 1A8IA 3T7KA 2O07A 1RMYA 4RC9A 3DHYA 3JU3A 1ZO8A 4X61A 1P60A 2JJYA 2R6JA 5TVKA 3WRXC 4BLOA 5HHTA 4CEHA 1BEZA 1G2OA 1IN5A 1MAUA 3AM5A 3KAPA 4TV9F 1VE9A 3N0RA 3AUAA 2NP6A 1PR9A 2QXTA 2ZPTX 1OR8A 1AIPA 2JJ1A 5H0IA 2DT5A 3VR6H 3E48A 4ZO9A 2HQSA 4FFSA 5CLGA 2B25A 4IH1A 4YA6A 4X7PA 4Q19A 3ADBA 2OT3B 2IDJA 3O1IC 2ASEA 3FYUC 3FOZA 4CQNA 5FWXB 4KUEA 3W2IA 3OP1A 2E4XA 5TGZA 4FZ5A 4H60A 4R5MA 3DJFA 4ND4A 1DAMA 1BQ4A 2DY1A 3LX4A 4ALNA 4OH7A 4ZYZA 1D7AA 4C0QC 2O2XA 5C7OO 2QRJA 2YFQA 2FFRA 1PK7A 3HDYA 1PFUA 1YC5A 3H2GA 3MT8A 4QUIA 4WW0A 1C7FA 4R40A 4RTOA 1NP7A 1VPWA 3AH8A 1QKIA 4BPBA 3AHFA 1XEXA 2HWUA 3IUMA 1IRIA 5PNTA 3MHPA 3PNPA 1ATZA 2XTZA 1ESMA 1JDBB 3A3PA 4PC3A 3EVBA 5FTJA 3GDFA 3DAFA 2PX4A 3L93A 4QXMA 1PUIA 3TQOA 2W2QA 4C06A 5DM70 4JXXA 4A2PA 4D4HA 3AVOA 5AW2A 2PVSA 1XOIA 4LVNA 5FPTA 2DRIA 4M8LA 3UV6A 4IOLA 1TZCA 2R6DA 3WL3A 5KVSA 3IKLA 5KWJA 4YTEA 3PDJA 3DBRB 5BURA 4NXMB 3MCZA 1X19A 4LYYA 2J1LA 5F1PA 2WWWA 3QFTA 3K0AA 1OAOA 3ESXA 4XFDA 5EE0A 1TVEA 3AGQA 4DBLC 2PL9A 1GARA 1EX9A 3DXXA 3VNSA 3BWMA 1ADYA 1O0SA 2NVUA 3M5PA 5FBKA 5CFRA 1BWRA 4C7XA 3FKQA 1ZUNB 5CB4A 2MSDB 2GO1A 2VHWA 5EEHA 4MRVA 5M5BA 2VBIA 3L1UA 1SXIA 4AKGA 1RLUA 4DYVA 1UIMA 3AP2A 1N8KA 1TIBA 2O2HA 4Y67A 1IVYA 2C5HA 5GONF 3E5MA 1C0KA 4GNRA 4OGKA 1PE0A 4QBGB 5IJ9B 2H4HA 5JC8A 1IOWA 1H5NA 4DA0A 4JZYA 4BO3A 4JB3A 5B2FA 1WXFA 2MMGA 3ELDA 1BMTA 3IAHA 2PUTA 4O4LB 2Q6VA 4EPRA 4PQGA 4HGZA 3UM9A 3M70A 4AS1A 3VMMA 2RK6A 1RZVA 1JAXA 2J0UB 2WWVD 3IOCA 5T6BA 2WSMA 1VQ1A 4BZWA 3PGKA 4EFKA 1K7CA 2GJKA 4US1R 2F1JA 1I4WA 5K3FB 1XRNA 3FHOA 1KWKA 5BYJA 2WIBA 4WCVA 2VXCA 3GOQA 4BX2A 1UBEA 2UU9B 3UGKA 1VJCA 1NJ1A 1NR1A 1CS0A 4CTNA 3GPCA 1GZVA 4I6EA 1PLKA 4FB5A 2JIMA 5JEDA 2BFFA 2QTRA 5DWQA 1ABFA 1AS0A 2A92A 1QMPA 2VHQA 1PFVA 2KBFA 4NQRA 2NZWA 4RABA 2OFWA 4RORA 1FX0A 1CUZA 1G3QA 4XIFA 3HYRA 2GLXA 2Z5FA 3HL4A 3N76A 2IIVA 1TGVA 3F4KA 4HADA 1R4NB 2RAPA 4W6QA 5FQNA 4YRBA 5EE9A 4POOA 2HADA 1OZGA 1DFHA 5CMLA 3RYCA 5FBZA 2ROQA 3I12A 3TOCA 1KR2A 3EB9A 1D9ZA 2Z5LA 3K20A 3BIFA 1ZNXA 2K2QB 1NBAA 2CNNA 4P34A 3RRNA 2G9QA 1UEXC 3PE3A 3EPHA 1DCMA 1ZH8A 3FIUA 1JWBB 4Y9SA 1YR8A 3E7PA 3NHFA 3ZE2B 3KOOA 5I8ZA 1G6OA 3NI2A 1CERA 2H2GA 3OPYB 1M75A 5JAIA 2GK4A 2WAOA 1NXSA 3ETJA 3KVYA 2EG5A 5A71A 4EZIA 2MMCA 4L02A 3ZCVA 1AZWA 1ABEA 1ZRMA 2BTQA 1I4TD 4EG5A 5DNCA 1UOEA 4XM0A 1M67A 1WSBA 4DWVA 1K7SN 5BV8A 5LVAA 3CBQA 1N2XA 4DIMA 5IDQA 2AMJA 4DMRA 2AKEA 1LSJA 1QQAA 1UXJA 4IKOA 3C6XA 4EO9A 3WRVA 1ZA2A 4JNCA 3I04A 4CMBA 3HV0A 4JYCA 5BMOA 1XD2A 2EW1A 1YL7A 3RFVA 1YTLA 1F14A 2Q62A 1A8UA 3JQ9A 4M1KA 2I8LA 4OEHA 3U3DA 4AZSA 1II0A 3OZWA 4EHFA 5G3ZA 3U5ZB 1X6VA 3B7WA 1VIVA 1ESCA 3P0RA 3GHHA 1XZNA 5J1TB 1RLJA 2VPTA 3HVUA 4Q4DA 5ER6A 4CMGA 4RZSA 3PUXA 2NU9A 4QYMA 1TK3A 1FXUA 1GRRA 1XTRA 2O0LA 3CBGA 3P8ZA 4MS4A 2A35A 1QR6A 1XMJA 1CD5A 4ZJYA 1V48A 3O3NB 3BIXA 4FZ3A 4BQNA 5JZVA 2GJAA 3QEBZ 2QU8A 1CY8A 3PUJA 4Z9XA 1X7YA 4H7PA 3LX5A 4UZEA 4RMGA 5F5NA 1XMIA 2II6A 2AN3A 3IQEA 3GDOA 3UGQA 4CRWB 5B37A 4Z1OA 3C8MA 1C50A 4JC0A 3PXDA 4WASA 4J7CA 1HNXB 3H5TA 3GELA 5EJMA 3ONWA 4L22A 5AKKA 3GLHE 2HF8A 5KVQA 4CM1A 2WJWA 3AFHA 3FPJA 1KNXA 1CJBA 5C1PA 1AUOA 1QG0A 4RQTA 3RUPA 3T1YB 3VSBA 2GD6A 1JHRA 1EG2A 3MB8A 2GS9A 4YGYA 4RJKA 2W00A 3NLLA 4XLTA 5E8JA 2B8EA 1U5BA 3GPDG 5D5QA 4XJTA 5AKZA 1DEAA 4OSOA 3PSHA 4NZNA 4PRZA 1B16A 1JXMA 4PLHA 4QJIA 4V3BA 1P0QA 4JLBA 4AJLA 3FBGA 1VB5A 1QKJA 1UKAA 1ZITA 2MU1A 1UJ2A 1WSDA 2ZANA 4FINA 3DL2A 3OY2A 5AVKA 5G02A 4OHRA 5HCIA 2A57A 2D2FA 4HN4B 3OLZA 3CZAA 4UCWA 3U16A 3OPXA 2EBHX 4B0PA 1T2AA 2XQVA 5DLPA 2JLRA 5BV2P 3B7GA 2LBPA 2W6ID 1BJRE 2QRKA 4TTJA 1ZHOA 1U0LA 2J6BA 4EPWA 3PQ8A 4RTMA 1MN6A 2O8NA 4QOEA 5TJHA 4AY4A 5K0TA 4L4XA 1TJ4A 1JDBC 3TI9A 1KAEA 5CLQA 4MK4A 3USES 1CJUC 2KLBA 2GFQA 2ALJA 3E9EA 1LS1A 4Q4CA 4YCJA 1ZVMA 3H5NA 3L9XA 1J9EA 1RW4A 5I9LA 4O63O 1T8SA 1IMOA 2J5XA 2Z30A 4KWEA 2YR0A 4KXQA 4QULA 2HDOA 3H9CA 3PZBA 1N6KA 4CLXA 4K1LA 4KR0A 1LDMA 4TLMB 3ZWBA 2AMFA 3A58B 1F17A 3GJQA 1WMDA 5DBIA 4DCNA 2E5FA 2HSJA 4MV3A 4EYEA 4BMSA 1NOJA 2AN1A 1YRAA 3DMYA 4CL8A 1GL9B 3QK7A 3YASA 1X7ZB 2HM7A 2FZGA 1ZMBA 2JANA 4UNIA 5SYAA 2YIVX 3OCXA 2ATEA 3MGAA 4TXNA 3RTGA 1MZKA 4RY9A 2OESA 3R5FA 2CHFA 3UH0A 4RF2A 1GXSB 2PO7A 3L6UA 3I9V6 3Q3IA 3R3ZA 1Q1GA 2XF2A 4BO7A 2UVPB 1JBEA 2QUIA 2VLIA 2GN6A 1CFJA 1PNTA 3M5WA 3ZDAA 5LYJB 2QVLA 1G8JA 3A7DA 3MTAA 4ICIA 4BWYA 