3V8MA

Crystal structure of nad kinase 1 from listeria monocytogenes in complexe with 5'-azido-8-bromo-5'-deoxyadenosine
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
257
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 72
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8mA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8mA01
2I2AA 2Q5FA 1U0RA 2BONA 2JGRA 3V7YA 3AFOA 2I2DA 1Z0SA 5DHSA 5DHTA 4WERA 3V7WA 5DHPA 5EJHA 1Y3HA 4L02A 3V8NA 2QVLA 1Z0ZA 4HAOA 4V24A 2AN1A 5DHUA 3VZBA 5DHQA 3T5PA 2I1WA 2QV7A 1YT5A 2I2CA 1Y3IA 3V7UA 5DHRA 2P1RA 3PFNA 1U0TA 4DY6A 5EJGA 2I29A 2I2BA 1SUWA 3VZDA 3S40A 2I2FA 3V8MA 3V8QA 5EJFA 3V8PA 4WRRA 3V8RA 1Z0UA 3VZCA 5EJIA 3V80A
chains in the Genus database with same CATH superfamily
1U7ZA 3GLIE 1ZL0A 3ADPA 1KI7A 1H2WA 2EZ8A 2Q27A 2QD2A 2G08A 1TXGA 3EGVA 2OAQ1 3EHDA 3OJXA 4OGWA 4OMDA 3GAFA 4L50A 1CNMA 1L3CA 2FA9A 2MDTA 1DKOA 3FXAA 4RH1A 3TRHA 4CMEA 1A2OA 3DTVB 1E2JA 4AD8A 4MQFB 4KZKA 2W7TA 1VL8A 3NOQA 2XQVA 1T10A 2XE8A 1K6XA 3MIZA 5DHRA 4R3UC 2XY4A 2B25A 2O8CB 4WJLA 4S35A 4OLBA 2Y05A 4ZVPA 3D5TA 2CLKB 1J4LA 1Q12A 2ZJYA 4Q03A 2XMBA 1RYYA 2HW8A 3G9ZA 1G1MA 3FFTA 1MO3A 3QPWA 1H0HA 3KJHA 4CE6A 4OQNA 4ARUA 4ZCTA 4DEYA 3U4MA 5KTRA 1JT2A 2FF4A 5IZCC 3EOAI 1LU9A 1HDEA 1W4LA 2V9CA 4ZK2A 5LFAA 1K3JA 4NOLA 4CCWA 3I6BA 4FM9A 3R8CA 4NXNB 1MHPA 2OUIA 4DV6B 5JAZA 4NHOA 3K4QA 4FK8A 4QU8A 3OQMA 3T7RA 3WKAA 5JRDS 3WGHA 3IUNA 1EBUA 1LSSA 2PJZA 1H2AS 4IH9A 1K97A 4AZ0A 3A7DA 1P7YA 1L5QA 4INPA 2A9VA 2QW8A 2VUTA 1P5RA 3VPSA 2OM2A 5EIOA 3V4SA 3R2JA 1HR0B 2FSFA 4MR9B 3M0EA 2OCIA 4QZVA 2O50A 3AF5A 3IUEA 3L1VA 2Z4SA 2HWUA 1KZ4A 1E3SA 3G89A 4IJUA 4TYMA 3VDMA 5ALUA 1E6WA 3IAHA 1ETUA 2WJ4A 4R2IA 3IP1A 3AEQA 2AYYA 1X3LA 2W58A 3O1JC 4L5IA 2EP5A 3IVXA 4P2BA 4YCMA 5JTTA 4N5MA 4BVEA 3TBHA 2ARKA 4H0CA 1YKSA 3D3NA 4H3VA 4WCDA 5T4EA 4YR7A 4F5YA 1CD5A 1GRQA 2GPWA 2LCIA 4G5FA 3ECAA 4LIPD 1MJGA 2PKYX 1CUWA 2XVZA 3IMFA 1L5KA 4X6XA 2I8CA 3KD2A 5CH3A 1AHPA 3I72A 2YZ7A 3DC7A 1Y63A 4RZXA 3U4QA 3R44A 4HZIA 1A8PA 1WHSB 3HUUA 3EY9A 3KYCB 3U7HB 3AVYA 4QU5A 1ZBDA 3OP4A 1EX6A 3WZMA 3FZYA 5FAKA 1HLFA 4S0ZA 1U2EA 3ER8A 3JY6A 1FXSA 4PRLA 5H16A 1O6ZA 1P4GA 5JU6A 2O8EB 1VSUA 1H6AA 3AETB 1T24A 3DMRA 2ZS9A 1OBHA 1JN0A 2ZQYA 4FHGA 5IW8A 3F71A 2ZUSA 4G1CA 5CAEB 1JDVA 3BIJA 4ETNA 3P4UA 1HX7A 2WJJA 1C3XA 1U2ZA 3KKZA 1KMHB 1QQAA 3GB9A 1YDEA 4KV9A 5IRCD 1FNSA 1RJEA 2OZVA 1TMOA 1C9YA 3EEFA 3FGOA 1ZN8A 4GMHA 4OMCA 1KOLA 3SC6A 1YRYE 5IN5A 3M3DA 3OMWA 3KEMA 2HJGA 2HQRA 3BJEA 4INAA 2H3HA 2PZKA 1RYNA 2NSDA 3AR4A 1RAGA 3DFZA 4X94A 3ZX5A 1FOEB 2C9ZA 2Y76A 2I8LA 3IFSA 5FJJA 3QTLA 1FXWF 1E18A 3BWMA 4LOAA 1GNPA 1ECLA 3BULA 1M8FA 1U4NA 3B70A 3JASB 5T57A 1W4CA 1LVHA 2GAFA 2RAUA 5HG0A 4AY3A 4P5DA 4RVSA 3L0PA 2NXEA 5FOVA 4PZLA 1DAIA 4QUEA 5DASA 2P9GA 2VKQA 3BK7A 4CCSA 1I6MA 2OBLA 1DOHA 3SC4A 3VI3B 1U9ZA 3H5VA 3WMGA 1ZZGA 1A2BA 3G5UA 3OFND 2AN4A 1ESCA 1H93A 1EIZA 1Z0ZA 3BL8A 4UEKA 2EBUA 1T5BA 3PNSA 4YP1A 3ZCSA 2IHUA 1RYDA 1UK9A 2DPMA 3ZS8A 2C8LA 3IPLA 4HNVA 4OFBA 3QGMA 4E2ZA 4YJFA 1F5NA 3U9TA 3PL5A 1IY2A 5AOVA 3IUYA 5CEJA 1PFYA 1SG6A 5JCOC 4XFKA 2QT9A 2H07A 4NYMQ 1A77A 5JEKA 4QASA 1KJWA 2XI4A 5B3JA 1UXIA 1Y4SA 3CRZA 3WWDA 2DKOA 4YVFA 4BJ3A 5DP1A 2RB5A 1UF9A 3D3KA 3CLRC 2FP3A 1TD9A 4EW3A 3QVJA 4NDAA 4HS9A 3WMEA 3LHSA 4M9UA 2JD0A 3ETGA 5H83A 5KVQA 3UWMA 3H7AA 1XCMA 3SZUA 2DY1A 1OZHA 5DM60 1JYSA 2OC4A 2Q3JA 3B1JA 3LQYA 3FFBA 4B17A 1KQNA 3YASA 1QP0A 2BHTA 3PPIA 4RQTA 2QX6A 5E6UA 3E9MA 5FI3A 1CXZA 5SZJA 2R25B 5I6DA 1XA0A 3NGLA 1YDGA 1EFTA 2VUHB 3QHAA 2P77A 1F14A 3ENNA 3HZOA 3V1MA 2Q6LA 2GUWA 1K2NA 4A16A 4B87A 1N5OX 3HFRA 3KOXA 1JIIA 4ER0A 4KQFA 1KGSA 4IR7A 1RQNA 1J2JA 2R6R1 3NBMA 4X3CA 4BJ5A 1H4TA 2XCLA 4G4JA 3WO1A 1J7JA 3OJFA 4MCHA 4XX1A 5ITVA 5JZMA 5LP1A 3M6XA 3GMJA 1WBJB 3K20A 4PG8A 4RK6A 3IBYA 4WN3A 4RL6A 4BKOA 3AL3A 4DBVO 1WPRA 3PUZA 4E1VA 1V7ZA 4AY5A 4M1WA 3K4HA 1K7SN 1VB5A 2V9ZA 4JEMA 3FSEA 1A5SB 3AUYA 1X8LA 2P9TA 3I37X 1SC4A 3PGVA 3A36A 4LHSA 3I6YA 4MYRA 4QGFA 1W73A 4H2DA 4UNPA 1IEXA 3FVQA 3GLHB 1RMTA 1ODFA 1PDVA 3IYLW 3VO1A 1J24A 2QMEA 2PUWA 1U28C 4RC9A 1TJPB 5AVWA 3TMKA 1QVAA 1ZA2A 1XMXA 3R24A 4UCQA 2ERCA 3VM6A 1TF7A 2OXTA 4ZT5A 4N3NA 1OYVA 2DWPA 4BN0A 3CVUA 2PJRA 1R8QA 1WV0A 3QVLA 3HJCA 4MB0A 2EHJA 3GL9A 5M3BA 4CTNA 3NHJA 4H1WA 2AHOA 2IT1A 3DFMA 1EUZA 1OLSB 1CF4A 2B1GA 1A4XA 4DWVA 1NF3A 4TYQA 4CF3A 1N2BA 2RMKA 5E3IA 1R6UA 5E4JA 1DHTA 3UENA 2PGNA 2HKIA 2H2IA 3UVEA 3SE0A 2L69A 3SKYA 5JAMA 4RSHA 5AESA 1ABBA 3KB6A 5G0UA 3G9UA 2AGVA 4C7MA 3KDAA 1CJTC 2Q29A 1GCUA 1P7ZA 3M81A 1JEJA 3T3OA 1BH2A 2IYSA 1P9OA 5ETJA 1U7VA 3KLBA 4KDFA 4YJ3F 3IS3A 4Q7JB 3M1AA 4CIBA 5EZYA 3R8FA 4KR7A 2PS0A 2QL6A 1DT3A 1KJJA 2QUKA 3SSOA 4WNYA 1JG4A 2FK8A 3ZDRA 1DEVA 2I65A 3IIEA 1WQ3A 3ZX4A 2AS0A 2IX3A 4KQXA 2RGXA 2IY8A 1R6TA 3AY6A 3ELUA 1UBFA 2DJ5A 2NPOA 4C0BA 2BM9A 2VYCA 1NG1A 1EUCA 1I7LA 2QRLA 1IZ0A 2ZTHA 4MPRA 5H0IA 3SM9A 5JPCA 4F8EA 2IBTA 4ZYXA 1D0VA 3L79A 3VR4D 1DKNA 1LDGA 1ZOLA 4IO1A 5T64A 2PMWB 3TG8A 3PE4A 1W46A 3HDHA 4QUDA 4EGCB 1OI4A 2W00A 3K8YA 4CT5A 3TTVA 