3V8MA

Crystal structure of nad kinase 1 from listeria monocytogenes in complexe with 5'-azido-8-bromo-5'-deoxyadenosine
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
257
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 72
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8mA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8mA01
3V7WA 1Z0ZA 2QVLA 3V7YA 5DHSA 4WERA 3PFNA 3VZCA 1YT5A 3V8MA 3VZDA 2JGRA 2QV7A 1U0TA 2I2DA 1SUWA 2BONA 5DHQA 3T5PA 3VZBA 3V80A 3S40A 5DHPA 4L02A 5DHRA 4V24A 1Z0UA 1Y3IA 1U0RA 2I29A 3V8NA 3AFOA 5EJHA 4DY6A 3V8QA 4WRRA 2I2AA 5EJIA 5EJFA 2I2BA 3V7UA 1Z0SA 1Y3HA 2P1RA 2AN1A 3V8PA 3V8RA 5EJGA 2I2CA 5DHUA 5DHTA 2Q5FA 2I2FA 2I1WA 4HAOA
chains in the Genus database with same CATH superfamily
2WUFA 3CUEF 5F9MA 2JCBA 1EP9A 2V7PA 5L53A 3G0CA 1NUQA 1QCDA 3HFRA 2IU6A 5EQFA 1GEGA 3ZXSA 3PPWA 1NJSA 1FHRA 1G7CA 3IQIX 4MQ6A 4JEMA 4QDJA 2P0EA 4IIXA 3HU2A 4AO6A 2BFCA 3A7EA 5H02A 4CQMD 5LIRA 1T3HA 1ZI9A 2HSDA 1CDZA 3T7TA 2VSXA 3FKQA 1FL9A 1GZ7A 4EECA 4PLGA 4PO8A 3ZQKA 1G9XA 4YR7A 1K92A 2QUIA 3B6MA 4PBSA 2ZT6A 4M53A 5LP6A 1IN1A 1GSIA 4KP7A 2UYCA 2AMJA 1T26A 1L5OA 1EDZA 3EQ8A 3PXCX 1JT9A 3RAGA 4W5TA 1G3GA 4RJLA 1NNI1 2VP0A 4WNYA 2F9MA 2I78A 4LHVA 4RZIA 4EABA 4C3VA 4HUQA 3VZSA 3DHNA 2JGNA 1ODLA 3GV0A 3R5HA 4KCGA 2O3SA 3UT5B 4EI2A 4DR2B 4EJ0A 1PEYA 2PHZA 4Q6BA 3WGTA 1KDVA 1KRWA 3HO8A 4LXHA 4EQ6B 5KKNB 3HUEA 1C9EA 5CJPA 4ZVNA 3AF1A 4JLSA 1JEDA 6AT1A 2ATXA 4UUMA 4W7HA 2GZ3A 3VPAA 1IHYA 2JD2A 1C80A 1N6LA 4LK2A 1PX2A 1HOXA 3N3BC 4KPUB 4MR8B 4TXLA 1CZRA 4AB1A 5JD3A 5HRAA 3N2NA 3UOWA 1ZL2A 4R0MA 4CF6A 2H2HA 1WTAA 1QHYA 1T1IA 3NHMA 5JJBA 1E3LA 2WNIA 4X92A 1NRJB 2OLEA 3HA2A 1JEQA 3IPCA 5KWEA 2HY7A 1RQNA 3C3MA 4KWEA 3BFPA 4K2HA 1UKVY 1UEIA 4PVCA 2I9PA 3T9DA 4CLEA 4IQFA 1Z8DA 3VZCA 4B7AA 5CB0A 3NFRA 4DZRA 1UC8A 3C3AA 4JQZA 4NAUA 2Y8EA 2ZBDA 4OFZA 4Y2TA 5GWXA 3UFXA 3MTJA 2IDZA 2XWQA 1W7AA 