4EW1A 2IYPA 1IN7A 3CRVA 4IJ6A 1FP1D 1O9BA 2XWSA 2ZVPX 3MJTA 2NUTB 3OWOA 1Y33E 1J0CA 3MNFA 2XRMA 3F9IA 4JBGA 5AJVB 1YBAA 3R3UA 1W52X 2OFFA 5IJ9A 1LSOA 4LECA 2H7XA 2C9DA 2O14A 2CDCA 3ML1A 3ZX5A 4CMKA 4LF6B 1LTHR 1NVKA 1ODCA 1CYEA 2ZYUX 5CLHA 2TSYB 4BVAA 1YR2A 4AWAA 1XVVA 4BLPA 1U7VB 1W6UA 3RGWS 1DQYA 4EM6A 1OJ7A 3K0CC 2E4VA 3ITDA 5FP0A 1QWOA 4PAGA 5EMJA 5HYVA 4Q9LA 1POXA 3AKZA 3DBIA 1RABA 5C1OA 4AKHA 1R88A 1YJ5A 2A9VA 3V7YA 5AYVA 3RRYA 3X1XA 5JD4A 3FCXA 3WRWA 5KC8A 3E4DA 3JCZA 4KQ2A 4AZWA 1YNSA 5EIOA 2AUNA 2GYUA 3QMMA 4QYIB 3RE1A 4ZYWA 1LY1A 5MN4A 1A77A 3RIMA 2VP4A 4M6WB 5BOSA 3OCVA 4WECA 2EKDA 5I9IA 3RC8A 1RXUA 1LVHA 1X9HA 1N4DA 1QX4A 2CZCA 2YQZA 4MWTA 1RAFA 1XDSA 3FFXA 4MVJP 2PXHA 4HQ6A 3WIOA 2YHIB 3HJHA 3GD5A 1CBUA 1THZA 3RVLA 3EVGA 2X5XA 1P5RA 3DKRA 3K1AA 3DDNA 4KITB 4HDMB 1SD5A 4IZHA 2ZGVA 5KINB 1WVIA 4AJEA 4TT3A 1TM5E 1IC6A 4HAUA 1PEAA 1Q1QA 1ENPA 4KAJA 4X63A 3HC7A 3SFTA 1EI9A 2CHUA 5DF1A 2CKMA 1B0ZA 2BGKA 3PUWA 1F9AA 2NU7A 4WFIA 3FVTA 1UKZA 2D2VA 2HSDA 4O2RA 2EP5A 1KZYC 1NW5A 2IXBA 4PFKA 3TLBA 4JBWA 1ZOIA 4DDTA 2R6GA 1U0JA 2Q6TA 2QRGA 4HP8A 3W8NA 3M3PA 1H6CA 2H6EA 1NTOA 3HA7A 2IGBA 4DJJA 2QD5A 2J6HA 5LCXA 3CVXA 2F3TA 2D5BA 4NYJQ 5DCWA 1ZSVA 1Q0HA 3KQMA 3NTOA 4BAGA 4F6RB 5KKNB 2ZJ7A 4LISA 1N6NA 4MUKA 4IRUB 3DBOB 1RLOA 2QQFA 2HRBA 1E9DA 4F1KA 1UK6A 4LCBA 3VZPA 3I76A 3FDJA 2R47A 3C70A 4KGVA 4C05A 3FLBA 2CY0A 3HZHA 3UNXA 2G9ZA 3IAS1 4DM4A 1I4OA 4MPRA 3OCCA 2F3RA 4H6PA 1CUVA 4Q21A 4DUZB 3I6UA 2KKLA 3D6FA 1U94A 2L19A 3FTDA 4BEJA 2MOKA 4PYIA 4D4GA 3O8QB 3QMPA 5ALXA 5FFNA 4BKOA 3H04A 3M81A 5HZHA 4JN6B 2Z56A 2MINB 2FA9A 3OM8A 4FLEA 3IKTA 1NYRA 2PBLA 4U00A 4W6ZA 2YYYA 2VCEA 4RY0A 4J7XA 4N41A 4MO9A 1W29A 1RNLA 1KI6A 3L18A 2X2EA 1MTOA 2R00C 4LGYA 1BH6A 1TC1A 2E4YA 2VN8A 1RLIA 1AY0A 2FXVA 2YRXA 1UFKA 1KQNA 2ET6A 1FTYA 2Z4TA 4MW0A 1QK5A 1E1KA 4V1CA 1KHXA 4FEEA 1NDHA 4TXJA 1J21A 3H2JA 5K8UA 1P3DA 2ZYDA 1E9EA 2WRZA 5E7QA 5J4KA 4GBMA 4O4HB 1OSNA 3AKDA 4LRQA 3QSYA 2QRVB 1T6YA 1B76A 4OHCA 2YWGA 4ZI7F 3Q7SA 4JI8B 1PWHA 4DLLA 1IY0A 3GVIA 2LPMA 4IVPA 4C3UA 3H9EO 5KPDA 1AKNA 2ZYRA 2HMSA 2C0PA 2M2IA 3UNNA 3AGPA 2P9YA 4XH9B 5JNUA 2CDNA 5AJXA 3P1JA 3P20A 3PENA 1LLUA 4GNKA 4BV3A 4QHSA 1MH9A 1DO0A 3B6IA 2B4KA 4EQZA 2H1SA 1P1BA 3VOSA 4P3OA 3A6KA 2OQVA 1GIAA 5D3QA 5BXYA 2ONYA 2DP4E 1ZGZA 3UHFA 3L8FA 1KQFA 1X74A 2OCKA 4WRRA 3NJ4A 3PHCA 1FPQA 3I8OA 3OF5A 5C1DA 3BRQA 1C3JA 1GM5A 1TA4A 1QIEA 2R60A 3AR6A 1T3HA 3AR7A 1KE1A 4L28A 2IX3A 1VKNA 2QOEA 2WVJA 5CIQA 4ZAXA 5F52A 3QVKA 2O2JA 2K4MA 2DLNA 4IDFA 3EEFA 3VPCA 2P4HX 5FWDA 1VCMA 1Z6AA 3JQQA 4C22A 2L82A 3MQ2A 3QW2A 2K5UA 2NV0A 4R1MA 3AEKA 3T38A 3UJ3X 3H6HA 1EM8A 3PDUA 4XIJA 2M6KA 3UUFA 4IMPA 1PLJA 3E27A 1K92A 1EVZA 2AEJA 2BY4A 2FF5A 5E4FA 4YT8A 1BJTA 2TRSB 1YBHA 2CNWA 1E2JA 3LY8A 3N1UA 6Q21A 3RAEC 3BEOA 4Q48A 5CM8B 1UQUA 5AVOA 3LP6A 3DLBA 2QVXX 2WWFA 1NXPA 4MXDA 3RQIA 1T8WA 2DHCA 3FF1A 3RNLA 3G2HA 3R0XA 4R5HA 2YWXA 5CT5A 4MB6A 1G7TA 3QZUA 4LE2A 4U9IS 4R8KA 5LB2A 1CUYA 4TWBA 2QSZA 4DNPA 1Z7BA 3IQWA 3KKZA 2O5EA 1F2DA 3VC1A 3WGZA 1E4EB 1PNOA 2H08A 3BKXA 5A9SB 3ICCA 4N49A 5KZMB 4AKIA 1JR3A 3E23A 3BH0A 5FADA 2NU6A 1BQ3A 1G4AE 5DASA 5AKJA 4CN9A 2AYZA 3EODA 3WKEA 4AZ3B 4O2BF 1U2QA 5DI9A 2QXYA 4HK4A 4IIGA 4BGVA 3FRHA 4PZPA 1GYRA 2OBFA 2WD9A 2W9XA 3AZOA 4IDCA 1OIWA 1B6TA 4TMTA 5K4HA 3B53X 3N6VA 4EPTA 1T5TA 2FG6C 2QL9A 2I6QA 4JJZA 4UEWA 3W2TA 1AMNA 2DU8A 2EFDB 4B35A 1FDUA 3TG2A 3S1LA 1FBNA 1F06A 2E6UX 2GZRA 3VISA 1T2NA 3MRXA 4HTAA 1P1FA 5BNZA 5B5SA 3OH8A 3LM8A 3LTNC 2HWXA 5I4CA 4MI6A 2J3EA 2JLCA 3WO1A 4Y0VA 2WNSA 3ZDCA 3WB9A 4QDUA 1OF1A 2ATXA 3SYLA 2PLWA 1XDUA 2K2WA 4E31A 4RD2A 1QRAA 3JQBA 2NU9B 4AICA 1WW8A 2Y66A 3RVPA 2PAAA 3ZDXB 1AZTA 5CEJA 5JSUA 2QTZA 3W6OA 1X0VA 4L3OA 1DOHA 4PCVA 1UBHS 1YZHA 4D7AA 3RAFC 1IBKB 3O93A 2A0YA 5CDHA 4EHKA 4DNFA 1F51E 3EZXA 2IC5A 4I6JA 2EBWA 5FOTA 1BMFD 3I9V1 5K3DA 1G20A 4B5KA 1XZQA 2QLJA 1DEKA 3MILA 5ALVA 3FW1A 2WM8A 5GMOA 1EJ6A 3L7LA 3MVEA 4NHOA 1IB0A 2WV7A 3ZE6A 4QOGA 4EPXA 4ZO6A 5HCNA 4C14A 1V95A 2UYYA 2VO1A 2GKSA 2H51A 2YZMA 2Z3WA 2ZYIA 2G06A 3D8SA 4G0ZA 4LVUA 4PZLA 3VPAA 3EH1A 5KU7A 5ALIA 2J32A 3SCZA 4KIUA 1XTIA 2HMAA 2X9NA 3KTOA 4TN1A 5SZHB 4OYRA 1PFKA 4EJSA 2OCPA 4P3XA 3RYCB 5FV4A 2HHCA 2QAGC 2XD4A 1EB8A 3CONA 3F67A 4KWIA 2QU7A 4Q6BA 4RELA 4RKEA 3CSDA 1LEHA 1ELOA 5B6JA 5KVAA 4YO8A 3CLRC 2HYIC 4L16A 1SZCA 4NH0A 