5JS7A 5LU8A 1FNDA 1NBME 2XDYA 2QRKA 4FFSA 1UAAA 3FVRA 1HL7A 5B2EA 3FNRA 3ON5A 3O8LA 4J0IA 2X76A 1JEAA 1O95D 5L9AA 2J30A 1P7CA 1RHRA 4C04A 1LJ8A 2F8TA 4ZI2A 1HT3A 3T5CA 3GZNB 3GIWA 3K9LA 3K6KA 3PNQA 4KWIA 3LHFA 1C8VB 4HFRA 1JKJB 1WJGA 5SV2A 1VHTA 3T0IA 2AEEA 1E58A 2A33A 4NFSA 4BNGA 2CLHB 3G59A 4HPXB 5D86A 2NZUG 1AA9A 5C1BA 5J2TA 1ONPA 2FWMX 2JIDA 7REQB 5K0CA 1PR5A 1PEAA 4C89A 4KYIB 2XQIA 2W0SA 1XYGA 3RLIA 1X92A 2WSSA 1G7RA 3G88A 3QMMA 3T1HB 2ILVA 4AN0A 1D07A 3DZJA 1BMFA 1A9XA 1ONSA 1QGAA 1HXHA 3LCRA 5AOBA 2AR9A 1KBZA 2BZ0A 1X42A 2WM9B 4GICA 5IARA 4D46A 3V8QA 1RC0A 5FEMA 4XCXA 4AG3A 4CUZA 2DTDA 4HATA 3TFWA 1T3ZA 4DQVA 2OM6A 4N48A 1RXIA 3JWPA 4IW3B 4Q3AA 4CFYA 3LBFA 2ZBGA 2UVPB 3D6HA 4FFLA 1XRQA 1MC8A 3D6AA 4IDOA 4C7XA 1GYQA 2C54A 2VDUE 5FL3A 1IXYA 3UC9A 1UDWA 3PIIA 2O6HA 5BNIA 4NNJA 5JVDA 2W2NA 4X24A 1K8XB 2IZOA 3UAOA 2EQAA 2PL5A 2F62A 2YRWA 4EELA 5DI3B 2B3TA 3OZFA 1DIAA 2HGZA 5EUBA 1HURA 4JT8A 4KO8A 2ORYA 4ZRDA 3K9WA 4HNQA 4FHCA 5C1DA 4JH0A 3ZDZB 5F7JA 4BFZA 3Q9LA 4Q4JA 3NRBA 1EH5A 3EVEA 1LC3A 2BTQA 3ZHXA 3ZJYA 3S8EA 1SZDA 3K70D 2G6BA 1V1RA 2Q9CA 4C5CA 2E7ZA 3GFGA 4P7GA 4RE6A 3RS9A 4ERXA 1EX7A 1O89A 4N3BA 2MSCB 1OAAA 4JBIA 4DV5B 3ENKA 4IGAA 3KKLA 5H81A 4U6QA 5GONB 5ECYA 4UCWA 5CJJA 1Q1NA 2KBFA 1P5FA 521PA 1K2MA 3SYRA 1YB7A 5FT9A 4C0HA 4E03A 4J1TA 2E1RA 3GA0A 1W47A 1YO6A 3DF9A 1TVKA 2PDAA 5HJ5A 4Q47A 2Y6VA 3V7UA 3NKVA 5EHXA 2PCLA 5CA0A 1KTIA 1N7GA 3LCVB 3HSKA 4DIMA 4EG3A 3TD9A 3MERA 3N2GB 4GKKB 4WCFB 2XTMA 1I32A 4LF6B 1RPZA 3UNMA 3H9EO 4MIKA 4TSFD 4X00A 3VISA 1BMQA 1NIPA 3CZ4A 3JD3A 3G2OA 2J07A 3QPCA 4FEEA 1U2DA 5FWXA 2NUBA 4V0NA 3CY6A 2O2HA 4B4WA 3AILA 1MD9A 2AB0A 3VSDA 5JZ9A 2P5YA 4YJGA 5B4TA 2FY8A 3HYSA 1OFUX 2FQYA 4CIWA 221PA 2P5UA 3MCVA 3E5HA 5LCXA 3NIWA 4OK5A 3AT1A 4QQKA 1W76A 1T6NA 1C8BA 1I4DD 4II7A 3EUFA 1N4AA 3QY9A 1KJYA 1O77A 1V5FA 1M7BA 5EJGA 3OOSA 4YRNA 2ZJ0A 3CWZA 2NZXA 4YJ2B 4EK9A 5IJ0A 1OBVA 2OB2A 2X0JA 2F3RA 4PFJA 3CEPB 3FCOA 3IXMA 2YZKA 3D59A 3N87A 4HMOA 3JALB 3KZOA 3BSFA 3ETCA 4JMPA 1KK2A 2R1UA 3CLVA 5E2AA 3RW9A 3QE2A 4F86A 4A6PA 1C1YA 3ASVA 4H9GA 1I7QB 4M1MA 3A1UA 1NBOA 5T4FA 1Y8ZA 4R01A 1G9SA 1SURA 1UEXC 3VC1A 1GXCA 2MMGA 1UWCA 4QNNA 3E9NA 4N39A 4ZDKA 3JYPA 1A4RA 2CFTA 2ERYA 1L5WA 3DTYA 2O06A 2R8YA 1EFPB 3IGFA 4K9PA 1GNRA 4P98A 2GXSA 2IHVA 4F5WA 2FMUA 3N8DA 4JKYA 3VPYA 1BMTA 4BFTA 1YOVB 3S5UA 4UUBA 4YGXB 1EWTA 1YDFA 1COWA 3AB8A 1ZOSA 2H4YA 3LA8A 2YWGA 1YV9A 2O2YA 3MWDA 4RSMA 3C0KA 1F60A 1CYDA 4HH0A 4EHNA 5AW2A 1TJYA 2PX5A 3HGQA 3MWJA 1MOQA 4R1UA 2HIHA 2V74B 4G26A 4IEIA 3Q6NA 1SK8A 5AIAA 1ZVMA 2Y6UA 1IIBA 3DB1A 2VPTA 2A5LA 5DX1A 3RVMA 4AJJA 2QJTA 1FB5A 1I13A 4V0QA 4EL0A 3IAS1 1C7IA 1S2NA 3QE0A 3ESYA 1ZR4A 1QTNA 1DPFA 3E7PA 1ST3A 1TAHA 1J0CA 1UDAA 4MQ4A 4KWHA 5JPDA 5AW4A 5FUVA 4UD2A 1L5SA 1T5TA 5EYPA 4AJ2A 1XAJA 1Y3FE 1LQTA 1Q7RA 2EDCA 2OK7A 3KT3A 3KZXA 3U3OA 1Y89A 4KB5A 4D41A 2D7DA 1T1JA 1UBTS 4M0EA 4CF5A 2JAUA 1H9CA 1SC3A 4Q93A 3FGNA 3RBXA 2PH7A 2VDKB 3G0DA 4KQGA 3FOFC 3GJZA 1XROA 1Y34E 3STYA 1WDLA 4CM4A 4WZAA 1PT5A 3AUFA 2F1HA 3AHEA 3AM5A 2JIZD 1T5OA 4PO8A 4RHTA 4WFKA 3H2IA 1H6CA 4EG0A 4GNKA 5P21A 4HVCA 2VDJA 1ZI6A 2EH0A 3O4VA 5AVVA 3EVGA 3QXHA 4POAA 4PX5A 2P79A 2RHCA 2IYQA 2Q5FA 4KQKA 3L4SO 1T36A 4R54A 5BN3A 3ZDBA 1POXA 2O3QA 4GXTA 5JG7A 5J4KA 5HMLA 4JSRA 3QF7A 3V1UA 1YR7A 1ZIXA 1HBJA 4HWPA 4KKXB 3UA3A 4ND4A 1I30A 3VOSA 4PIMA 2HLHA 3C3PA 3WFJA 5JJBA 1J1IA 1QORA 2YIVX 3ETHA 1S2OA 3OBIA 1KNXA 1AZTA 1YQDA 1L7XA 1USVA 2NNLD 3EDCA 2P9YA 2C2GA 1P6XA 2B6HA 1CUZA 1Q0RA 2NMVA 1AKNA 3TSWA 1UFVA 4CKBB 2OV8A 3ELDA 3I9OA 4NS1A 2GHTA 3BGSA 4FMCF 5AKGA 3B5IA 4OHZA 1F4PA 1WMSA 1VTKA 3LLVA 3DO8A 1LDNA 3ZGZA 4JI7B 4DRZA 2ODQA 5IEBA 3NWEA 1SM4A 2IZ6A 4RVNA 3DZHA 5ALDA 4ENTA 3I1JA 2PTGA 4R6XA 4ZI7F 3DQPA 1HDXA 2OBNA 4I55F 4EZIA 3QX7A 1P80A 3WAKA 4RHYA 2SHKA 3DOFA 1Z5ZA 3CX8A 3JVEA 3NTOA 1PTKA 5ALGA 4J16C 2C03A 4R69A 1QQ6A 4AO8A 4BX9A 4A0GA 4DEVA 4RABA 1G18A 4YP5A 1BXRA 4FOSA 3F6BX 2LZ0A 1NSTA 4TKMA 1NW9B 2HCRA 1DQZA 3WGZA 1NLMA 2WYWA 3FR8A 3TEMA 3FTCA 1RWXA 4IZ6A 2BKAA 1ODCA 4MITA 2WA2A 1PU2A 3F6RA 3LT0A 5LA6F 2C7RA 1YFZA 2GK4A 3AEUB 4KPUB 3L7NA 2TSYB 2YJ5A 4PV7A 4XLLA 5TVKA 4LF5B 3PHLA 1KE2A 3OZDA 3GU3A 2OBYA 3IUQA 4PSKA 2A3RA 1PYOA 3TLMA 5FOUA 3G17A 3LZCA 2ACEA 3K32A 1CQIA 1QIIA 2JCVA 3JD4A 1T8WA 5I7EA 3OT1A 4TTRA 1NI3A 1V96A 1RE1A 3LOUA 3U0VA 3W7BA 3DPSA 2HTEA 1EFRA 1MIOA 2PRSA 2ZIFA 4Q3BA 6PFKA 2HOQA 3OZCA 4NP6A 3WWCA 4POOA 3GUYA 6REQB 3U7GA 4LHXA 5KYWB 2A94A 3ZZ0A 4U0JA 4DT1B 3EIOA 3C1UA 1LI7A 3N3BC 2JJMA 3FLEA 4B1FA 4MVCA 2MYPA 4NK5A 3IL2A 3JQEA 2RE8A 2D0DA 3SQDA 2H1CA 1WMAA 2C95A 4QPPA 2NUAA 5D3MB 5EE5B 3ZWNA 3PQ2A 2H7CA 3T7KA 1W93A 5ULLA 4DNQA 1MORA 4D0GA 1DFIA 3DBLB 3P94A 4J6EA 5EQFA 2OHXA 3RWMB 4EENA 5C7LO 1FC0A 2HK7A 2P2GA 1PWYE 3IQHX 2XKJE 4ND7A 3JWIA 3QVWA 1PI3A 2H06A 3IE0A 4EY8A 3TKLA 1Z25A 3H5WA 5G41A 1Q92A 1ZG3A 1CZHA 2XUDA 4QXAA 4BECA 3G2NA 5KOYA 4GP9A 3DZBA 1R0SA 2AOXA 3A9SA 3V3TA 4QJ5A 3S0JA 3KV1A 1OWOA 1JNXX 1AK1A 1E1CB 3IV9A 2R9VA 4D3DA 1XZQA 3ECCA 1DTWA 1YQTA 1E0JA 4V02A 5EUMA 3ZDYB 1EX9A 1JFLA 3FR7A 1N5IA 2ODPA 2X0FA 5KVVA 4GOND 4A8HA 4BMZA 3WGQA 1E2PA 1QXSA 3AUAA 3FI0A 1EZ4A 3KVRA 4QEKA 4EARA 4EWLA 1N36B 2EBHX 1U3CA 2H4FA 1DGQA 2EF1A 2IELA 3L4EA 1FRVA 4P0TA 3N39C 3WDSA 4RDCA 3SVTA 2QTTA 2QTNA 4FYPA 4XB1A 2ONZA 4BATA 5FI1B 2I7DA 2BGLA 1V6SA 3I2YX 4L8FA 1Y82A 3GOQA 1Z68A 3ZWWA 3IESA 1E2HA 2OMKA 3KUDA 2CVZA 2JAPA 3DTTA 2BLLA 3GFPA 4FBMA 4ZOAA 5HQ3A 4JYZA 3BRCA 1NT2A 1UXOA 1VLVA 2IPXA 1S3GA 2P62A 1HI9A 3H13A 3RC8A 1FJ2A 1G8JA 2HIMA 1BCRA 2LKCA 3ZNNA 1WXIA 2E6KA 5CNJA 1FW6A 3CNQS 3AY0A 3IKTA 1Z7EA 1NUHA 4FYXA 4GVPA 2GESA 2QY6A 3SNKA 2VQ3A 4UPVA 3RTGA 3SC3A 4G5RA 5AKEA 4KXYA 1NW6A 4WZBE 3WLQA 5BWBA 3DKIA 2IIVA 1B7GO 2DR0A 3SF8B 3JAKA 5E9JA 4B43A 1XZCA 1ZNWA 4MYUA 1XFDA 4LF9B 3H1PA 4IJMA 5EJAA 2O8DA 2ODBA 1MJHA 1NVVQ 3SQOA 5A2QA 2AN1A 1ADJA 1F0NA 2BFCA 5EJEA 1XDBA 3TJRA 2VPXA 1KEVA 3MRVA 4RTMA 3U61B 3L6OO 5IAOA 4RS3A 1OE0A 1Y3CE 2H6EA 1XNGA 3CSDA 4YIHA 2ISSD 2VHZA 3QHPA 4JBYA 1G4UR 2PH1A 3MMSA 3NVDA 4MVJD 4DIUA 1KI1A 5IKXA 1JP7A 3Q0TA 2XDWA 4J4TA 5G02A 1E7RA 3KUKA 1FFWA 5D6NA 4I19A 4M83A 1ZGGA 3TMAA 1KY5A 1ZR2A 2R8RA 3D8UA 1O4VA 2BH9A 4Q7QA 3AIMA 2HV8A 1TLTA 2XITA 4RD0A 1OC2A 1KDOA 2YV3A 1KF0A 4A2WA 2ZPAA 1V8FA 4FGKA 5G3ZA 1QO9A 2H00A 4YECA 3RU7A 4EJSA 2VHJA 3IXQA 2FDXA 2ZI3A 3NHSA 4NOJA 1OAOA 1I5RA 1LQUA 1OHHA 3DD5A 4UJ3A 1BVRA 5IFLA 2QYHA 3GR6A 2BGGA 3KPUA 3QPDA 1IPEA 1I6WA 3KKMA 4XFDA 4Z0HO 1EIWA 1KHHA 1I0IA 1GADO 1AQ6A 1U6JA 5HKLA 1L5GB 5COQA 4FYMA 1YFJA 3OJEA 1AH2A 4OH7A 4BJHB 2FX2A 1L7DA 1G7CA 3E9EA 2CHGA 4KUHA 5CG2A 4DR1B 5ITZB 4E6EA 4JVOA 3K70B 2ADOA 2I2AA 2X2OA 1G0OA 4GGMX 3LVFO 5FBWB 5F2NA 1M83A 2BEWB 2WUVA 4G2SA 1UXHA 3DPIA 3S1LA 2IEZA 3EDOA 3WA6A 3X1MA 3ZGXA 1SKMA 1S1MA 5JWOA 3C39A 3DMNA 2DCMA 2QT0A 3C41J 2RSLA 3EGCA 3G5TA 2PGIA 3OWHA 4E0BA 5BMOA 4CG0A 1QWTA 3GGSA 2V03A 3QFFA 4JVNA 5JCXA 1W19A 4UQLA 3ZDAA 4MYTA 1EP1B 3NDPA 2ZT7A 3LT1A 3NG1A 5K0NA 2ZRPA 2J5KA 2XYQA 5BXYA 5IFKA 5KQPA 4G1VA 5HK8A 3ZC3A 4A8TA 3QTTA 3ZZUA 1IAQA 3PZRA 5HBRA 2HU8A 5LMNB 1QCYA 2F43A 2GN9A 1M0EA 4X1IB 3ANTA 1GKUB 2NO5A 3R4CA 3KWMA 2AR7A 1F4VA 4C3ZA 3KTOA 1QRTA 1DAFA 2GD1O 1XJCA 2O8NA 2OESA 3MA0A 3LBHA 4JJKA 4JUBA 2P67A 1NQ5A 4DR7B 1EGQA 3DO6A 3PQFA 4OJKA 1ECJA 4MV6A 2NZ2A 3NOVA 3RJ5A 3OE1A 1HTBA 2V5VA 3NJ4A 4Q82A 3OUTA 3MTAA 1KZ6A 5CRIA 3R74A 5KEIA 1QO0D 2FPUA 2NQ2C 1IN6A 4Q4HA 2IHNA 3MJHA 4RZQA 1K8YB 2I2XB 2XUOA 2BFWA 2JBHA 2P4EA 4TL7A 3A04A 3MC1A 3L6EA 1XLUA 4OYRA 2BFDB 3V46A 4DUGD 1ZIPA 2PZ8A 3PX3A 1MEEA 4PZCA 4ENWA 2CCGA 4GKAA 1QOZA 4O4HF 1F5SA 3GJXC 1JHRA 4NMLA 4QEZA 4JU9A 2DX7A 4I8DA 5B3KA 4JC0A 2BGTA 3UK7A 2BE9A 3X1YA 2DCUA 1ADGA 1GQRA 2FVXA 2IYAA 3QXGA 4Y18A 1VIDA 2E3JA 2FLKA 4C0WA 4CT4B 5BUQA 4O5AA 2DC1A 4HVTA 1X7ZB 2A4KA 5HCIA 1PG5A 2O2XA 3BGDA 3BSYA 3O2NA 3SIPA 3W8RA 3W9YA 3VNVA 3ZU3A 3E5NA 2JLYA 3UK0A 2D06A 2HDHA 4HLCA 3OC6A 3GBPA 4HAOA 3ITKA 1NX6A 3CSUA 1YB4A 4X85A 4GR4A 3VC3A 3W78A 3ZDXB 1MFZA 4GPBA 3RK1A 1RBYA 2FUNB 1WPGA 2IPLA 4BAGA 4CV3A 4XD7D 2G9VA 5HKOA 4I50A 2GSDA 4FDMA 4DC1A 4EKEA 2P7IA 5J5AA 2BGIA 2GTIA 1FUUA 1XX6A 1GLNA 3K6SB 2JFXA 4NZNA 3RRJA 3DV0A 1FTQA 3VDRA 1XL0A 2PH3A 1O58A 1WTAA 2Q3HA 3L77A 2X8JA 3PG5A 2XIJA 1CZKA 3QEOA 3RJMA 4X1KA 1GOTA 3VAAA 5FORA 1XDUA 1ONNA 4UJ5A 1XDWA 3ZU6A 3HEMA 4XPZA 4TKUB 1YQQA 3KT8A 2ZYGA 3QE4A 3GZ4A 4R0NA 1HV8A 1QR6A 1GZUA 1RCUA 4Q5IA 3UG6A 1M2HA 3FI9A 1TEXA 5JBQA 3DE6X 4P7KA 2BIFA 3EC7A 4PPYA 1X13A 2XH8A 4IMJB 4XGKA 3SVZA 3CWQA 5G4KB 4HWGA 1Z9BA 2YDYA 1AKVA 2J6CA 5JAHA 1XRMA 3A2NA 2ZUVA 2J59A 3R5TA 4F97A 4YXWD 3KSBC 2W2LD 1M6HA 2GMWA 2RHLA 4BTEA 1QJCA 2CDCA 2BY4A 2F3QA 2NZYA 4II3A 1RJ9A 3VHQA 1C14A 3EDYA 1TCBA 1KSJA 5LQSA 2HLNA 1DC6A 2C2OA 2X1VA 3BD9A 4DPKA 2QD1A 4PBTA 1V8PA 3K4PA 1IY8A 4CL0A 5CM9C 3W2GA 1YI8A 2WVGA 3W4KA 3DZCA 3R5JA 3GDOA 3KOUA 5E3HA 3CVYA 1CS0B 5ABPA 2FFAA 3THWB 5CYGA 4W63A 1USKA 5K0SA 5LU9A 1WXEA 1BW9B 1TW2A 1BDJA 2ZRJA 1SXJC 3REOA 1P1CA 4BXOB 1Z0AA 1PV4A 3PENA 2CXOA 4K9OA 5DX0A 5M34A 4CQNA 3WGYA 5TJHA 2RK6A 3EXEA 1Z6AA 1JG6A 4G0ZA 3L8EA 3L0ZA 4FMBB 1K3FA 1G7SA 4BRZA 4BNZA 3B12A 3KT6A 5HUJA 4JI8B 4J7XA 5HYVA 2GASA 4I1IA 2FQ1A 4IG4A 4QXPA 3TD2A 3KHSA 3HCWA 2G25A 2WDZA 5B1HA 2NXJA 3GGCA 1X6VA 3LVBA 3NWJA 4GI3A 5DKFA 4E5SA 1U7UA 4TM8A 1IPFA 1MO2A 2RH8A 2QNRA 3HO8A 1NVVR 1IEQA 4YBZA 4A23A 4M1KA 1KK3A 1Z83A 5JZBA 3GFTA 4P3OA 1LPBB 3H99A 1MF7A 1M3SA 3IUMA 3N28A 4URXR 4QOIA 4EO4A 4F8JA 4DA9A 1SCKA 4KO3S 4LV8B 4IF4A 1H4VB 5KSOA 3VOBA 2WM8A 1ID1A 3A1CA 2J8ZA 1G4HA 4JYPA 3ROPA 4R1PA 5DYIA 5A4DA 3VSBA 2XF2A 4A2QA 3PUIA 3KQMA 4B80A 1C1XA 1TUBB 2KMLA 4CFZA 2I6XA 1SHUX 1V2GA 1EP2B 4M0UA 2R4UA 3I1YA 1J2YA 1ISRA 2IFTA 4W7SA 4JXZA 1QIDA 1JLRA 1HEUA 2D3TA 3L06A 1IYZA 4G84A 3BT7A 4HRXA 1YJ5A 2WSIA 4R3NA 1BWRA 1K7YA 5K09A 2RHWA 1P2SA 3UN1A 3W3AD 4LQCA 3TE7A 2HXSA 4P4GA 3JSAA 2QM0A 3A25A 1DZ3A 3KQSA 4FOOA 4LC0A 3VYUB 1E9BA 3GF4A 3AH8A 3VR6H 4C1BA 5DFAA 1H85A 2YBDA 4MKIA 4S2EA 3EVBA 3CPHA 3UT5A 2XYGA 4QRDA 3SKVA 4MMXB 1MVOA 3L8CA 3B52X 1NF9A 2TMGA 1LRJA 3QENA 2GPBA 1NMYA 1JI3A 2VYVA 4REMA 3ZHOA 5A03A 1DB3A 2GCOA 2GILA 1SBHA 1MOPA 1WWKA 2X0RA 