1TO1E 3ND6A 2I8CA 2GK7A 3IR5A 2JAHA 3HV2A 1UXHA 1CPYA 3IELA 2GERA 3HWX1 3H1GA 4HH0A 2FX2A 2Y1GA 4XEUA 3T1NA 1E3MA 3ZCXA 3AIMA 2A7XA 2NV6A 3WHIA 3TCKA 4B8ZA 1ZZEA 4ZPJA 1N5LA 2C83A 2AFIB 4MVYA 1GQSA 4JJGA 1JL3A 3WIUA 3ZNQA 2DHRA 3GFFA 3KYCA 3SF8B 3K2EA 4J3FA 1G8FA 1UQRA 4D8TA 1A96A 3W5CA 3BA1A 5GINE 3AB3A 1MQ9A 5AM3A 1S7CA 1FFYA 5K05A 2ZT5A 2WSLA 3D6MA 4EECA 1F38A 1NQOA 4ZD6A 1TK9A 1R7RA 4C5CA 4MVJF 3FROA 4DCCA 3UN0A 5JBIA 3EC1A 5KNDH 1CVRA 4RV5A 2I2XB 3AOEC 1KA9H 2FR8C 3R7WB 5ALFA 1QV9A 4JC4A 5KS2A 2QV7A 2HMVA 2X4IA 2P9ZA 2HBZA 2FRXA 3FR7A 1H4QA 4F4CA 1JAIA 2XVZA 4HZIA 1EK6A 1GAJA 2F67A 2ZUCA 1K6XA 2IOYA 5DULA 1HT0A 1USUA 1W87A 1Y9ZA 1P1KA 4GRAA 4EG6A 3E8SA 1FP4A 4BFYA 1GYQA 1A9ZA 2IS2A 3BRWA 1PWEA 1PTJC 1RXEA 2DKNA 2GYYA 2W6JD 1IZYA 1P91A 3DVQX 2F59A 3EFOB 4KWTA 1SB9A 4V0OA 2VTKA 4RGYA 3GF4A 4U2DA 4YJGB 4Q12A 1G7RA 4TLDA 4LK3A 2DFKB 2VJYA 3OETA 5EZYA 1XMPA 3JD4A 2YV2A 1I3OA 1L7EA 2JIZD 3K6JA 3V4SA 4MCJA 3QIAA 4R0VA 3ELVA 2QHXA 1UC9A 3HPRA 4TWZA 2XCOA 1J9GA 5SYMA 4F21A 2ODTX 2D1TA 1Z4IA 2OZKA 4D3YA 4B3IA 2BGIA 4DQDA 1YZUA 3T12A 2DVMA 1LPSA 5LYJA 5CDTA 4AJNA 3U44A 1NC1A 1BHJA 2GM5A 3JAWB 2B5VA 2ZATA 1CVLA 3CZCA 3VZSA 4E11A 2C94A 2CLMB 5CT4A 1W36C 3DSRA 3QPDA 1EINA 3B1FA 4ZCQA 2H2WA 3VDRA 1G19A 3N59A 1LQTA 2GO7A 1QHHA 2GN4A 3AETB 2W98A 2CE2X 5A05A 3NTVA 3FMIA 1OVGA 3CZRA 3QLVA 3DEJA 3NYIA 2JNWA 4Q3LA 1TQ6A 4DUPA 1IN1A 2IUTA 1DX4A 1CQXA 1DT3A 5E6RB 2Q49A 2WHEA 3AF1A 3ETGA 4X3PA 1CEEA 2AJDA 1OILA 3B9QA 2CVPA 4JOQA 4OQFA 5JJKA 1IN4A 1T2FA 2AH5A 2IF0A 2VPPA 3PJFA 4ITVA 3ENZA 3RSZA 2WUEA 1KEEB 2J3HA 4FGUA 4Q7MB 3KLBA 5KTKA 1UPUA 1KYXA 1ZM3A 4JUBA 3AR5A 4JI0B 2VLBA 4LFCB 3QX9A 3CSSA 2UUBB 1U9IA 1FNCA 5IZCA 1JEQB 4MTCA 4RJJA 4Y6RA 2BEKA 3MJCA 5EINA 4C4AA 5ITZB 4PZ9A 2B2CA 1FFXB 3AHEA 3OLWA 3ZJYA 4F3CA 2PS1A 4YBZA 1EWVA 1ZMXA 2FG7C 4J0IA 1IDOA 4J3NA 3TBHA 1OC4A 2DECA 3VJLA 1V1RA 4RVGA 5E2AA 4HLNA 3KYIB 4P35A 4RKFA 2YFHA 2CJYA 5JXIA 2GBCA 3DW3X 4FC6A 3L1JA 4R2KA 1C3VA 3RF7A 2JK0A 2Z6VA 5JEOA 3EPRA 6ABPA 4X64B 4BEBA 2RGDA 4OI0A 4JITA 2VPZA 2W4MA 4Z0HO 3MWFA 2Z0MA 3GRCA 3PJDA 4NC9A 3L40A 1T9GR 1Q2XA 1N2BA 1B93A 2FCRA 5DJ5A 2YVLA 5FHRA 3BFPA 4Q9HA 3A4NA 3DGFC 4ZV9A 4PNHA 1SZDA 3LHIA 2WMDA 5M29A 3S3TA 4B2YA 2IPLA 1U6KA 3T35A 3KHSA 1W2GA 3SVTA 1BRMA 1ESDA 1EP2B 3M6IA 4MEJA 3SI7A 1UJ4A 2VAMA 3K1YA 3M6MD 3WMFA 1XHLA 4WZAE 4ES6A 3LPDA 5ILQA 2Q4BA 1U8CB 4X92A 1I6WA 1O03A 1QSGA 4KGDA 2ATVA 1W49A 2G83A 1F6DA 3B89A 3UUGA 1O4VA 1GHTA 1FQOA 4ER3A 1C2YA 3U48A 5JC1A 3BERA 4KGZA 4HJXA 1YCHA 3ZHSA 4C1BA 4MZDA 3BFKA 4NDNE 3P26A 4LRUA 2WIDA 3IUJA 3MG9A 5ALWA 3LDAA 4UMFA 4E22A 1S3FA 1QRDA 4CQLA 2A67A 1L5FA 5FBQB 2X23A 2WJHA 2ORED 3BJRA 3KQOA 1BXKA 1ZP6A 4XLZA 5D7BA 1KRWA 3L77A 3T3HA 1PN3A 3S99A 5LDHA 1M8PA 2EYUA 3JALA 4QTYA 1UDWA 2OD7A 5J2UB 4O3FA 1CRZA 1L7DA 1QCYA 5CW2A 4D6PA 3OMXA 5K8LA 2YN4A 3Q6IA 1H8HA 3DTVB 3GWZA 2QF7A 2CLKB 3GJXC 1SZJG 1GV0A 2FSIA 3RUCA 3ZWNA 2HWKA 1NNUA 2I33A 4IPTA 3T1QA 1UZLA 1TT7A 5JXHA 2FPMA 4DCUA 4GQBA 1RC8A 4TVSA 4HGPA 3E5HA 4PAWA 1YRYE 5CA1B 4L27A 3S29A 4DC9A 1ODIA 1KGDA 1XNGA 3CT6A 4CV1A 5KX5B 3RRXA 5EP4A 1HOXA 1SVLA 2XTJA 4S1WA 5T8KC 2C54A 3L8ZA 4FE4A 1EQUA 5EWJB 1QE0A 2VCYA 3FCUB 1HOTA 4WXEA 1Z5WA 1ETHA 2HFKA 1XDWA 1T4CA 3V4OA 3UYLA 4N40A 1E3WA 3A2LA 6NULA 5ALNA 5IKXA 1ZIXA 1PS0A 1RAHA 2PNFA 2N0SA 3CYFA 4AG3A 4BVLA 3PEVA 4XVHA 2Y4NA 3NJRA 4IG4A 2XRYA 4CW7A 4PIVA 3VJMA 1FP7A 1J8VA 3N74A 4EMBA 2H2AA 4GYKA 2AOUB 5ALQA 1C30B 2UVDA 5BMVF 2Q5JA 4ECEA 4C0HA 1U9CA 9ABPA 3TGPA 3HXPA 3DT8A 1TAHA 3FOCA 2OVFA 2PK3A 4M22A 3W1VA 4LHWA 2H9AA 4LTMA 4L4RA 5E4JA 3DSHA 1ISHA 5I9MA 2EFEB 3EPPA 1JIUA 2VI5A 4NBSA 5H02A 3A6ZA 4G0MA 1GU0A 1JAHA 1FEZA 4UM9B 1CQJA 1HY3A 2CNDA 1IBSA 4QWMA 3IERA 2YV4A 1Z3CA 3INYA 3MMSA 2ZBEA 2AOTB 3DYBA 3KZCA 4JHXA 1T4DA 2G07A 3AOGA 1SK8A 1W5EA 3E5NA 4P2BA 4AQDA 4AWBA 4PLWA 1OBOA 3RVBA 1ZNQO 2GEVA 4N12A 4RH1A 1ADFA 1F3LA 1RACA 2NTVA 3THRA 1QFZA 2NU6B 4WZZA 5JWHA 1WV3A 1G18A 4FHCA 3W77A 2BR4A 1ZUNA 4ACBA 2QX9A 4DGSA 1ZIYA 3F6PA 3R8FA 4CM5A 1NN0A 5LD2B 4FW9A 3OBIA 1U0RA 1F8XA 1WKVA 4FYMA 5TMDA 2UXDB 1G4HA 3E7FA 3G1UA 4P4TA 4Y2PA 2PG3A 4G89A 3EDRA 3H0CA 3EY9A 1GPBA 4O4LA 4EEKA 5CCXA 4ZAWA 1EXDA 2J6IA 4JENA 2IUSA 4RZQA 2IEAA 1VIMA 4PAOA 5EWLB 3MT9A 4R1LA 3L7IA 1NUTA 3AJ8A 1SRQA 1PV1A 3DLCA 4QXOA 5DVZA 4B3SB 4IHJF 5LUAA 3B8HA 3ZGLA 5JAMA 4RSMA 3M6XA 