1FDRA 1GA4A 1K6JA 3COZA 4IIHA 5FLXA 4ZP1A 2A9QA 2E4WA 4DZZA 1A97A 1KO5A 2NZVG 3F4BA 3PEEA 4L9SA 5E7QA 2ZM5A 1PLLA 3EMDA 4GX0A 2QE6A 1GM5A 5E1OA 4CM1A 3ME5A 4IFEA 4EUKA 1YCFA 1C1DB 2WT8A 2XUIA 4TTJA 4JB8A 4F3NA 2ETXA 2Y71A 1OXBB 3DGFC 3H0EA 3JQAD 2QVXX 1BXGB 3JD2A 4O02B 4Q02A 2G72A 2I2WA 2OCDA 2OL4A 3RCBA 1SKBA 2AG1A 4JN6B 4OHOA 1IUNA 3KTAA 2FN8A 5HK9A 4K40A 1X87A 3LFTA 4FKBA 5EINA 1QS0A 2ISQA 4CKYA 1PR1A 2ZT6A 4RA6A 2DXIA 1OSNA 1G8HA 3V7NA 1JIKA 2AG6A 4EGFA 3BN3A 4DLWA 4RCZA 2JW5A 2PVPA 4Q1DA 1XL1A 1ESEA 1MA3A 1T5LA 4W1PA 3JZIA 3E8SA 5DWVA 4YRKA 3PDIB 4ZYZA 1Y80A 3H2JA 4M38A 3BB3A 4DQ0A 4Q7EA 1SO8A 3QLUA 1TFUA 1V7PC 3UHFA 2R1VA 1V1MB 3CUSA 2ZYTX 4KMMA 3ES9A 1A71A 3RTAA 4UHEA 4L6CA 5EEHA 1P1BA 1GRRA 2IGTA 3RHFA 1Z73A 4Z99A 5J1TB 5G40A 4EHKA 1WUTA 2GK3A 2PZBA 5HW0A 1W0JD 3HXMA 4KFCA 3VU3A 2WTMA 2M2IA 1QZTA 3S1AA 4C4PA 1FK8A 4DQUA 1HG1A 1FXWA 3OJ0A 3ZDEA 1REQA 3LQQA 5J63A 4DV4B 5F5LA 1WDWB 4ND8A 4AMGA 1ESDA 4I08A 1XP5A 2XE7A 1KJZA 1P0FA 2HIAA 4K6MA 5IJAA 4B4KA 2DHDA 2HJWA 4J90A 3LTNC 4WTOA 4UMEA 1S7GA 2ZJ4A 3CX4A 3RADC 3RFTA 3KSUA 4B47A 4NFYA 4N9QA 3T1OA 2AE2A 1OQAA 4KV7A 5KHAA 1ZD1A 2QM7A 3QKWA 1A9RA 3RSQA 4C78A 4DSUA 5JRZA 3OLQA 1KR2A 1R4ZA 1N2ZA 3BD8A 3IP5A 2OGUA 3L0OA 5JASA 2WWGA 2YN2A 4UQOA 1PJ8A 1TU0A 3A11A 3DVRX 3NCHA 4HADA 1Y9DA 3UFBA 2PRJA 2HL6A 4LV5B 1CHDA 1RKXA 2O1WA 4ZYUA 1O8BA 4R3WA 3FBWA 1TYBE 1E8MA 1DD1A 2WPNA 4HDCA 2JFUA 4UPDA 3E9CA 5AVJA 4DKXA 2YC4C 3TSYA 3KQHA 3G5AA 4KX3A 4WASA 2Q5EA 2LNDA 2CT8A 1F12A 1FX0B 1EYZA 1LK7A 1M2OA 3AFOA 1OA1A 1OYWA 2B7BA 2EKPA 5DMXA 2OFFA 3RYIB 2CFIA 3ZH9B 3ZW7A 5CFNA 1BWQA 4KRFA 1T9HA 4OHFA 1D5WA 4REQA 5ALTA 4BFWA 1R5BA 3L43A 2ZYDA 5BQFA 3ZV4A 3M9WA 4F1KA 4PZYA 4DHEA 3NFRA 4LVUA 3VR0A 1RZ3A 5TQ2B 2YX1A 2W8BB 3RVPA 1BQEA 2EWWA 1IRXA 3RE1A 2IZ7A 1Q5PA 1SUPA 2H1HA 3F6YA 3A1TA 3JQ9C 3Q8XB 3QE3A 2EKLA 4NBKA 4G5XA 4PCLA 5ADWA 2X8WA 3DHYA 5FIUA 3FBGA 1ZX1A 1M1ZA 3AF3A 1CIVA 3ELBA 3NHYA 1IG0A 1NP7A 2QJFA 2YUIA 1RKUA 2KQUA 4Q4AB 4UBJA 3U39A 1PFQA 3LGXA 4YJKA 2MR6A 4UEQA 3UUFA 1OY1A 5K0FA 3C1OA 1DJNA 4N65A 4Q05A 4TQAA 1XQXA 1KAEA 2CHVA 3N3AC 5EC8A 2YWDA 5EKSA 1JJAA 3T95A 3G0HA 1U3GA 5JNWA 5IVHA 5C81A 3HA5A 3HRHA 4CF4A 2BFBA 1ZIDA 2Z1NA 5D01A 3Q7TA 2EGUA 1OXSC 5TV2A 1KYTA 4C4YA 3FKSA 3PGKA 3STUA 3MTEA 4AXXA 3LDFA 4Y0AA 4B3CA 1U1GA 2QMUA 3OVMA 5G1PA 2WKWA 3K1AA 3DOJA 4OP1A 1Z7WA 5HZGA 2RGGA 4JFAA 4NZPA 1M1YA 1L5HB 2X22A 1JGTA 4WKPA 1WKBA 4L2IA 4PU0A 4H18A 1Z08A 2EIHA 1YMUA 2O05A 4Z4HA 2OCLA 3WAJA 2HH9A 1J22A 4L7QA 1ZJ6A 2I9PA 1V6CA 3A4VA 5ALFA 2XCOA 3E1KA 5BY2A 2K2WA 2GPSA 5FWYB 1X80A 3AIIA 3L7IA 4JYBA 4WINA 3RIEA 1EP9A 1HORA 2VP9A 3EZ2A 2ZP1A 4MO9A 4TKZA 2PUFA 2SCUB 2VRWA 2GA9A 3ACBA 3OTIA 1WUHS 2F8MA 3JQGB 1OYYA 4HAUA 4KAJA 4H6PA 5D3QA 4DAOA 3PXUA 2A88A 4ENVA 5IASA 4BLQA 3ZBPA 2VKTA 1FEZA 1BJRE 2P75A 4DY4A 2WILA 3RAEC 2RGRA 4NOKA 3MELA 4IKEA 1L5RA 1QIGA 5A6SB 2D5AA 1E7WA 2OGSA 2VDOB 3H1FA 3KVOA 4IHJB 2Q6OA 4OM8A 1QFJA 1QIHA 2PSHA 4TQ9A 4URVR 3MWGA 3BKXA 1US8B 4D96A 5CGQB 2NVBA 4QLOA 3NHWA 4D97A 3DUFB 4KVZA 4YFYA 4QKQA 3PKIA 4HYEA 1TNDA 5DXFA 3L04A 1KWGA 4IQ0A 4RZ2A 3S2IA 2V97A 1R64A 1LX7A 2BBTA 1THTA 2V7BA 2VAMA 3G8CA 3IULA 4W5JA 4B6EA 3SYTA 1ZI9A 1XZEA 1NY6A 2Q6TA 1FUIA 1G1AA 2G5CA 2C2WA 1DJLA 2WF5A 3L6CA 2P9QA 4OAOA 1NVWQ 2QB5A 4OQQA 1F3LA 3P5BA 5KJFA 3GROA 3RASA 1WW2A 2HWWA 4JMLA 2XMPA 2XVMA 2PO7A 1FSZA 1TKCA 2JNWA 1ILWA 2P6NA 3VH3A 4LYAA 5CCDA 1M2VA 5TQVA 1ZHOA 3DBHB 1OF1A 1V6AA 3ZGLA 1G5FA 1K4KA 5IWAB 2WIFA 2Z1MA 2BSXA 1X15A 1H8HD 4RENA 1MO5A 4DNOA 5BORA 2W22A 1VIMA 3HKDB 4QATA 5IS2A 2Z2ZA 1G2IA 4J91A 2JZNA 1IL0A 1JIJA 1T9DA 4GPZA 4XPIA 2H1OA 3BXZA 3PXEA 4MB2A 1F48A 3RFUA 3UQZA 4M21A 5K4AA 3WIBA 3UT0A 4BGIA 2F67A 4GI7A 4PHGA 4UHCA 3ZU5A 2O3JA 2OFWA 4PXYA 2CNOA 2VDVE 3S28A 4B34A 4CN8A 2HBRA 1CZRA 1VL5A 4DJ5X 1QQTA 4O29A 2V7QD 3VZRA 5K6TA 2BEVA 1IN4A 2B0JA 2H16A 1ZH4A 4G4SO 4UTXA 1Z29A 4C6SA 4F2PA 2XCTB 1KDRA 5CVTA 4BEVA 5CDUA 5EVCA 5L7TA 5BN5A 5ES3A 3OOEA 4IGEA 1T3SA 1DAHA 1IHPA 1AVTA 4UZFA 1MG5A 3SJUA 1TK3A 3GA7A 3EVDA 2AFHB 2NXWA 3VGJA 3EMKA 5INTA 1DBQA 3SZOA 1HLDA 1M6YA 2NUPB 3EUWA 1RAEA 5BR8B 2Z9BA 3KVNA 2V7VA 4WJKB 3GCZA 1EJBA 5DJOA 1LLDA 3JD0A 1NFQA 1VJ5A 2AKYA 4R8RA 2FWRA 2EX1A 2PWZA 3ZTWA 2DR2A 1I5EA 1SVKA 3UAZA 1TRKA 3PQ4A 4GC9A 3MCWA 4NR0A 4UXIA 2JD2A 3K53A 3TOXA 1C9JA 4PZAA 3KL2A 3UEOA 1BIFA 4RO0A 5DM70 4OQPA 1GKKA 1B6SA 4O4JB 1K5GA 3HU5A 2CBZA 1ECPA 1X7DA 1SUDA 3E3LA 5J23A 1KFEB 4XM0A 4TKVB 4DFDA 2A5DA 1X0VA 4ZZ1A 3PQDA 5F23A 4DV7B 4S04A 5JXGA 3W6ZA 1UODA 3D3JA 3RNOA 3TXAA 1T4BA 5JATA 5FOSA 5TPZD 3BUSA 1LRKA 4V0LA 1G6Q1 3WADA 3A6PC 1ZK0A 2JEOA 3T7AA 4HEQA 4PRZA 4AP9A 3T3DA 1AF7A 3PL1A 4BNDA 1RABA 3PNOA 4EG8A 5IF3A 4GD3Q 3PCXA 2H2HA 5K03A 3A9RA 4LXTA 2DG2A 4Y9SA 5JT1A 2BC9A 3G79A 2EU8A 1DZIA 3WYEA 3LW7A 3O3MB 1L6RA 4ZV9A 4UHKA 3UV6A 4CJXA 4OGFA 1GU1A 1N5LA 5DBIA 2D2FA 4B2IA 3NW9A 1MGPA 1JDPA 3D7KA 3MLBA 3OQVA 2OCGA 4HLDA 3RTBA 2CC2A 3TR6A 1N4DA 5I8PA 1WD7A 2VBFA 1E6LA 4YRDA 2G0AA 2I4LA 3H6KA 4II2A 5C46F 5JCJA 3TTXA 2FW6A 3HJNA 1K63A 3T4XA 4GYJA 4R4JA 4PHCA 3R5FA 3JYQA 4HYYA 4M9QA 3VZSA 4UDOA 4B79A 3SXUA 4Y2UA 2E4YA 3IT0A 5IBQA 1B1CA 2Y1EA 4RADA 4CLOB 2L2QA 3FUXA 2ALJA 3USZA 4A4DA 3QMPA 2YFQA 2VUIB 4D79A 2IH5A 1I33A 5LQNA 4OL9A 4ER3A 3U7JA 4P4SA 3OE4A 5AKKA 1A1VA 3JVDA 5FH9A 1ZN7A 2BAGA 3B6JA 3RIGA 1ZVKA 3SF0A 4O0LA 2CJWB 2JJQA 4YT8A 5HTOA 3SJBA 3CPSA 3C6QA 1S01A 3KTDA 4D0NA 4MGEA 1ZSYA 1Y5IA 5KYNA 3WL6A 2ZFUA 3MINA 3OKPA 4GFDA 1JDUA 4EUNA 1JKIA 5ADHA 2AOVA 1DC4A 3OEEA 5DXJA 5IXYA 1U2DC 4KXWA 3AB3A 3MT0A 4JGGA 1X7YB 4YPFA 3FUUA 3GHYA 4R2HA 5ALLA 3VHRA 4FR5A 3DDUA 4GVLA 1YJBA 3IURA 3N75A 2REOA 3PC2A 4BZWA 1UIMA 5JJLA 5FA5A 4QEDA 3AU9A 1DJOA 2DTEA 3V00A 4FOTA 4MUBA 3D31A 4LSZA 5NULA 5JBNA 3ROEA 1PEYA 3ADCA 3AP2A 5T6BA 2R87A 3OOJA 5KJ1A 3U9LA 4RACA 3JVUA 1YBFA 2WJIA 4RFSA 4UOQA 5L4LA 3GJ4A 2CE2X 3B6EA 4TOIA 2VAXA 5AOAA 4Z2AA 1NVBA 2BFEB 2NZWA 1P2UA 4DF3A 4CCYB 1G20A 1L5YA 2PSEA 2YMMA 3CNBA 4ETIA 4TYPA 2HPVA 3LQRA 4M87A 1XZJA 1L4GA 4NENB 5BWOA 1UM8A 3MM4A 3RUIA 2PS3A 2XE6A 3MN1A 4A10A 2FTKE 4BKUA 3I1IA 1DWQA 1LW7A 2RJNA 4ECEA 1XEFA 3D9QX 2G09A 1KTVA 4NV1A 5GINE 2BYTA 3PKZA 2VDLB 2J5QA 2F90A 3EAQA 1DG3A 4NYJQ 4O3FA 4A6XA 1HOXA 5LNK6 4RTKA 5F4BA 4ZVRA 1Z15A 3GVPA 5BN1A 5BWCA 5FBRB 4ACAA 1NC1A 1Y8CA 3FPEA 3W1WA 1NLUA 2G5PA 2IU6A 2J7PD 3AKEA 1JU9A 3HA2A 4WIAA 3JQAB 4XWAA 1DEKA 1NW3A 1ZN2A 4DOMA 1Y42X 2R6JA 4Z7NB 3O8OB 4DSZA 4X60A 3ZBQA 1O3YA 4KLRA 5TXGA 3E18A 1DWUA 1X7GA 1LBIA 4G1UC 4YONB 3R23A 2CMGA 2RK3A 2NU9B 1E9VA 2G40A 2VJBA 3PJEA 1UQRA 3HCBA 2MSNA 3DL7A 3PDJA 3EEQA 3EUAA 1BROA 4EYSA 4BFYA 1Q19A 1UP6A 5ALEA 3CLKA 1JQBA 1ZCJA 2PXHA 1H5UA 2QROA 2C8VA 2VT2A 3P71T 4RK7A 5DSTA 4KXUA 5ILOA 1Z5PA 5K8TA 2AVNA 3VDNB 3ZI4A 4JR2A 3LX6A 5K0EA 2O8FA 2HYDA 2XDQB 2F2TA 2MCFA 1HDRA 4BMOB 2NU7B 2FNAA 3E7WA 1HPLA 2PMCA 3LQ1A 3BRQA 3HNOA 1Z0JA 4FNMA 4G9EA 4BCCA 3DBIA 3ZGYA 4N82A 4W7HA 3UKOA 1M2WA 4F6LA 1JALA 3GOHA 1BS9A 1G3UA 4D0LB 2XHEA 3FLAA 3KYIB 4EJ2A 3KLPX 2QMZA 4JELA 1OX5A 1U7OA 3EEIA 4MWOA 5D7BA 4YROA 4BGUA 1QE5A 5CEEA 3BSWA 5KYVA 1C7ZA 1M0SA 3VR2A 1WP4A 3G7UA 4S0XA 4FU0A 2VSQA 3P0JA 1SC6A 2E21A 4I55A 4ZRMA 1C3OA 1NN0A 4YT2A 4KWTA 4HX5A 1PYDA 3ETDA 4J8PA 5C8YA 1E69A 1AKTA 1UMDB 4E32A 5DM1A 4EB6A 3AFNA 2OXCA 4Q1EA 4B33A 3HO1A 4Z51A 1DOAA 3PFCA 4L0QA 3GT3A 4XB2A 1PBTA 3H2SA 5HKKD 3LC0A 2GEFA 4BS9A 2OXFA 5JMTA 3AYZB 2Y0EA 1XAGA 4JJ6A 5E1MA 5ED0A 1DKPA 5KU7A 1IZZA 3PXBA 1WXFA 2VPWA 3K92A 2WSMA 4L6AA 4EB3A 2I54A 4IFTA 1EKXA 3L0YA 4IVPA 3NH9A 3KJZA 1CG6A 3TX6A 3WXBA 4MS3A 2IWHA 3OPVA 1V9LA 4D4MA 4NCBA 3HDQA 4XR4A 2YR0A 2CNWA 2GN6A 5SYNA 3RSGA 2JQJA 1UEJA 1I36A 5KYXA 3PV0A 3FKQA 2ZR9A 3DEKA 3C6MA 3V1NA 4H0FA 3IQXA 1I2BA 1AB6A 4LHEA 2XUPA 4C21A 1TEHA 1NLZA 2FJ0A 1WV3A 3LW8A 3QIAA 5EZQA 4KX5A 3HTXA 3D6JA 3O93A 3E7DA 4P38A 2H4XA 2ZJAA 1FDWA 4INOA 4YMGA 4D2IA 1ENPA 1X8JA 4B76A 3IEMA 4HWRA 2UUOA 3ACDA 4MUEA 4TRMA 3ZE2B 4EYGA 1KH2A 1QCZA 4L16A 2Q6IA 5KSYA 2MSLA 2OHVA 3M2PA 4DCPA 4F4IA 4U4AA 1U2RA 4I1SA 3PZBA 3TINA 2XR1A 4HDNB 1I94B 3LOPA 5IKMA 1HSZA 1N7IA 1OLUB 1T8YA 4IHAA 2ZR8A 5KYTA 2NPIA 4IFBA 4BEBA 3UPTA 1ZWKA 1J2EA 2EJUA 2VT3A 2N3ZA 3HSSA 1XIVA 4ZPXA 4Q9DA 2CXNA 3FLMA 3QH4A 5EXDA 5L51A 1JAHA 3PFKA 1GITA 3T7JA 2JDIA 5AK4A 4Q18A 4G09A 1QONA 5COBA 1NI4B 5AI6A 1FFEA 4OHCA 3DDSA 5H3HA 2HJSA 3A4IA 1LSJA 4ZC8A 1QQ5A 4RLSA 2GPYA 5JE8A 1TUGA 5A02A 2WIJA 4UU1A 2CVHA 3ZZNA 5DDIP 1SQFA 4AJLA 2JGEA 4XSHA 1UKAA 1B8OA 2C9YA 2P4UA 5C9ZA 4BU1A 3LL4A 1WMBA 5KTTA 4F38A 3L0BA 4IYJA 1B74A 5HDQA 1PSDA 3EVZA 4FE7A 5JWHA 1KZHA 3OMXA 2ESRA 1TOAA 2PMBA 4MW6A 1HH4A 1KO1A 2EGHA 2QTWB 3S2UA 1GWNA 4KNWA 4OP2A 5D00A 5JISA 3P1JA 3I2IA 4R0MA 4AY6A 3EG9B 1EFAA 2LE0A 3HXLA 3VSEA 3F5SA 2OGZA 5C8ZA 4RA9A 3ED1A 5MFPA 4BDTA 4FI3F 3BL5A 3LL7A 2BL4A 4MR7A 3GLGB 3NCTA 3BMNB 1G66A 4QSMA 2Z5VA 5AVRA 3BPSA 3G6KA 3VKUA 3JR3A 4UUNA 4MS1B 3L4JA 2IUYA 2QRVA 4JP5A 1A8SA 3MTBA 2HA2A 5EERA 3BWCA 1NXWA 4U3JB 1JZQA 2DUUA 1SOMA 2ZSKA 4NMHA 3DWIA 5JWRA 1YKFA 3MS2A 3ZK7A 1Z88A 2X2EA 4V3CA 5I9BA 5D2CA 4L74A 5B7NA 2HSEA 2I0FA 3SG0A 1GUDA 2HWXA 4PYJA 2GEJA 1JMYA 4RJJA 3WKBA 2C42A 3FDZB 4NKRA 4Q16A 4ISBA 3KU4A 3KUCA 2WU4A 1LV8A 1DJPA 4FSHA 3BERA 4NCIA 1MZPA 4KBFA 4JOBA 4BWVA 4HG2A 3DLTA 5LWQA 2JAXA 1UKBA 2QVCA 1QV9A 5EPOA 5ARDA 3KFXA 4M99A 1JTFA 4DKJA 4RBNA 2GI4A 4FS3A 1Z22A 3C85A 4PFSA 2JJ2D 3L8ZA 3ODPA 4BVHA 2R7AA 1NP6A 4F1WA 2RGNC 1OI2A 3IDAA 3DZGA 3Q85A 4XDHA 4HNSA 1T2DA 1UXKA 2GNPA 3BJIC 3I9NA 3PO8A 2ZDQA 4TS3A 4EUHA 4Y2XA 1NNLA 1POWA 1HTWA 3GJ6A 2H92A 4MWCA 1PE0A 2GO1A 2KX7A 2W4QA 4RM3A 2JFGA 1UM9B 3CZRA 1E5VA 2AKAB 1F2TA 2PYIA 2Y1OA 1GNTA 3E8XA 3HGTA 1COZA 1P6QA 4BMCA 2W93A 3PEWA 3R1IA 1A9OA 2VN8A 4S12A 4JT4A 4JI0B 4CQMA 3HB0A 2C2XA 3V8PA 3KOOA 3ZE7A 3FZQA 3FTDA 4YUXA 4EHFA 4HXGA 2JLWA 1NNUA 4EO9A 3WQBA 3GJ5A 4U7PB 3T9EA 4KI0A 1NOKA 4UVGA 1J1UA 2CDNA 1TCCA 2POQX 4D45A 2EW2A 1FNMA 4KQCA 3O73A 4LMPA 1EWKA 4CLEA 2YJTD 1OXXK 3WO0A 1M1NA 1IXZA 1GZHB 2OCBA 5ALPA 3M8KA 3QTBA 1UOEA 1SBQA 3IDOA 5EIBD 5CJ2A 3LCCA 3GFBA 3HGMA 3CA8A 3KR1A 1XXHB 1YS9A 2Z43A 3TIXB 3BMXA 4C4AA 5AM3A 2P5SA 1WSAA 1GSIA 4AVYA 4J0JA 1MAUA 4X90A 1M0TA 5IBCA 