3TKAA 3LUJA 4I8DA 1K5GA 5DYNA 2XE4A 2ZG6A 1Q77A 3OTWA 1DWUA 2X5OA 3EXAA 4WJKB 1VBKA 1MB2A 3BYZA 3CJTA 4UM5A 3UNMA 4EB0A 4TWIA 4WKNA 2R4TA 1RI3A 5K51A 2FPXA 5IC6A 4UPDA 4BNDA 3U3XA 1RWWA 2ZJOA 5HRUA 5CB4F 5KC9A 3UK0A 1OH6A 3HUFA 3BL8A 3NWJA 2JI8A 3D5QA 3PHLA 4Q1BA 5JSZA 3MJSA 4CLDA 1OI3A 2GFHA 4E5DA 3GVHA 1ZLYA 3MK31 5I51A 2IFTA 4NYMQ 2CJPA 3H42B 1YQWA 4Q3BA 1CIPA 3N8IA 4E6EA 1HQCA 3QOXA 3PRJA 4Y2TA 3OZEA 4OHFA 3DWEX 1ZK2A 3N53A 2O3QA 2VQ6A 2YVQA 4WHMA 1JFTA 3PG5A 1ONPA 1VJTA 1G4UR 2B6HA 3GNLA 3LY5A 5EXDA 1HE5A 2P1RA 2C00A 1PQWA 4JYMA 5B3JC 1JG2A 4PF1A 1DP4A 4EHBA 5KYXA 1MQSA 3ISJA 1LBIA 2ZJBA 4HDRA 4LNUA 2P65A 4XGQA 3TK1A 1IZ7A 2C88A 1S3SA 3JYHA 3NFYA 4FD2A 1JEQA 5B7GA 2HSZA 2A59A 3OWHA 3C1AA 3HU2A 4JWKA 5CA0F 4GWLA 4HH1A 4P80A 3SX4A 4YLYA 1XMOB 1B2RA 2VTVA 1E6LA 1DPGA 1FC0A 3EBLA 3EULA 3KPJA 3MUOA 3TD2A 2C2GA 2IYSA 1AT1A 2JVJA 3D2CA 3FNBA 3GUVA 2Z8XA 1CJCA 4M0PA 4R2WA 3B1YA 3COYA 3G8BA 3KZVA 4HVLA 1BDBA 3I62A 1FFAA 2P2SA 4AX4A 4DR4B 3HZZA 3E1KA 2OHHA 5F78A 3WNCA 1T3GA 2NSLA 1X87A 3U7JA 4LMPA 3QXCA 2PZJA 4Z9BA 5AT1A 2ID8A 5DYWA 4IDHA 4RF3A 1TUGA 1KZ7B 4AL4A 4IZIA 3H19A 1O96A 3WGLA 1YJ8A 4WERA 2V6MA 4QFCA 4GR5A 2HJHA 4YQZA 3SOZA 2GAAA 2DLDA 3ZWQA 1G20B 2PT9A 3NHZA 5A9RA 4P4NA 1KFJB 3W5AA 2C78A 3ON5A 1JR2A 3W9SA 5ITVA 3MOGA 1DB3A 3Q0TA 2PEZA 5EQDA 4BFZA 3ZY3A 1M33A 1MO4A 3DVAA 4HPJB 2C20A 1NTRA 2G4VA 4XOIA 4CKEA 2O59A 4UKDA 3TZ6A 4UHJA 1VBMA 1P7ZA 5AHRA 1D6SA 3CLTD 3GT7A 2NYUA 1LGYA 3QKRA 3K30A 4UTRA 5TC4A 2JFHA 1LC3A 5H9VA 5KSOA 2R5WA 4FI3C 1FVOA 4C0JA 1REQA 3MGGA 5DTIA 4DV3B 2Q6LA 1M6YA 2ZAIA 2XSZA 5DBOA 2WZDA 3CH5A 3JTMA 4F5ZA 1QGUA 3NWPA 3ZE9A 4UDXX 1QH0A 2YWHA 4GP9A 2ZZKA 3D0QA 1YA6A 2A9RA 1T1GA 4CGZA 3WNQA 1XZDA 1NGSA 3AW9A 5AH0A 4YXFA 1TXGA 2AYYA 2PT6A 2PV0A 1VOTA 2BMEA 2XRFA 4GOKA 1B74A 3KSDO 4IQFA 2A0XA 4BP1A 2O1XA 2VR1A 4ISCA 1C9MA 4JWTA 4E5UA 1W93A 2IWHA 5A4DA 3JALB 3P4YA 1XQVA 4KTVE 4N7MA 3PYXA 3THXB 4IS2A 1L4NA 4JQOA 5G1NA 4AJ4A 3SAJA 3PFCA 4A2QA 1FQKA 1DXQA 2RI1A 2ERYA 4YROA 4ZCPA 3TX6A 1GNLA 1R0BA 2TMYA 1ZM9A 3DR3A 1G0NA 3LK7A 1OA0A 3P0JA 3NONA 2C1ZA 2RHOA 5D7NA 1M5RA 1I30A 3GRAA 4QBFA 4KR6A 4C2UA 1BIFA 1M1NA 1HE8B 4FKMA 4TT3D 6LDHA 4UCXA 3LHSA 3MN1A 3GJ4A 1P0MA 4REMA 1QS0A 2LE0A 3NBQA 4UUAA 3TL2A 4WK2B 3THWB 1ZIDA 4HRAA 2BR3A 2WINI 2YHBA 5IHPA 5HBRA 1PJTA 2HV9A 3DLAA 3H1EA 3HSKA 4NPCA 5KNBD 1RWNA 1YR7A 2P9TA 1DJOA 1JAZA 1W5BA 1JSLA 1SZPA 4I4TB 2P3QA 4LRYA 2O7RA 5TB5A 3S1AA 4CN8A 2P40A 4YUVA 3WBBA 2GOYA 3R6GA 3L8HA 4OOFA 2HT6A 2XWPA 3DE5X 4QJBA 3CRZA 5SZKB 2GNPA 4O8CA 5LDDC 5DK4A 4G1VA 2Z6AA 1Z17A 4JIWD 4MVJM 4DWWA 3REOA 4OP3A 1QF7A 1SELA 2FN9A 1DGQA 4S3MA 3HX1A 3A1SA 3FOBA 1CJSA 3V1YA 3RBZA 1EAYA 2IYNA 4MUEA 5H1YA 3UWKA 2IHUA 1KJWA 3E3LA 2QT0A 1R0WA 1YL6A 1QJ4A 1V8ZA 2ZBUA 2PGDA 2VSXA 4LDAA 4C0WA 2A7QA 2OFOA 4PO8A 2AE1A 3QXHA 4IIVA 4KTTE 2Q7OE 1MOPA 2CNOA 2ZTUA 1B8VA 5DYIA 4Z0NA 1J8DA 4L78A 5LD2C 1XMVA 3BCHA 3QVTA 4UU7A 3QTTA 2A5GA 3IDSA 4US2R 4RKQA 2E5WA 3OIUA 3O8LA 4KQEA 2DR0A 1KHUA 4W1RA 3OTHA 2O3TA 4GL2A 1YCDA 2ETXA 2GCGA 4D8UA 1DSSG 1KRHA 1NYQA 4H08A 4K6GA 2X22A 3TZHA 1HEIA 2QJRA 4DIKA 3U2QA 3QWFA 2ADOA 5KDOA 2QMUA 3EIWA 3ZJTA 2G67A 5DM4A 2WHXA 5KI6A 3COSA 1UZMA 2Q3EA 4KUGA 1G0OA 3P2YA 4NENA 4NFHA 1P7CA 2JGFA 5HE9A 1YMQA 3WV4A 421PA 4F3TA 3F5QA 4U4AA 4M1WA 1I4EB 3TOSA 4QTTB 5CNKA 5E7IA 3PVCA 5KVVA 4W5OA 5DOVA 1Z12A 1V4BA 2A8YA 4Z7JA 3HCOA 1C81A 2NZVG 2XUOA 3OZAA 4J1TA 5T5QA 4RF4A 2HIHA 4R9VA 3ET4A 3PD7A 4YALA 5CX4A 1JMKC 4HATA 1EVJA 2EIHA 4N5HX 2OPHA 1NE2A 1KY5A 3NKFA 4RHXA 1HTWA 1T13A 1Z5UA 2ZCVA 2D5AA 3WLNA 5LZ2A 3EMKA 1QYCA 1J4QA 4GP7A 1NBMD 3NHSA 5BSFA 5EJ6A 3GP8A 4N8SA 4QYIA 3E2MA 4BKUA 3K6RA 3ZDEA 4EGXA 1IH8A 3B7PA 4K81B 4QQ8A 4DXDA 5HM8A 1SD2A 2SICE 4FCTA 3INTA 1NJ5A 4W8HA 3HP7A 5ERYA 4CHTA 3FZGA 3IQGX 5K6RA 3G2OA 2VHTA 3H1PA 2F1OA 2CEAA 4E46A 1NJGA 3EXEB 2R97A 4RLHA 5BUSA 3HFGA 4BTEA 3LUAA 3G2NA 3VPBA 2QY6A 4G23A 4CT5A 2IYYA 1O5TA 4MW4A 2QD4A 1UPTA 4RKYA 3GBPA 4UTOA 5YASA 1JA9A 4BMZA 4P54A 1B73A 4G4JA 1NN1A 3GEDA 3UW1A 1E9CA 4II3A 5G4KA 1T24A 2P0YA 4LNUB 1XIVA 4HEA1 4PM4A 2ZJ4A 3H9BA 4ABYA 1QRUA 4DZRA 4B3MB 1SXJC 4Q1FA 1C4OA 3Q7EA 4RTNA 1DFGA 4OI1A 4MUAA 5FUWA 3T3IA 5AVWA 3PIRA 4P4LA 3FWNA 2IPAB 1DC6A 4GMGA 4PYLA 2P6RA 2RCNA 1ZNWA 1M73E 3C5WP 1C3XA 3ZC3A 2XVYA 2XUFA 1KYYA 4BKRA 2ACKA 3V00A 2XUAA 4JA0A 4PFQA 3E2IA 3W1EA 4XDHA 