5TLSA 5B5SA 3STTA 4FZ3A 3REFA 1T3HA 1VYTA 3I09A 4BO1A 3LCUA 2QTBA 1ZHHA 2DULA 2V65A 3IQWA 1IXRC 1GTJ1 3ZQ4A 4QYIA 2B0CA 1N0UA 3N8NA 2NYUA 3UPDA 4DWOA 4Z49A 1E3DA 1C41A 1YMQA 2WFMA 3ST7A 2Y1KA 4F4DA 4C08A 3VBCA 4RF2A 3PTLA 1OAOC 2IV7A 1DKMA 3VSCA 3CTPA 4BNNA 1MP0A 5MFZA 4UE3S 3GMSA 2QYOA 4CU2A 2IYRA 5TPWA 3VNRA 3DMFA 4D3FA 3G2KA 2A1UA 4CLRA 1WLSA 2O3UA 1S6YA 4G5YA 5HUQA 3NDBB 3CEAA 1RYEA 4CL3A 5IHPA 3GLQA 1ZRSA 3R5KA 2B37A 5AD1A 2P65A 2QY9A 1LW6E 1XWWA 5CH5A 4QDKA 1W75A 3OX3A 1A7AA 2Q3LA 5K6AC 1G4AE 4LNUB 4D9HA 3A14A 3ELVA 1CB7A 3GLIA 3B6IA 4F9EA 1KJ8A 4G81A 4Q4LA 1TZMA 2XT0A 3NBAA 4YS6A 4YMSA 1E9EA 5HGJA 4ZHQF 1CPYA 5JY1A 4J1QA 2C4WA 1GFIA 2HF2A 3SQMA 3WYAA 1PEDA 4XW2A 4Y9TA 3MBOA 3V2GA 4D4JA 3LXXA 2WJWA 3FPGA 1PD0A 5M7EA 1P2VA 5ARCA 5IKEA 2VEDA 1CUHA 1DX9A 1AKQA 2PT7A 2QQFA 4GT1A 4PGGA 4ZO7A 5D84A 3WV4A 5A06A 3DYVA 2WBLC 2J0UA 2XMRA 5A6VA 4OBXA 1HZJA 1AZSC 2DQYA 1KI6A 4O4HA 5GGXA 4JL8A 721PA 3K9CA 4GX5A 2O8BB 3TVTA 2PGXA 3E22B 3F6EX 1J7KA 3RAFC 1N77A 1GYRA 3GAMA 4NU6A 2IXAA 4C06A 1ZD9A 4C0QC 2YN4A 5JFOA 3GWGA 3O84A 3BRWD 3DL2A 3FOWA 1E9FA 3K16A 3NHMA 1GTVA 3NYWA 3NWOA 2IYNA 1LNQA 1ZKDA 3SQXA 4YAEA 3U40A 3EN0A 4D5GA 5C2JB 1WY5A 3G9QA 3JAMA 5KJEA 2EP8A 1Z28A 4HAYA 4QXMA 5LOVF 1H6DA 4G56A 1CFZA 3QEAZ 1ORRA 2J1LA 3DBOB 1RQXA 4UU8A 4CQMB 4NK4A 4LJRA 1YCGA 4FGJA 5MN4A 2JIOA 3OP1A 4DA4A 4N0PA 2CFOA 4DSTA 1P72A 1NI5A 1NVEA 5T4HA 4YYEA 1EUQA 3R9XA 3BL6A 3AI2A 1FNCA 3F2VA 3GBVA 4K6GA 4M6WB 3GH3A 1B3RA 1QTQA 1NSYA 3PICA 3ICOA 4IQGA 3SFTA 3T3PB 1R4MB 3U3MA 1XCPA 4E11A 4NBSA 3QW2A 5EHQA 4BV8A 2OZLA 1FRZA 1K7CA 4OXKA 3TIGA 1FF9A 4EPVA 5E0KB 1FS5A 1E99A 3UWDA 2WZBA 1RKVA 5AVYA 3N1UA 2GF9A 3SSNA 1T43A 4RHXA 4R84A 1D8AA 2R85A 5JSZB 3WR5A 5A3JA 3SLRA 4RV9A 2M6LA 2CW5A 3SBEA 1MMFB 1PKXA 4J7AA 4N7RA 2DE0X 2I33A 3AVTA 4YMLA 3EPPA 1V5GA 1PX0A 3TQIA 5JD5A 4C7OB 3RJ9A 3H65A 1QRDA 3MOGA 4ZMBA 5JC1A 4M8SA 3SXJA 1NU6A 1SKYE 1R6BX 3HDGA 4CKWA 1WSBA 2HREA 1ZL2A 2WQ6A 1F6DA 1UMCB 3K09A 1KC3A 3VR1A 3VGPA 3W2IA 4LA4A 4V1CA 4D56A 4TTPA 5BN4B 1ADFA 4M89A 4YLYA 3ECSA 5DNWA 1PV1A 3JZAA 5EJ4A 1JU4A 5KSPA 1E60A 3SN6A 4FVTA 4G41A 3CPEA 5LBTA 4L4UA 3PHCA 1U98A 4Y2PA 1H9BA 4BX2A 3RKSA 2CVPA 2YWEA 2OXEA 3FBTA 1U80A 4W6ZA 2WPDA 1P39A 3EA4A 2V54A 2G06A 5I48A 2ZR0A 4KAAA 4OJMX 3WI7A 2X6RA 4LPKA 5ICMA 3ZZ1A 3OTQA 4IHQA 2XEXA 3Q7PA 1CBUA 1P3DA 3IAAA 4YUWA 1PRYA 3LXUX 3I83A 4LNAA 1FP4A 2I99A 4GRAA 5BSMA 1XU4A 4C0LA 4IP0A 4N9WA 2UZ1B 3JYOA 1XLVA 5BSKA 1XKLA 4QULA 1ZRNA 4I6JA 3X3HA 4UNRA 1K0UA 4MVYA 3P0FA 4U0KA 4YA6A 1HYGA 4PHHA 3N2KA 3DDOA 4XRRA 1DRKA 2Q1SA 1DG1G 2WWXA 1VHLA 5LYJB 1Y1RA 3FCUB 3EF3A 2GJKA 4ZI5A 2J0QA 5A71A 2WD8A 2OECA 3KLOA 3SKXA 2YCBA 1PQYA 1Q0ZA 1GGKA 2CN1A 4E5PA 4PQFA 5KTOA 1WZ2A 3M6FA 1PNQA 6YASA 2C98A 3HL4A 1U6KA 4J1NA 5CYOA 3ZKWB 4D4HA 4DHWA 3UJCA 4OBEA 1EHYA 5KDDA 5KQMA 1ZU5A 4DR3B 3A1DA 4RKFA 2ZG6A 3EMVA 1H3NA 2DKNA 2R8ZA 1EZ1A 3A6ZA 3UYLA 4CMIA 3UF0A 1H2HA 1XVTA 1G5HA 4JLBA 1DC3A 4CIYA 5GTDA 5I4KA 2VPIA 1UL1X 4CHTA 4HNHA 1XG5A 1R4NA 3RBVA 4KN5A 3HN6A 3LT4A 3NDIA 3CSSA 4W8GA 2QN1A 5AK0A 5GM2A 4CIXA 5ENVA 3SEAA 4J0GA 4YRIA 5JNTA 3PPXA 3D1LA 2ISCA 4FCTA 3T0FA 4UAVA 4KLNA 4IQFA 4LCJA 1DJQA 2QZ9A 3H18A 1XTKA 1CQJB 2F48A 3WGVA 3AM3A 2FFHA 5SZKB 5F9HA 1MR1A 5EN4A 2LBPA 1YGSA 4PAOA 1X2BA 4LW8A 1ZM7A 2ZRQA 3F4LA 1VE6A 3GZTB 2AOUA 2OV6A 4Q01A 4WXHA 5EQTA 3DEAA 4KH1A 2FR1A 1C4WA 4QTUB 3SHFA 5IYZA 2GKGA 2J87A 3K6RA 3CRVA 1E66A 1L5VA 4PCUA 1Z13A 5EFOA 4N41A 2FGKA 1S7CA 4FDLA 3RRZA 3TLAA 3MRXA 1IRIA 4B09A 3C6XA 4ASUA 4W99A 3A6KA 1QHNA 2F1JA 2W2KB 4EYKA 3UKJA 1S0UA 3DDCA 1EK0A 2VH5R 4HDKB 1JA1A 4YALA 2QEQA 5KOJA 1E32A 2C2KA 2WOJA 3V7FA 2AA3A 2VYND 2YS7A 1LPAB 3QVOA 4B3IA 2ZYIA 1IY1A 5AUOB 1RXWA 4K0KB 2F59A 2PZFA 3WDKA 1RWKA 5D7NA 2BT4A 5F5XA 1V16B 5IK2A 4Z4FA 3T54A 4ALNA 2VT7A 1SXJD 5EIWA 4F2GA 2QZ4A 2XKKA 2KB4A 3QP9A 3IKJA 2BDUA 3DYBA 3L7DA 4MVJE 4PVDA 2XMSA 3G6WA 3RAJA 3GHHA 4YMVA 1TMKA 2UU9B 1Y7IA 3H16A 3WMWA 2LTAA 4J1SA 5ALOA 4NQZA 5TF0A 2HZBA 1N6OA 1P6UA 1X1BA 1X1SA 2AW5A 3QU4A 1XJWA 4YAJA 3RFVA 5DGTA 1FQOA 3L92A 2AC2A 2PCJA 3A06A 1DV2A 3LXMA 5BO5A 1C9MA 3HDVA 3KQWA 3CN9A 2HJ9A 1B16A 2ORWA 3KAPA 3P2IA 2FOXA 5THQA 1B0UA 1K8QA 1N3YA 2JLSA 1U2TA 3BCHA 3CZ5A 3OLVA 3UM9A 1GQSA 1BRMA 1RI2A 3QKUA 4X54A 4L02A 1K9VF 5ELLA 1V1JA 1WXDA 4MVJM 1CQXA 5E7MA 3UJ3X 3VO8A 3G2MA 1AS3A 4LYDA 5EMJA 4P4UA 4HNAB 4LZJA 5GJWC 3BHJA 2PNJA 2IF0A 3B36A 3TL6A 3ZK9A 4K87A 4D99A 4ERNA 2R65A 4P54A 1W88B 5CFPA 3AVQA 4DA6A 5C1IA 2VTEA 3G2PA 2YJ6A 2J3JA 2Q5JA 4FX2A 2H63A 3M6WA 2M1ZA 3C3DA 1KBQA 2NNWB 3WLEA 2QDKA 4ZCLA 1N2CB 4EHHA 2E5LB 4R1NA 1YDMA 2WMNB 4MV7A 5GONF 4RGQA 4PRYA 4UEWA 4TZ0A 2QK4A 1YKGA 1SHJA 2V7UA 3NT2A 1RCTE 4Y7CA 2QVZX 1MHTA 4EZBA 3WYGA 1XTRA 4Z0PA 3RD5A 4TZ6A 2R5WA 3PLNA 1J4AA 3VR6D 3UOWA 5ARBA 2EW1A 3INGA 4RCVA 3ZE6A 5GPBA 3ADKA 2F3UA 1KH1A 2BM0A 4HEJA 2W2QA 3U1TA 4ENQA 3G2QA 5A8IA 1NBMA 2FPPA 2QU8A 2JBAA 4H7EA 1DRVA 1LF5A 3AL0C 1ZRMA 2B7CA 2XWJI 3O0TA 1U7HA 1E3EA 3BFPA 3VX4A 4B3BA 2ZI7A 4L8LA 4Q9HA 2PXXA 3ABRB 3ZN2A 5CM8B 3LGSA 2VAVA 3B1VA 1JKFA 3IVGA 3NVMB 4TUYB 1NXTA 4BO3A 4NDZA 4BVFA 3COYA 4PXSA 4BYGA 2QE7A 4PSUA 3E15A 5JXHA 1PWXA 4G4SP 1PJ4A 3AVWA 3R9WA 2ZXEA 4ZVQA 4A0RA 4DM7A 1EWVA 3KZMA 1VJTA 2X0DA 3OE7A 1MOSA 2NSHA 3THXB 3BIOA 1WHTA 1JHAA 4YJ2F 5DW0A 5F1YA 3GNQA 4G0NA 1TQ4A 4GIBA 5LC1A 4EKGA 4D8TA 2YH2A 1WPQA 1DS6A 2ECQA 1BXKA 1JLKA 2R8OA 3JAWB 4LDAA 1N8KA 2JZOA 1J0AA 2VZLA 3DLAA 3OD1A 3ASZA 2BZGA 3BTOA 1ONOA 3LQFA 5EGSA 4NJMA 3TQOA 3HYNA 2YW2A 2HPHA 4QOJA 1HFEL 1AS0A 1Z6PA 1U11A 1LCIA 1U8TA 4FZJA 2CUTA 3CUEF 2FWJA 3DP9A 3D7SA 4YREA 4PNZA 3ZW8A 2RH9B 2JGJA 1P45A 4NFHA 1I51A 4Z9XA 2IS4A 1XTBA 2JEYA 3DVAA 1SQ0A 1Y1PA 3F5QA 1KS2A 1E63A 2G82A 3FWYA 3EK2A 3R6WA 5DGHA 4J9VA 3RVJA 4E12A 5J5VA 3S8MA 5CT9A 2XAUA 4O5OA 2IW3A 2RC5A 2XBLA 2ZRNA 5CLGA 2E4XA 4DSNA 3WRYC 2IX9A 5FV7A 3BMCB 4NDNE 4QJ4A 3Q2OA 1XTPA 1MX1A 2AFHE 2ZU6A 4BBZA 4MQEB 3I0NA 2JFYA 4RIFA 1KRWA 2OR3A 4P36A 2AXEA 4DMMA 4CETA 1A69A 2Q0SA 4KWEA 5IXJA 4TLAA 1WE2A 3PC8A 2I80A 4PBRA 2XXBA 1A76A 2P27A 1R8YA 1G8AA 2XADA 1YRHA 2ZIXB 5JPIA 4ZGGA 3NM5A 3VVMA 4IPTA 3CJTA 3SS8A 5DB4A 1JB1A 3LX4A 5LQAA 4XX0B 2JPEA 1PNOA 3U3KA 1NFFA 5KI6A 2KKLA 4CZ2A 3H19A 5HILA 2PBLA 3ZPXA 4AS1A 1ULZA 2A7QA 2P11A 2W98A 4I7EA 4O1MA 4PC6A 2RHTA 5GOTA 4M1ZA 4AJEA 5HTKA 3OZ7A 3R0JA 3UMRA 2NUTB 1R37A 4JT9A 2IV2X 5BR1A 3OTHA 4FHEA 4W8HA 4B83A 3ANNA 1RI3A 4BLRA 2GEUA 1G59A 4RTPA 4DG9A 1NXXA 1ZMXA 1FZQA 1KDVA 4D3YA 4P3YA 3Q7QA 1WSDA 5ECWA 2E1PA 5FLKA 1FFHA 2DBVO 1A0OA 2C61A 1UBRS 1ICEA 3ML1A 3GJTA 1RM5A 4MHOA 5BSVA 5JTUA 3TEFA 3MCUA 5LPNA 1RADA 1DADA 2AL7A 2ZE6A 3ESQA 621PA 1II8A 3QELA 5HF8A 4X3PA 1XKQA 4XSVA 3LV8A 3UMGA 4DEXA 3KQKA 3I9MA 1F8YA 1ZRHA 2HQSA 1R00A 1HDZA 1XV5A 3LTEA 1RWNA 1W96A 1HE3A 2I55A 3RSLA 2XXAA 3NEAA 1RPTA 5L6MB 2OGWA 1EFKA 3WWZA 4CFSA 3IEUA 4DMLA 3HJAA 4NQRA 4HDQB 1OKKD 4EFLA 1J8YF 4YR9A 2BP7A 2G17A 4URFA 4YMWA 3TDMA 5F78A 5TB5A 3VTAA 3ZQJA 1DKLA 4Z2YA 1CLUA 4E4YA 4EX7A 3LI2A 4TKVA 1LI5A 1VOTA 3E5RA 5G1OA 1WCV1 1J2FA 5DRYA 3WGKA 4YY3B 1DIRA 2QTAA 4GWGA 1QKIA 2FZGA 2H5EA 3MJ4A 4M0FA 4WLEA 4R8SA 5IT9A 4ZALA 2QTVB 2GZ2A 1GV1A 2ZUBA 1CP2A 4IZIA 4C0XA 4DW8A 3EX7C 4Y6QA 4ES6A 4IDCA 5E4FA 5EVJA 4F4UA 5A7FA 5J59A 1LKZA 3PHHA 5C0OE 3K6JA 3HCOA 3F67A 1M6EX 3FNGA 2K4MA 4UHJA 4YUVA 5HF9A 2H0AA 3GXBA 3RU2A 1L4NA 3JPWA 5FTJA 3WL3A 3ZOZA 1FFSA 3TO5A 2HF9A 1I7DA 5K7SA 4O2AB 4Y2HA 3VR3D 3OIYA 4FE3A 4M8IA 4Q19A 2FG7C 3ZEIA 1QO7A 2D2IA 1U5CA 2BHSA 1YVDA 3FCAA 2JARA 5CK5A 1YOBA 1QH1A 5DEIA 3FCEA 4YCBA 1XN1A 1ZMOA 1AZLA 2RAVA 1U7WA 3WIEA 3M2TA 4WPGA 3I8XA 3LY5A 5LR6A 5HFAA 2GJ8A 2ECFA 4S1NA 3B3GA 3RYFB 2FZVA 1ZI8A 5IWCA 1QHSA 5ALWA 3UA4A 4C5BA 3ESCA 3WYBA 4F60A 4ZGBA 3U0BA 3FWHA 5CX1B 1E1LA 2UVQA 3HHPA 3M5PA 3P9XA 4P3NA 4EG4A 1T4CA 3B20A 2IS2A 3GPBA 5BNTA 1IEVA 2HAEA 4FC7A 4LJ4A 4CT0A 5I45A 1RRMA 1G5IA 2K7ZA 2KW5A 1TI7A 3DP7A 5HF6A 3W1EA 8AT1A 5KOIA 1EBBA 4JI2B 2QPTA 2IU0A 4WRRA 1GXSB 2P3SA 2WC1A 3I9V6 4RHCA 1RPAA 1A8IA 2YJGA 2A92A 5EWMA 2OCAA 3FHTA 2C2ZA 4BO9A 2OBXA 2AOTA 1QDLB 3S6JA 4TT3A 5KHOC 3TFQA 4P3PA 3M9LA 2VPYA 5DYGA 1H1TA 3QBVA 3PIDA 4FMDB 2JLCA 1UBEA 1WAMA 1X7XB 3HR8A 4RVFA 4WBNB 4YV7A 2EOAA 3ZQUA 3LCJA 3GDFA 3VPFA 2E0IA 4YYZA 2DY0A 2ZWIA 4FEYA 2DFLA 2Z04A 3P27A 3GFVA 3KO8A 3EW7A 3R5XA 2B2XA 4I1PA 4GWKA 4UM7A 3KZNA 3LUFA 5M5BA 4D6YA 3E0XA 1XQVA 3BF8A 3UV7A 3O8RA 2X3YA 1M2GA 3FMIA 4PYRA 1RZRA 1FSPA 4FT2A 1Z6GA 4FKZA 5C7YA 4EITA 4BEWA 5F7ZA 5IJ9B 4D9IA 5DBGA 4RZIA 2FN3A 4H31A 2Q5CA 3ZWBA 2XUQA 5I9SA 4B3XA 1E1NA 1AJEA 1V11A 5JH7B 3A9TA 3U7EB 3UQYS 2P9FA 2HRCA 2Y27A 4BB5A 4DPMA 4X20B 3BX1A 3T06B 1AIPA 1UINA 4UVEA 3SIRA 4AYXA 3W2HA 4EGAA 4KR6A 1UPAA 5E38A 2BFFA 2OORA 3OIVA 2VDMB 4YAGA 2ZAYA 2XA2A 5L8VA 4PYOA 3CS3A 1ACJA 1LJUA 1WCIA 1K1EA 3D6MA 4FCWA 4RVGA 2CFCA 1FTWA 2AUTA 2DWQA 1T6YA 1P8JA 4F21A 4FR2A 3V80A 2JANA 3VXKA 2RIRA 1GKLA 2AD5A 5AP9A 3FAZA 1YB6A 1F8GA 2ZRAA 4MVJG 2IPOA 4E3ZA 5CD9A 1MENA 4EG1A 4IYRA 3GLKA 4MPJA 1OFTA 4HTFA 3C5VA 3LWZA 2CBGA 2C2BA 1EQ2A 3IPYA 2D62A 1QZUA 2EKQA 4C4XA 3MQFA 4IF6A 3UMSA 1U2GA 1DRWA 2D1FA 4RPJA 1R0XA 3HVKA 4HLUA 4YV1A 5A9TA 1ECGA 4P83A 1WOYA 1UJXA 1IK6A 1GUAA 2AMYA 3CIFA 1H9AA 3Q7EA 3RTEA 3QKSA 4DARA 3D0QA 1RXUA 5AVKA 1Y6JA 3I45A 2ACWA 3UMVA 4U9IS 4E5YA 2MU1A 5JCPA 4EIWA 4QIHA 1SVLA 4YJDA 4F4FA 5IJWA 2SKEA 1D4AA 1OR8A 3BC1A 3AR7A 3OPMA 2RGAA 5DGIA 3R7WA 2QRUA 4KKVA 4OSPA 4Q1AA 1DC5A 2I91A 2V96A 3REQB 3RAGA 3AUKA 3TWOA 3LUHA 1YIDA 2CV1A 1IHDA 1Z2EA 2ZIAA 4X71A 1FYDA 1XZIA 1KI3A 1N2SA 5FB3A 5H68A 4PLCA 2AFIE 2WJ3A 1Z37A 2D5BA 1EEXB 4JDPA 4CM9A 4YUAA 3TF5A 1SG0A 1Z5WA 2AC4A 2HLDD 2CDBA 2Z83A 3LBYA 1TL7C 3I8SA 4IJ5A 4LVOA 4YNBA 3FNIA 1GFSA 1X38A 3ZK8A 1FFGA 3HU2A 3IOMA 5KAPA 3N5KA 3L05A 2QXYA 4F12A 3FIJA 2I6QA 1JHPA 4HUQA 3AHCA 3BXFA 2ODNA 3DAPA 4XSGA 1RLJA 3UBTA 4BNHA 3TQCA 1MIHA 1M2NA 2AJCA 2QTGA 2FPGA 3AHDA 3HVHA 4FJ1A 4XGRA 2QN2A 4H4CA 4DWWA 1PJLA 3HY6A 5JY6A 1J8DA 2QG4A 1NGSA 1YR3A 4JZYA 2GYWA 4C7BA 4MTCA 5C53B 2BSAA 3T5AA 4B3HA 1TQ2A 2ZJ7A 1FP6A 2VOJA 3A27A 2WNIA 2FW8A 2XKAA 1IEWA 4ZOQI 4N0QA 2HU2A 1U2PA 2J5RA 2WSYB 3PFBA 4AU1A 5JEJA 3GRKA 4MKFA 4EJ6A 5LDHA 1D2HA 3OEHD 3DONA 