3NNDA 3HS3A 2GPYA 4HHEA 3I30X 4MGYR 1FFSA 4RJIA 2DWOA 4CEIB 1V11B 2KSQA 1PJCA 3I8SA 1KK1A 4IEIA 5DNAA 1LU9A 4HJRA 4BGIA 3DW1X 2OILA 2F9LA 2Q4RA 4UHCA 3A1UA 1R1DA 1YASA 1Z7EA 4IZOA 5DSZA 2X7HA 4E4YA 4AKTA 1H3FA 2I4NA 1XD9A 4MS4B 2W4QA 3O8QA 2WWYA 4QJ3A 2QBYB 3JYLA 3ICEA 2VHJA 4IMJB 5DLEA 5CB4B 4DA4A 1EXNA 3GH3A 1DRUA 1R8YA 2WJPA 3DEAA 4PSUA 4YONB 3VVMA 3Q2OA 5BRJA 7MDHA 1PT5A 1ZCBA 2Z98A 5CVVA 2YC2C 3W2GA 5TMBA 5TF4A 3W7AA 1ZL0A 5EL0A 5HIJA 3AOEA 2PTGA 2FPKA 3BRWD 5AUPB 5KX5A 2QP3A 3A25A 1Z8NA 4JONA 5CG2A 2ERCA 3MUEA 4KSBA 3FNQA 3S2ZA 5B55A 1LPAB 1BS9A 2P6UA 5E95A 3FPAA 1C1DB 1RWOA 2HPZA 1H42A 4NBRA 5GOZA 3WIDA 5HJ7A 5DP1A 2WFZA 1XEWX 1Y0BA 2DQYA 1ZI9A 2LZ0A 1VHWA 3Q7TA 4XOUA 1TU0A 1ZSYA 3I9FA 1SCIA 4C29A 4KPEC 1CC1S 1M54A 1YE8A 3D6NB 3W5IA 3STVA 1I80A 1I7QB 1IONA 3K5HA 4PSKA 1NI5A 3WRYC 4YDQA 1AX9A 2JIBA 4YB8A 5F5XA 1NVDA 3WGYA 1E60A 2C4HA 1KHHA 2YFYA 3ZE1B 2GXQA 3BRSA 3QSGA 3EZGA 4GX1A 4MQEA 5IT0A 5EXPA 3IAUA 4NCXA 4YLEA 4OGFA 3OUNA 3FRIA 5JQGA 2B82A 1M2NA 1PW5A 1OX5A 2I65A 3K1TA 4RS4A 3FFWA 3PQ4A 1H05A 4OK5A 1KI9A 3D43A 1GUZA 3MBOA 3OSZA 4QPDA 1WSAA 4F46A 4F4DA 4L15A 1KDPA 2B1QA 2P27A 1BMFA 3FYDA 2XBLA 1PG0A 2GAJA 4C7BA 2ZT6A 1AH2A 1ZR2A 3CUUA 1WU7A 1ZQ1A 3HUTA 1H9CA 4JELA 1ZM2A 1JPVA 2WF8A 4EHLA 3ILSA 1Z3IX 4GBGA 3UC5A 3ZVRA 4ARUA 2HR1A 3QYAA 4FQ5A 4JT8A 3O8OA 2O4CA 2B1RA 3I4LA 3P9IA 4R8LA 1FSSA 1UJMA 3BOSA 4O1IA 4XYGA 3JWGA 3ZQJA 4MLDA 4DYDA 5EZQA 2YXNA 1MENA 2FY8A 1T8PA 3B78A 3DCJA 3D2AA 4Z3KA 3OE5A 1P8JA 4GE0A 5EJ2A 4R3WA 3SZGA 3VH2A 1J0XO 1PEDA 3GBSA 4M1OA 4HNTA 3CW9A 5C1IA 3U4DA 3FNIA 4UVGA 5GGYA 1N7IA 2J9RA 4ZEMA 2P6OA 1ZIOA 2PSEA 4OU5A 3BXHA 5EP3A 4B4DA 4CCAA 4NCJA 1CULC 2PUVA 3ELUA 3UT5B 2QN9A 1YFJA 2NTJA 1JFFA 1E1YA 2ZWPA 3BGVA 5F4BA 5AVVA 5GV8A 2YJ5A 3ZLJA 5CK5A 2IBTA 2XCTB 2ID9A 1G3IA 1R3DA 3KVNA 3WLRA 3K0HA 3DDOA 4GD3Q 4B46A 4EL0A 4H0FA 2PD4A 4RQAA 5TJ9A 1J2JA 3LUHA 3UPUA 5JLAA 3F4BA 1OWOA 3OIVA 4RQBA 1G2QA 4BDTA 1SG6A 1YQGA 2CN1A 4FR2A 4UD2A 1EM8B 2J0SA 3BXGA 3WK4A 3EAQA 1SAYA 5BWMA 2DKFA 2PRKA 2SBTA 1YU6A 2XXBA 2CLHB 4GBED 4WXMA 2C03A 1D0VA 3SM3A 3SR4A 4LZJA 1RWMA 2P75A 2YVAA 3QUQA 3KOUA 4J0KA 3R5KA 2D1SA 4RIHA 4YECA 4OKIA 1TF2A 5BP7A 1JJBA 3BGSA 2OG1A 3JPYA 4TV8B 4BLQA 3WAGA 2ZETA 1R0LA 3P9XA 2DQKA 1ENOA 2BKAA 3LPMA 3D1VA 1Z74A 5FA8A 3MS4A 4NCNA 2CMHA 3PO8A 3K5IA 3DTTA 1XRMA 5LYYA 5KYWB 3L7DA 4X6UA 1E6EA 3T4UA 1A9PA 1Q7CA 2G40A 1CY7A 2V7QD 2G77B 2Q4EA 4QUKA 1AB5A 4URVR 3IODA 1I2AA 1R9MA 3TUZC 1APBA 2CLEB 2P3LA 3DCYA 3HB0A 4HBZA 3DDUA 4Q4HA 1VC2A 4KH1A 3TOXA 4MV0A 5A62A 4YYZA 1Z4PX 3KETA 5IBCA 5E7MA 4ZVRA 2DUNA 5TR9A 1JYSA 3H5IA 5IT5A 1D6JA 1HDYA 1K1EA 1W25A 3X2SA 2XTMA 1VL6A 4F9TA 3ET5A 4YAWA 2P3OA 1KJQA 2EZUA 4IIFA 3OCZA 4MDHA 5DM1A 2RH4A 1PEYA 3PGLA 3PUYA 4QWWA 3PWKA 4AXBA 2XB4A 4R71A 2BFDA 1BU5A 3EAGA 1TADA 3L02A 5EKUA 5H59A 3THYA 2RKBA 3H4VA 4LA4A 5BWBA 1DIAA 2BZ0A 3DXFA 4ZYXA 3NHMA 1VJRA 3CX8A 2VTEA 4HBGA 4MRNA 4OUDB 4Z9AA 3WGIA 1Y1PA 1T2EA 1HFJA 2O8BB 2P62A 2XMDA 4B44A 4RTSA 3HBFA 2A9OA 1OGIA 2W5UA 1JR3E 4HUTA 5A0VA 1MRZA 1YU9A 1EUDB 1JVNA 4KN6A 1ULUA 1UINA 1GRCA 2KS6A 3LVBA 5GM1A 3G0CA 3THXA 1M0WA 3FCYA 3R7AA 3TMKA 5JAZA 1AXGA 2HYDA 3NKVA 4EA8A 1SCQA 1XTKA 2W8BA 3F74A 1K98A 4WK0B 2Q8QA 3UXYA 4IZ6A 1AF7A 5C7IO 2FF4A 3LZ6A 5FI3A 5LQMA 2IRWA 1FTNA 1XZHA 2CVHA 4N3AA 4UNSA 4AURA 5TPZA 1WZIA 1RJFA 2FW8A 3DZGA 4RD3A 4ZK2A 5K01A 1WY7A 1X7HA 5C46F 5ALTA 3V46A 3HJFA 1HLPA 2C04A 4KIGA 4EF6A 2ZS7A 2VDVE 3GT0A 3WDLA 4W5JA 3W7VA 4IIXA 4BVFA 4NS4A 4ZIRA 3AVUA 1DARA 3ZZMA 4I1PA 1DC7A 2B6NA 3CNOA 3LDFA 3S1AB 3T9CA 3CH7A 2A58A 2VHCA 2DTEA 2O52A 2HO4A 4UCQA 3LPNA 3L4BC 4X65B 1ISJA 1XRSB 2X19A 1Z88A 3KTFA 4H6VA 4RCZA 3F9RA 5IJAA 3VO8A 3LK6A 4CLRA 4KMRA 4OL9A 4ZAVA 1R3UA 1S96A 2XVAA 4UBMA 5KPJA 2F3QA 2CHQA 3RSHA 2R85A 3F90A 3OC6A 1DRVA 3HY6A 1P45A 2XQFA 4LMRA 4RJ2A 2JIRA 4JUDX 2CXXA 2AJ8A 3AHIA 3B9BA 1Z8FA 3LXXA 3MWLA 1SCKA 1DWPA 2BFPA 3PD0A 3LT2A 2Q1SA 3CN9A 3DL7A 2GVNA 3DD1A 3MTQA 5TX7A 3KJXA 3U4QA 1D7OA 1NF2A 3EVNA 3NAGA 1DQZA 3NH6A 1WMAA 4QE3A 1H9AA 1V1MA 1QR2A 1V8BA 2BZGA 2C98A 2P7HA 4B7CA 3D6JA 3RD5A 5E50A 1IXYA 3GCDA 2VPWA 2ZM5A 2IS4A 2WTEA 4C0LA 2JH8A 1S1CA 4QPPA 4Q3OA 5L9AA 2VNHA 2ZIAA 3GLIA 1E9AA 2DJIA 4MTLA 4RH0A 5TDHA 3M3DA 1SG9A 4DXAA 2R3SA 1N34B 1EE2A 1G8PA 4B6RA 1G41A 1LSUA 4ZCRA 3RSSA 1P4HA 2YKGA 3IS3A 3I9OA 5I48A 1N2IA 2AHRA 2FLVA 1EXWA 4YWJA 4MHOA 2VQSA 1B4DA 1T3SA 3UC9A 3WSWA 4GPD1 2M9MA 3H5OA 1XJQA 1PT6A 3S2FA 4B3JA 3MWEA 2X1VA 3LCVB 4G5FA 2G9NA 3RC9A 3RYTC 2C96A 4NECA 3OAAA 3DEHA 3SXPA 1EXVA 1USKA 3J80A 1BXRA 2O2EA 4MS3A 3CH6A 2ZI3A 5BWLA 3H3XA 4F38A 1NLZA 2PZEA 3C4JA 3CMCO 1BWPA 4WNAB 1LPPA 4I7EA 3UK6A 5K0EA 1TF5A 3VO1A 1PJRA 1U3WA 4JDPA 4JNKA 3SSMA 3ZWXA 3W1WA 3I6IA 3SXUB 4US0R 4EVIA 1D1PA 4EG7A 1U1FA 2Q9AA 1RHMA 3IHLA 4OJNA 1JFLA 1FZTA 2XCUA 1H3EA 2WT4A 4F56A 1UDBA 1XDBA 1YCFA 3KXLA 3ZD9A 3OE4A 4GWGA 3GI1A 1BXZA 3SVLA 9MHTA 2JFGA 4HPWA 1BKDR 2QTHA 4CIVA 4WCDA 5GY7A 3WLQA 2ZPUA 3TTVA 1CDDA 3VZBA 2FZLA 4I3GA 4D8YA 1XJ0A 1QBKC 1FUUA 3I9JA 5AQEA 1A7UA 5F2OA 4M1EA 5JD3A 4XDGA 2JH9A 1C7RA 3LIIA 4RDHA 1SQ0A 5DBFA 3UJDA 3EA4A 1ST2A 3TDMA 1UL1X 5IDYA 8MHTA 3HVJA 4LZLA 3F47A 5LQSA 2GX6A 5DHAA 3GRUA 1G98A 1H2ZA 3WG9A 1OZAA 1MZVA 1HQYE 3QI2A 1JKJB 4G5QA 1I51A 1OWMA 3QELB 2JBAA 3LO5A 1Z26A 4JX8A 3QKSA 5F76A 4XCVA 3TE6A 3K8YA 2FPUA 1OVMA 1BNCA 3OO1A 3T54A 1HDIA 1J1ZA 3BD7A 3SEZA 3D6UA 1JXOA 4WNIA 5TGTA 3OURA 2CXRA 2VQDA 1E7QA 1H8EA 2YY5A 2Z2JA 4BV2A 3AEQA 3F5MA 1CY6A 5LWHA 1IRXA 2PUAA 1U0TA 5HNKA 1G21A 4DL9A 2DB3A 2V8OA 2WI8A 3MD0A 3AESB 4BN0A 1UFQA 1V7QA 2BCJQ 4XVQA 3DAGA 3EN0A 4B3BA 2J3QA 3JARB 3MLBA 5K6AA 1E1QD 4A23A 5CD1A 2FE4A 2FZCA 3N9IA 1N9GA 4XWGA 3BZWA 3QLJA 3KVRA 1TLTA 1DX6A 2BF4A 2DCUA 3PF8A 4HAZA 4RW0A 5EWMB 3OZIA 3IKJA 1G1MA 2H0RA 1EUZA 2FPRA 3LNTA 2QI9F 3PDWA 2CDAA 4IXNA 4M21A 4O2BB 4BP9A 5HKKD 4K9LA 2FFAA 1P1HA 3W2EA 1PL0A 3U7HB 1SU6A 2H2FA 3QP9A 3MRVA 3IVCA 4UQPA 1AUVA 2V9ZA 4X66B 3V80A 5C31A 4ZZ1A 4OB7A 2YS6A 3ABQB 2OXTA 3MZ0A 3DYVA 4YRJA 1ZA1A 4N4AA 4CIDA 1PZFA 1WKCA 2PO5A 3E70C 2VDMB 4CQMA 1U9JA 4GUAA 4MP3A 1P7PA 1TU4A 1DDOA 4UOEA 2EFYA 4JEUA 1KEVA 1JI3A 1ZFNA 4BIMA 2Z8YA 1A5TA 3O21A 4COOA 1XWFA 4XKJA 2WD7B 4WVLA 5KOJA 1WZ2A 3MJDA 3DTVA 1EA7A 2CNKA 1MABB 3VOTA 4XJSA 4Q9IA 4IILA 3ER8A 5FRDA 1CZKA 2QE7D 2P5YA 3QJGA 1NATA 4HGYA 3JYOA 3T7CA 1KYTA 1V5WA 3UANA 1DJNA 1JQBA 3D02A 3KHKA 3JQ7B 1EFKA 1FNSA 4IUDS 3W4KA 5BR4A 4NF2A 2Q29A 3H5LA 3QVSA 5FX2A 2Q07A 3U62A 2JIDA 5IM4F 1JG1A 4EUFA 1ONNA 2IHVA 1RFGE 2PWBA 4G4SO 2NGRA 4BP3A 2WQ7A 3L7AA 3TQHA 1UF9A 1GNVA 4JR0A 1DIBA 5EHGA 2ODPA 4TKZA 4CKWA 3LLVA 1QGOA 1PDWA 3EIUA 4TL8A 5EUQB 4BZQA 1EHIA 4Y2UA 4QELA 4PFSA 3PHHA 4KODA 2HPAA 4TQ9A 2PKRA 2YYZA 4ZA2A 5KTNA 3LVFO 5I5GA 3K70C 1ZI6A 4E09A 1O5OA 2RCYA 1BFKA 4B6JA 3IIMA 4B9AA 4E13A 8GPBA 4MLPA 3QJYA 3B52X 1PQPA 4M99A 4EVRA 2I3AA 3AT1A 4NOKA 1NI3A 1K5PA 2OWEA 2V7QA 5B1YA 3AVPA 3NM4A 3VR2D 2HK6A 1ADGA 4EI8A 1CUDA 1YJMA 5EI5A 4XI9A 3J7TA 3BUSA 3E84A 5FPKA 4YCBA 3A6LA 1YH3A 2GCNA 2F62A 2REBA 4ZQIA 1M6NA 1DC3A 1ZM7A 3QYFA 4CDMA 5LBUA 2WTNA 4FS3A 4DV4B 3Q41A 4KFSA 2C9BA 3KYBA 3ZZUA 4YMTA 3TX2A 4DLRA 5AOVA 3WLTA 1GPNA 5IC4A 4IRXA 3ISTA 4YRSA 1RXCA 1ZU5A 2Y1DA 2ZJZA 1GQ2A 3A36A 4ZKEA 2OGTA 3KB1A 4J1TC 4WZBE 1FFXA 4DB2A 4M9CA 3OZUA 3DVRX 1A9QA 2YJZA 3SR3A 1KH1A 4TV8A 5IDWA 3DPSA 3PXGA 1XYVA 5BUZA 2HUPA 1JB9A 2G6TA 1XA0A 4OHKA 5JFGA 4TL6A 2C2OA 2QPAA 3FGPA 2GZHA 2DUWA 1BSVA 3GJ5A 1JDZA 3I39X 3IR7A 3ZGVA 5BVGA 2JAWA 4QTUB 3PNKA 2JEZA 4DA8A 4B7ZA 1XTPA 1C8KA 1GQRA 2V9CA 1U8AA 3NCHA 1JLHA 1FQJA 4V24A 1XD2B 4ZC1A 1IATA 1XEAA 4PGFA 5JAPA 1DUVG 4N3GA 3UKDA 3D8TA 1ZN7A 1G3UA 1EEHA 1RQXA 4HRXA 2VAPA 4JVSB 2H1WA 2HEGA 1I1NA 3KEQA 2O7VA 5CFZA 2BFOA 2PMFA 4PNZA 3W06A 2ZJ3A 2ZUVA 4HTFB 1PCXA 3N7TA 1EHCA 3N0VA 2JPDA 4D41A 2IH4A 3PR2B 1OX4B 1YOVA 2AEEA 2ODEA 1K7EB 1WY5A 1VE6A 1L1FA 4Q3EA 3S1SA 1RPTA 3LT0A 1MDBA 4UAVA 4EENA 1LBHA 2WAXA 1KRXA 4BU1A 2X9QA 1V8DA 3I32A 5ADHA 5HR5A 3C3WA 2AVDA 4Z7NB 1LWNA 1H1DA 4EVQA 2J3JA 5FR2A 1X1SA 4MHTA 3GJZA 4AJHA 2Q0XA 4G84A 4L4SA 4WLUA 4F72A 2YJGA 3SIPA 4BU0A 2WABA 3SDSA 3TRFA 3P5BA 4ZAZA 4MVXA 4NBWA 3JQPA 5ELXA 1YJQA 2ZUEA 2AFIE 1E92A 2CBXA 4YV1A 5EJ5A 2JCGA 1PZHA 1XVTA 3FTCA 4LN1A 5JDCA 3DZJA 2EAUA 4ZT2A 2R751 1GTL1 2LD4A 3NQ41 1GFIA 3GPIA 5EC8A 5DWVA 2R7NA 4K9MA 3I28A 2RJ3A 5FNVF 3OQVA 1ORHA 3O0TA 1H2EA 3UXMA 1SHTX 4GOOD 1Z0DA 3IP8A 5DGIA 1L7VC 3NHBA 2W0SA 2WKPA 4PY2A 3HDHA 1MD9A 1E99A 1HDCA 3LQRA 4KAFA 4D92A 4NQZA 1JPNA 5IAAA 5JI3E 3QV1A 3J81k 5E38A 1A0OA 5IAGA 3U4AA 4C6TB 2DE0X 1IY2A 1JQAA 3PE4A 4YP5A 4I66A 1KBZA 1LI7A 3UAOA 2NP7A 2C2XA 2PQ2A 3WGKA 2WJ6A 3U7EB 3C41J 4NCKA 2BRUC 3FVWA 4KXFB 4QPJC 3RAPR 2RI6A 2Q2QA 1P77A 2P2GA 3TZEA 3FDZA 2WB4A 3TQCA 3KT0A 2FAXA 1YQXA 3M3HA 