1C3VA 1NJ5A 2WFZA 1J9ZA 4BV9A 3GA5A 1PVDA 2YWBA 4KOEC 5BSHA 1H3EA 3WVNA 3OQIB 2NAPA 3T1QA 1QU3A 2BRUC 5IHXA 3B1KA 3QUQA 5BPFA 2V98A 2JLBA 2LVBA 3Q6MA 5JSKA 5CB4B 1GPWB 1CY8A 3HXTA 1KMCA 2FN4A 4NPHA 5FFNA 2YY5A 4DGSA 4KREA 2CZQA 1Q0SA 2XD9A 2YHBA 3EFHA 4LXQA 4UUMA 1DEAA 5H80A 5HCNA 3PEYA 4ND1A 1V95A 1XZNA 3E35A 2Q7DA 3EPKA 4DNFA 3LUAA 3OJOA 5AIBA 4UXHA 2YJ3A 3L8GA 3FDFA 1FW8A 3IXLA 5T4BA 5KNDD 3QYAA 4OBWA 1Q0UA 3P0IA 2VLBA 1MB4A 2OHJA 4RWEA 3UCFA 1IVSA 5FQOA 3IMCA 1QGOA 2XT9A 2GEVA 1YGYA 3E1GA 1I9CA 1LBTA 2I03A 2P40A 2B2NA 4K6KA 4ZZ2A 4UOEA 1HDIA 4LX8A 4QWWA 3I1FA 2W4MA 3T9CA 3C5EA 4H4DA 1G5QA 2RD2A 1XNHA 4YGYA 1RI1A 4EHJA 2WUDA 4OVKA 4YCNA 3NJ8A 5TX7A 2MSWA 3VTFA 2PUHA 4TWZA 4WZBA 1ZH6A 5DWDA 3W5UA 1UDBA 3GPIA 3GUHA 3WAGA 1GHTA 1CUEA 1XU9A 2I6UA 3OE5A 3OPYA 3CLUD 4GRIA 5BT8A 3HN7A 3FRIA 5C35A 4IQ4A 2B83A 4KBGA 5EZ6B 1J6UA 3NIDB 4MV8A 3OU7A 2AQKA 5FUBA 1ZVQA 4LFAB 4UPEA 2NU8B 4F85A 3V1KA 5CU7A 1KI2A 421PA 4MR8A 1QYRA 5IDQA 1AN9A 1EJ0A 3ULKA 1PR2A 1RS0A 2Z8YM 1PS8A 3F7OA 3P9RA 3TQTA 4D98A 2C9DA 4AZ0B 3AW8A 2CF5A 5K3AA 1P61B 2VBCA 1N1GA 1SVMA 3LPNA 4BMNA 4UTRA 3ET5A 1MTZA 2ZZMA 2INGX 4RJTA 1YVUA 4KRXA 1RI4A 1J2UA 2QYSA 3IILA 4HZUA 3AEQB 4NJEA 1GY8A 1NDHA 2C3MA 4NYIR 5DM0A 5BMVA 2UZ4A 3EYWA 1WB5A 4L8YA 3P0EA 1VKNA 2VHQA 3DXZA 3BK1A 3M6UA 4RD2A 3ZY6A 2J31A 2B94A 1AE1A 4R8VA 5ILQA 1TEVA 4KLAA 2QR2A 3KPJA 1FQJA 4MI1A 4UHDA 3C15C 2ZBPA 4EB0A 3WMXA 2ZWPA 3F8SA 3U4QB 4AYWA 1UHTA 1E20A 4NVRA 2ODTX 3LNTA 2Q4TA 4NEQA 1LRLA 5BNWA 4EBBA 1SCUA 4CV1A 1T5DX 1Y6FA 3CRW1 4PPFA 2J3IA 1EVEA 4KMRA 4JLVA 4ML3A 5C80A 4MRVA 5CFZA 3N6RA 1OPRA 2A9KA 3BTVA 5CH8A 4OEHA 2ZRIA 5EJ8A 1O96B 3Q0IA 4JP2A 5BW5A 1L7EA 1M74A 2YYZA 3CE9A 3ICWA 4YIKA 4C0SA 3TR0A 2ODEA 3KYBA 4YDSA 4TXNA 1MN6A 4ZQEA 1ULTA 1YR9A 5FNVB 3AR8A 1UDCA 1BFKA 4OXYA 1UOOA 4TZTA 5TQJA 5AXBA 1OIXA 2Y77A 2ZT5A 4KO1S 4EDFA 9ABPA 5EPUA 4JOSA 4P86A 2ZUFA 1BN6A 1RXCA 2J9ZB 2Y2VA 4UZEA 3G8AA 5DBHX 2OMEA 3F74A 1QPGA 4EB8A 4KFSA 4QM7A 3NAQA 1DTEA 4V3BA 4MCJA 4OHXA 4WXRA 4LHVA 3SFVA 4G37A 3RQSA 3SQWA 1BE1A 2Z2YA 1C0EA 1OX6A 2ZUUA 1AGXA 1JLLA 3B13B 4GOMD 4WECA 3U26A 2DM6A 5KVCA 1HG0A 3A3YA 3DNPA 2HDWA 4ER7A 3ZDQA 1TUEA 4FMPA 3AI3A 1OVGA 3B3QA 5C3MA 2WWFA 4KGXA 4CMGA 2ONKA 3EAGA 4FC6A 4XI9A 1U63A 2LWIA 3BE5A 2FUG1 3AZPA 3QBEA 1ESMA 1I24A 4OGLA 5D5QA 1YJMA 5GOZA 5B36A 4WDRA 5LZ4A 2QRNA 1R9MA 4TV9F 1O94A 2MWMA 4Z9AA 5CLFA 1Q77A 1S4MA 2FKAA 5CR9A 3T6KA 2Z2KA 3UY4A 3DMDA 4YJFB 4HRVA 2VTVA 5CYFA 3M7IA 4E88A 1SD5A 1FYVA 1PZGA 2I3DA 3V55A 1I10A 2NSYA 3AO0B 3GCDA 1RKBA 1LGYA 3W9UA 5I7FA 2MSDB 5B58C 1EU1A 3QA3E 3PUJA 3MAGA 2EF0A 3D7NA 4TMFA 4JEUA 1UC4B 2ZRDA 3DTVA 3LC2O 1OZGA 2ZJ8A 3PQ3A 4HB4A 4MRRA 3GJQA 4U2DA 5AKXA 1LY1A 1MRNA 1TKAA 1GR0A 3ZWVA 4GYWA 4NCKA 3L7CA 4C0JA 4RK1A 3AEKB 4R6WA 1RRPA 2BHLA 4ME6A 4U2CA 3TTSA 4B6FA 4F56A 1Z4NA 1PSWA 2PK3A 5BWLA 3WSWA 1EA5A 1U0JA 2ZRGA 3EFOA 4KIFA 1XQ1A 3SSAA 3K2EA 2FB9A 1P19A 1XLTC 4K8RB 4LXUA 3H3FA 2QQ0A 1B0AA 2B7LA 3AUUA 5FF9A 1XC7A 5E6UB 1Z56C 1ECBA 4R41A 3U1BA 2IDKA 2WJ6A 1CY2A 3CRNA 3JWGA 1K7FB 1NMSA 1SA0A 4LI3X 4LJ8A 5K8UA 2II6A 3B3AA 4D9CA 4GP6A 4DDHA 4TM7A 2P9JA 5B58T 3LS2A 5HIKA 1JHVA 1CE8B 4G0PA 4HWKA 3P9SA 4CPDA 4RIGA 4MS4A 3E7FA 3RVNA 3W8NA 5DWQA 4O2BA 1RQGA 3BWEA 1CVRA 1FQWA 3SAJA 1OAKA 2I6FA 4EF4A 1Y48E 2ZJZA 4MMZB 3L1IA 2X5XA 3DW1X 4O6VA 3TK1A 1R8JA 4XOIA 1LNSA 3MRSA 5JQWA 1XQ6A 4WLVA 4PX2A 4K1LA 3WJ1A 3AHFA 1UFRA 5AVUA 1JIVA 1KEZA 4C7JA 1S8OA 3UXYA 3X2FA 3T5TA 3GT4A 1G16A 1YL7A 4MR9A 4PZEA 4YRCA 2A58A 5HQJA 3UWSA 2O20A 3A3NA 2BMWA 1L8OA 3PPWA 1JFVA 2XTAA 2DTXA 3B60A 1VG8A 3QEBZ 4NCJA 4CMCA 4OP3A 1BGXT 4I46A 5LKAA 3AP3A 1YA4A 4HAWA 3ZHQA 5B6IA 4FQ7A 3CCCA 3RKUA 3Q98A 3AF1A 4RW0A 1JKXA 4JHLA 4PVCA 1PFVA 2UXDB 3OSUA 3UW3A 1TIKA 5HXAA 1LH0A 1PVVA 4PY2A 1CIJA 1DSSG 4EOGA 3G85A 3ZLBA 4D26A 1H65A 1SZPA 2B4YA 2J85A 3CHYA 4LOLA 4N12A 2X13A 1WXHA 3EGXA 4U8HA 1NVAA 3AESA 3EPLA 4QECA 5KAMA 4QO7A 3MJVA 1I6KA 2O8EA 2X5KO 4D74A 2QX7A 5EZYB 4NLLA 1SCIA 3WMFA 3UMMA 2QZPA 2HUPA 4FFWA 1BX3A 1QTRA 2C1ZA 3TSAA 4ZHQA 1JHZA 1KMHA 5K4GA 1EESA 1K7XB 3KQTA 2WV7A 2BFMA 4JA2A 5KTPA 5I5GA 1EUCB 1QK3A 1RJWA 4RH3A 5CDSA 4KIUA 5EY5B 1YASA 5AW7A 4XJVA 1FYFA 4U5XA 4ACBA 1IJEA 4GDFA 5AM4A 3TPZA 4AKTA 3O8CA 5AW0A 2QJOA 1N32B 2RG7A 3HUDA 4Q48A 4EVQA 2H1WA 4B6PA 2AFFA 3JASA 1XCOA 3GRAA 1E2IA 2XXJA 4I1RA 2DHEA 3UOGA 1TZJA 4NSNA 4N0MA 3N0WA 1V5WA 1UCFA 3PRJA 1CR6A 2AEJA 1R21A 1HDYA 2B92A 5LUBA 4OA8A 5CTJA 3V2UA 4B32A 4J49A 4JGBA 2BDTA 5LJIA 3OQNA 3IQDB 5LOVA 1BA3A 3DAOA 4PE5B 3TD6A 5FNVA 1DWPA 4YV2A 1QP8A 4RGVA 1CRZA 2JJ8A 4RK4A 4Y6OA 1PFGA 4MYHA 1VRWA 2FMIA 5J2TB 5BT9A 4UOZA 2YV4A 4CM6A 1OIVA 3GJSA 2Q2NA 3ZEAA 3QOWA 1ZY2A 4R8KA 3R7SA 1HLPA 3GJ7A 1TYEB 3D0KA 5ESDA 2KLHA 1NBWB 2HBZA 2OAEA 3NDJA 3PYMA 4WWHA 4X63A 1A9XB 2GBPA 1OILA 4LRQA 1E79A 5FA6A 2MINA 5ILGA 4CBVA 5I7HA 1QU5A 3GYBA 4JQOA 4TWBA 3TTUA 4IS3A 1PG0A 4YRBA 2YYSA 4LJLA 4Y1GA 3KBBA 2DBZA 3BIWA 3CF0A 4N3GA 2WVJA 3Q8MA 3ZXUB 4C03A 3MUFA 1XGKA 3GMIA 1CY7A 4G5GA 5DPMA 3WDLA 1Z6YA 3TLBA 4CR8A 4M9ZA 3U7QA 2Q9AA 3I04M 5D1HA