2RK3A 3FYHA 3ZK9A 1QRSA 3PQCA 4IUBS 3C97A 5K0SA 1UWLA 5FPQA 1ZM4A 4ABTA 1Z6PA 4NBUA 1Y3BE 1GG8A 1UBRS 4K9RA 4JLOA 2IOFA 2VS1A 3NAMA 5L7WA 1Q50A 1SQ6A 5EE3A 2FR0A 3TOVA 4DILA 3GCZA 4FCCA 2PUDA 3WIEA 1X1CA 2ANCA 3NDPA 4ZGBA 3N2EA 1EWTA 1HRKA 2OXRA 3KUUA 1N0HA 3AKEA 1T5LA 1U98A 1U2GA 1NFFA 3PQ7A 3G0GA 4G97A 4KACA 4WEQA 4Y2QA 2O19A 2NXJA 3ZQ4A 4CMIA 1UJCA 3ABZA 2GN2A 3D81A 3ZQUA 1SK9A 4RHCA 1HFWA 2ZK7A 3UMYA 2W22A 3I34X 2A4MA 1DL5A 3ZIUA 3IO5A 2OVBA 2O0HA 3B6MA 4LOJA 2P8JA 5KTPA 2TMDA 4KZKA 3KJHA 3RCBA 1EIZA 4AF6A 1IZ0A 4J2TA 3C6BA 5CVEA 1T8RA 4A26A 1VE5A 5LOVB 5HTOA 1OBVA 2D1FA 2JAPA 2VJBA 2FPPB 4Q0MA 3WQQA 1EK0A 4ETIA 1LB1B 2Q5QA 4LDJA 3WRYA 5L4NA 3KQKA 2QR2A 1Y9EA 4BO8A 1I6LA 4I9HA 2XKJE 4XIYA 2DWQA 2Y0PA 2Q2OA 3CLUC 3OLCX 2G9VA 1FE8A 3K53A 3X44A 5T7BA 1RTKA 1ARZA 1O6FA 2NPIA 3G7NA 4W1PA 2BHSA 4E15A 1QQTA 2ZR9A 1Y7HA 4IWXA 3NGXA 1YRQA 1NT4A 2FETA 4RDXA 3AXSA 5SY4A 3KEFA 2V4MA 2BR5A 2WF5A 3C98A 2O6LA 1Q95A 3LUDA 4B48A 3TLMA 4I50F 4XQ0A 4EB8A 1E1CB 1LZLA 3I42A 2F1KA 4Y9TA 4ARAA 1Z2CA 1QAQA 4F7DA 1L9KA 3ZY4A 5JPIA 1SBTA 2AVNA 3FY4A 4UEOA 1HV8A 1Q7GA 1QE3A 1V7PC 3L8CA 3W6ZA 4PSDA 5GVRA 4A0GA 3WAJA 3LYAA 4FHDA 1T0JB 3V7FA 1ZJJA 4IIEA 4KDRA 1EVIA 4G56A 4OHUA 4F8JA 2A9KA 4I4TF 1YGPA 3GPBA 1R15A 4UPEA 2I4MA 1IPHA 3U4MA 1U99A 3OWXA 2F4NA 1F5NA 3KSMA 4DR3B 1H4SA 4LXHA 1V2GA 1W0KA 2B78A 4XYBA 3OLXA 1E2PA 1R2QA 2FWRA 4ZHSA 3BD9A 1GPDG 4FX5A 1FFWA 4QUEA 2R2AA 4XWOA 1W96A 3RI3A 3EEQA 1QZZA 1RLMA 2H7CA 3D5EA 1DG1G 3FPHA 1RM0A 1BKSB 4BX8A 5JFOA 3I5YA 2VPIA 4IQ0A 1A2OA 2Q7XA 4JQYA 2Y93A 1QRRA 4FKBA 1JYFA 4X00A 3P0EA 1OREA 3ND9A 3K1AB 3ODPA 1AMOA 4OQMA 4PYRA 1OAKA 1XK7A 4J0CA 3LZCA 1JI0A 3JWEA 1XXHE 1Z73A 2CYCA 3PUIA 4LY3A 3ZU2A 2C7PA 2PUBA 1TLLA 4QRHA 5ALOA 2YY7A 3AUFA 3FVQA 3Q12A 5EGSA 2NTEA 3EHEA 1GDHA 3CIFA 1OGJA 2NU7B 1K6JA 4GC9A 4L9WA 4OIMA 4UUQA 3V2IA 1QPZA 2PCLA 4UBNA 1P5HA 4HAXA 1MFPA 1Q0PA 2ZSUA 3AEUA 4R16A 1A82A 3KQQA 4RWZA 3CEPB 2UYCA 3MGBA 3U3JA 2JKZA 1A76A 3UHPA 1CUWA 3R9WA 1P2TA 3UIEA 2IP1A 2XSZD 2JFYA 4WLEA 1CDZA 1IM2A 4O2BA 4WOKA 2L42A 3NC4A 2GLUA 3PNLA 2HT1A 3RVDA 4QUGA 1AHHA 3VO9A 4KU0D 3D3JA 4R1UA 5JDCC 5A2QA 3L0YA 3IEPA 1R5BA 3KCNA 4TMWA 1SA0A 3UQYS 5E3JA 1IBCA 1YK0A 3NPAA 1XSEA 3WL8A 5BRAA 5D85A 5T6MA 2JLAA 3N8GA 3HM2A 5D5HA 3MERA 4LC1A 3LW7A 2PRIA 1NRIA 4PQFA 1GKIA 2BE9A 1XN1A 2L18A 1GKKA 4D45A 3JSAA 2JIZA 2FSSA 3UBMA 4DMUB 2WAYA 3TSWA 1WF6A 1I4LD 1O08A 4AULA 4DJDC 3CLSD 3ZZ1A 2IH5A 3C87A 3AV3A 4KH0A 1BVYF 1VGQA 3VNQA 2DWUA 2A33A 1SU4A 1QH1A 2H11A 2R87A 5HKAA 2BF7A 3FI9A 1IHDA 4GF5A 5CYOA 1RAEA 5KYUA 4RCYA 1VPEA 2AEFA 4LSZA 4N48A 4GSKA 2COUA 2XH8A 3CKLA 4IQ8A 1F1BA 4IVQA 4TZTA 3VR3A 3SMVA 2CUNA 3SC6A 2KLHA 4K46A 3K0FB 3ULKA 1C3LA 4BO0A 4XX0B 3FLEA 1HZZC 4EKDA 4UDNA 4UQLA 2AYXA 5E6SB 3FTEA 3SFVA 1D1QA 4HDQB 1QS0B 4MUMA 1BA2A 4ER0A 3BSWA 3H2BA 4V38A 5ESXA 3LRXA 1Y4AE 3WJ2A 1H2HA 5KOYA 1QZTA 3N2KB 1A9RA 2J7PA 3DOOA 1C3OB 2VDNB 2Q3FA 1XZMA 4LDPA 2YW2A 4R2XA 5BQOA 1GR1A 3ZDFA 3I37X 4UXHA 2Q3BA 3IEUA 4GXQA 5CXQA 2IELA 4LYFA 5LWQA 2ZSBA 3B3JA 1AKYA 3A6DA 3HBJA 1KPHA 2AKAB 3R9KA 1KH3A 2IVZA 4A3SA 1JQLB 3SBXA 3NIDB 4ZZ0A 2IYRA 1K8XB 4HDOB 2EFGA 1JZSA 1VZ2A 1O4WA 1FFGA 3A1VA 1CSEE 2DPMA 3PXEA 3DV0B 4LOAA 4UHDA 5A04A 1SCNE 3RRFA 1GTZA 4YAIA 3R6LA 2W6JA 2UZ1A 2HAEA 4TL7A 3L49A 1T5OA 5KTMA 3LUKA 5K3CA 2X1MA 2H0QA 1RYBA 3GJYA 3HJTA 4IV0A 4QFBA 4CIXA 1EX6A 1Z82A 2HTEA 1FFHA 4RK1A 4ON9A 2AX3A 3RU2A 3NHUA 4TUYB 1YDHA 2RIRA 1A1SA 2ZUWA 1D3AA 1TD1A 3D9QX 4GECA 1P17A 1WBJB 3R4VA 1M1YE 2EJVA 4ENTA 3P27A 3KIPA 4I1IA 2J33A 1BDMA 5BT8A 5JTTA 1Y7TA 5C8XA 4RNCA 4CKBA 1VPVA 4RL4A 4JGGA 2IZOA 4PU0A 4I99A 1YF3A 1QP0A 4XPIA 1DQSA 3AL3A 2C8KA 2Y3IA 1JRLA 4KXXA 2GFIA 1DV2A 5K1ZA 2LW7A 1O8BA 1SQGA 1NOIA 1K9VF 3FSRA 2XA9A 5JO0A 5DZSA 2EJTA 1YB1A 2J0UA 3C2QA 2QTMA 4DJTA 1XFDA 2J3KA 2C8JA 3EXG2 4Q4AB 4GVLA 2QI9C 4D9FA 4I2NA 1ISSA 221PA 1U0EA 3AEZA 3KQHA 3G2KA 4Q02A 3ZK8A 3Q8LA 1LPOA 2PKXA 1ZI8A 3BZBA 4YXWD 4D8XA 4QU9A 1S8AA 1BE0A 4KOAA 1UBKS 4NOLA 1PYDA 4FGKA 4LGVA 4HQ0A 4Q1DA 4NESA 1FYFA 2L17A 4XUDA 5K3SA 4DZTA 4F6RA 2SHKA 4L8WB 3SYTA 3VKFA 3NXSA 2V3CC 3IT1A 2B35A 4WACA 3OA2A 1KR5A 3EW9A 1SMKA 3TTYA 4UE3S 3DQZA 4ENQA 4L5AA 5KNLA 4NJOA 3OG9A 4MQ6A 5DTQA 3B1JA 1E2KA 3LWBA 4DMLA 5IEJA 3M7IA 2EKQA 4X71A 3FZQA 1OV4A 1KJ8A 3WWOA 4BBZA 1CXZA 3V6LA 5EJFA 1NRWA 4YYEA 4LCEA 3HB7A 4IFTA 1QONA 2ZW9A 1XLTC 2H4FA 4JLMA 4DLWA 2CVQA 4I1YA 3ZKWB 3D4PA 3M33A 1G64A 4Q1AA 4Z4HA 3CVYA 1LA2A 1HSZA 2LVBA 2OD2A 1XMQB 4BNKA 4RGBA 3GA7A 3BXEA 1A7AA 3A4TA 1Y1QA 4HFMA 4R9RA 2VEOA 4B74A 1HMPA 1P81A 3ADOA 4I8XA 2HU7A 3H6GA 2ZTMA 3GGGA 3UJ9A 1FLAA 2QNBA 2Z57A 4FFBA 5C8YA 3TYXA 1P9RA 3HB9A 3NOOA 4WV3A 3DFFA 1SHKA 3Q88A 5JLJA 4O0LA 1Y4UA 3JYNA 2PZLA 4ARBA 3DM5A 2IHYA 3ADKA 1TAGA 4Q9JA 4BWFB 4F4IA 5ETJA 4FQ8A 1U81A 4BNJA 2BGJA 2J0EA 1B3BA 2NXCA 1MX9A 4K9SA 1Q57A 2O3RA 3IOYA 4O4HA 3GVCA 4R7ZA 5AI9A 3N0WA 4FFMA 4K6OA 4IOKA 4CKCA 4CL0A 3KPYA 4KKXB 5IMBA 3T94A 3G9QA 3LBIA 1GPJA 3ZVLA 5B3LA 1DCKA 1TM7E 4F5DA 2EWVA 5JG7A 2D7JA 1ZK1A 4GI5A 4R9NA 3I1JA 4CCYA 2EC5A 1R6DA 2P11A 3UAYA 3ZIDA 1H94A 4WOCA 2VHXA 4G9EA 3DXZA 3NHKA 3M1LA 1ZD3A 4RD1A 1E5DA 4B9EA 1Q1AA 5IEBA 5J9FA 3R5XA 2VKTA 3DFZA 3LL4A 4LNAA 3OF3A 2B20A 1W59A 2B8WA 5JQGB 5CFPA 2ZYSA 1NVEA 2AT1A 2AR7A 4B6QA 4WY8A 2ZUSA 2OGSA 3NRBA 1SVKA 4HY3A 2PSDA 5C37A 5AI4A 1WAMA 2Z5GA 3PL5A 3P0FA 4TN5A 3NIFB 1ICIA 1XU4A 3H1FA 4B8YA 2BCGY 4HQLA 4S24A 4XSGA 2WWGA 1BVRA 1T9AA 1TYCA 1X77A 2A3NA 4LWPA 4G0YA 4HG2A 1RYZA 5LL6P 4IS3A 4UULA 3WQSB 1DBVO 2MSCB 4RS3A 3U31A 4AUEA 3B6JA 1NVXQ 1SN7A 3GAMA 4U63A 3O8DA 1SPXA 3K0AB 1CHDA 1YVEI 3KUCA 1I7PA 3IMEA 4BNUA 4JBLA 1ORIA 5BN5A 2A0UA 1P2DA 5L3SB 3A9WA 1HDOA 2DPGA 2BEVB 2R6CA 4NBLA 5L7YA 2ZE5A 2FFQA 3DAOA 2UV8A 4FGZA 4JP8A 4DIEA 5AI0A 3AG5A 3TEMA 3V97A 2Z2IA 4J0DA 4WZAA 1TW3A 2Q2WA 4GXTA 4CLRB 3BWVA 5KTSA 4N6NA 1QHHB 1KFKB 1ZD2P 3EOAI 3ETDA 1ECPA 3HA5A 2ERXA 4LJAA 3RO7A 2YIJA 1GTG1 2V7GA 4G0XA 1UWKA 3E0XA 1JIKA 3FCSB 1KK2A 1B2LA 1RQGA 2LWIA 4MMXB 2JAXA 3D1JA 5ISMA 5F5LA 1BGVA 3STYA 3GDHA 3OC0A 4ZIRB 3ONNA 4DREA 1T29A 4L1KA 1JIJA 4C3OB 4JU9A 4G24A 1IY8A 1L7QA 5JYCA 1V0JA 1V43A 4OF4A 5BUQA 5LQDA 3VZRA 5C32A 2JAOA 4G0NA 3FPLA 3KBBA 2X0IA 5E3IA 2EHJA 4LBZA 3S7TA 5AHOA 1FTGA 2B4TO 2OAEA 1X1AA 2QT9A 1RXSA 3H2YA 4FMBB 3MELA 4W9RA 2GNAA 4BLRA 4C4TA 3KWJA 2OHFA 3LYHA 2QD1A 3U0BA 5JH7B 1NAHA 1JR6A 2JHAA 2G4CA 3DVSX 2BDTA 4HWGA 4Z6KA 5BR1A 5KNBH 5K2OA 3K32A 1HURA 2VQ3A 1LBEA 1XZAA 1TVMA 2ZIWB 5GZ3A 1J70A 3LYLA 2QORA 3WQHA 3RUHA 2GM9A 1OU4A 4WVFA 2GCOB 1US8A 3AZQA 3O75A 5CH8A 4L6AA 1HEUA 3CWQA 1HE2A 2EERA 2JQIA 1ZYUA 3PC7A 1Z6ZA 1I1OA 1N2EA 4BUJA 4WXRA 2X3YA 3GUHA 2MSKA 5JXWA 1E1CA 2H00A 2WNIA 1JSCA 1RRVA 1Q2UA 1FA9A 3V4FA 3N3AC 4AZTA 3CNLA 1R8JA 4Y6SA 2DBQA 2PR7A 4Q66C 1G5PA 2R6HA 2ZJ1A 3EZNA 3G8AA 3IESA 3IPCA 4G0VA 3GGDA 3OAAD 4BMYA 1QDUA 3DH0A 1JJ7A 3E7DA 4UVIA 3TRDA 1E3IA 3OJ0A 3ZXYA 5HZMA 4BO2A 1QU5A 2FSGA 5HIKA 2N1BA 1XJCA 2ZVJA 3AI2A 3IB3A 1FZQA 5EN4A 4DMCA 4FZVA 2FZVA 2BUCA 1EFRD 3PNYA 1T5IA 4E6PA 3DEKA 2B94A 3NTUA 5CB0A 3WV5A 2BSAA 5REQB 3ZU5A 1KOGA 2JIQA 4NNPA 1QTQA 3JWHA 2J45A 1PKXA 2QTWB 2GSWA 4ZEOA 3EXG1 3MOIA 1JF8A 1HDRA 2UAGA 4G0QA 1OROA 4DKJA 1WCXA 1BCSA 1RYMA 2D59A 1UHTA 1NNSA 3DAHA 3RUFA 3HY3A 5AD1A 1RJEA 3ZHRA 1RHJA 1UWCA 2MIIA 2A4KA 3P7MA 5G0SA 3DTYA 1O3YA 4MUGA 1RCUA 2VYCA 3H1BA 3AR8A 5IUNC 3S8YA 1N1MA 1S9HA 4XM1A 1NU8A 4BNGA 3SE7A 2COEA 3UHAA 1EFPB 5I5EA 1R10A 3DITA 3GARA 1E2IA 2G3YA 5LKAA 1DAIA 1IIBA 1OFVA 4HNAA 2WWRA 4NE9A 4XD7A 3ZGXA 1N2OA 1V5EA 3A70A 3FXAA 4D6YA 5E6UB 5HK9A 1P7VA 5FLXA 9LDTA 4ER7A 3ZHYA 3EY4A 4R3UC 5LM3A 2FMFA 4MWCA 3U9SA 3WWEA 4UD6A 3REFA 4M1MA 2OGZA 4XCXA 5BXQC 5ABPA 4KXLA 1MO5A 3LGAA 5CA1A 3F3YA 2WYUA 4X95A 4P4UA 5FLYA 4F6LA 1N5IA 3HJNA 4W9MC 3C3CA 4ML3A 1X8XA 5JR3A 2FN8A 3H5AA 1NX6A 3JQFC 1QQ5A 3HDGA 2VHYA 2TMGA 4RIIA 3ZJ5A 2Q3CA 1TZ2A 3C6KA 2QAGB 1L4EA 1LVGA 2EDCA 3EZ6A 5BYKA 1QH9A 5IX8A 2XBMA 1OT5A 3BE4A 1YZYA 3WWYA 1SHUX 5ARBA 3IAM6 1QLJA 3QE9Y 1OW3B 1Q84A 3FWKA 3HI6A 2IHBA 4IY1A 3Q9UA 1VPLA 4NBNA 1UJBA 1YS4A 3RS2A 3ETCA 4ENVA 3BMXA 3GLSA 3Q7PA 1X80A 1KY4A 3CF4A 1NU6A 2AOUA 2E55A 4HC4A 5FPPA 2FFBA 1XK6A 1X1TA 3HQ4O 2GM3A 4OMDA 4W63A 4ZXFA 2FDRA 2QJTA 4S04A 3EWNA 2YWBA 1OXXK 2C59A 2ADMA 2XNSA 3AVQA 1XPRA 1SOMA 4OJKA 2PIEA 2J67A 4NMHA 2JZOA 4RPGA 4QBTA 3CX3A 4QIHA 3QU2A 4BNZA 2AJLI 4FHZA 5CUQA 3T1TA 4MV1A 2IYOA 3G23A 5LNK6 2CLFB 2Y6VA 2I34A 3EA0A 2B8NA 3OZBA 3RTBA 2W42A 4X0EA 3WFIA 2ACWA 3ELSA 2G7MC 1DWOA 2I3BA 4ZDWA 2ORYA 1XTZA 1A4XA 3SDZA 5HQ3B 3HHEA 5DYYA 3I1IA 3N0XA 4HZGA 3BXOA 5AM0A 1PT7A 3MSXA 4KYUA 5K7SA 3ENQA 3IR6A 4LRWA 4OJYA 2XZDA 4W4TA 3CIOA 3VR4H 4BC0A 3KZ1E 5F9FA 4NYMR 1OYVA 4HWOA 3UWSA 2H48A 2GI4A 4ZVUA 3EPLA 2HRQA 4FM9A 4PW0A 4U6QA 3QLUA 3INNA