5C8XA 1JSRA 2GS9A 1O5TA 4BGUA 4EA7A 2JD1A 3RGWS 3E9RA 1P1HA 3KFLA 3B7PA 4EK9A 2I7TA 3SHQA 2ZOSA 1VA4A 3ZU2A 2ID9A 4KIWA 1KYTA 4TTJA 2C57A 3C6XA 3ZQ4A 2IK8A 2NO1A 2C2YA 3LFUA 5EUQB 5TPZD 1N25A 5LP6F 4F71A 3F47A 3PQ7A 3LDUA 3PWTA 4BC1A 4E33A 3KO8A 1QTQA 2H2FA 5A7GA 5AJVB 2O8VA 4XASA 3THWB 2CT8A 3VNUA 2GK3A 2YCBA 1Y98A 5EMHA 3ZD7A 4B3GA 3VUFA 5K7SA 3ORSA 3J81A 2MWMA 1YDGA 3TW0A 1RU3A 4B33A 5BN5A 3MLBA 4DR4B 5E8JA 2ZU6A 2XV1A 3P7MA 1SXJD 3EIHA 3DT6A 4LRQA 1IHOA 5KJEA 1WLYA 4DABA 4EZIA 3K96A 2QTAA 1P73A 4MDHA 5DGIA 1REQB 2AT1A 2YH2A 1MV8A 4RHCA 1E20A 1YB1A 1V1RB 2VPPA 3ZKAA 5E6RB 4L95C 3BGDA 4KRYA 4LXIA 3K9QO 5HA5A 2L69A 3H8JA 2QUKA 3C8UA 3I9V6 4RE6A 5TJ9A 3I6MA 1U5BB 1PV2A 1PT5A 3E7PA 3I6BA 5G0VA 3VU8A 2BLNA 1C3OA 5BW6B 1CPYA 2VQEB 3RUPA 1L5FA 2INGX 4II2A 4Y7CA 3L43A 4NJMB 3EGVA 3EXFB 3OM8A 4B8ZA 2HKIA 1QZZA 4IAOA 3RVNA 2JGAA 4ZWNA 4IGAA 5E1OA 3KQMA 1MQ8B 1PWHA 2ZJ1A 4J07A 5KYYA 1B0AA 1C7QA 1M7GA 2I2DA 4UUAA 2GHIA 4CM9D 4PHTA 5CA0A 4ILEA 3TL3A 5JAHA 4UHFA 1FOEB 2X7HA 3BJIC 1DTEA 3BCUA 4IP0A 5JSFA 1RI5A 2P78A 1ELOA 2E7ZA 2YWBA 2ZJ8A 3IKLA 3LKZA 1GFIA 1Q20A 4DKJA 2BM8A 2I54A 2ZETA 2QRKA 4P7GA 2HD4A 4EIWA 4PAMA 3HYCA 4N5LA 1QQTA 4YMTA 2AQKA 5AXAA 1WP9A 2E49A 2E4UA 2J5RA 3LOPA 1TTPB 4B73A 1CRLA 5GVSA 5AI5A 3PO8A 4L78A 3OQIB 1G2IA 3PDIB 3RUCA 1K3JA 3IA7A 2WIFA 2KB3A 3U48A 4TXJA 5BN1A 1XA0A 2Q0SA 3JY6A 4KVGA 3MT9A 4DLAA 1XMOB 4NFYA 4TXNA 2G63A 2OKGA 2YJ6A 2C9CA 1DBSA 3COZA 3SLRA 4DSZA 4XIYA 2QG6A 2GBGA 1T2DA 4W63A 5BQXA 2EFGA 1G1AA 2WTBA 3CNNA 3FNHA 5HM8A 2Q9UA 4JJ8A 3RT9A 1E2KA 3ZPXA 1E2NA 1HMPA 3H83A 1UOOA 1M1XB 2O2IA 4O3FA 5A02A 1DC7A 3K70D 3UBTA 1BJTA 3L6CA 1NYQA 2ATIA 3DOUA 1C2YA 1P9OA 4Y6GB 1UIRA 4PSDA 3Q40A 3TDMA 1SXJE 3BQNB 3VI4B 5DASA 4REQA 5CLHA 1K98A 1SJ9A 2Z5VA 4EY3A 1BX3A 1PR5A 3GLIE 3BCRA 3GBVA 1K2VN 4BQFA 1SBIA 1AV6A 3T35A 3GMSA 4D2IA 2AEEA 1KDTA 3QELA 3W9SA 1LSOA 4ENTA 4MW0A 5K0BA 4WGGA 2ZFUA 1UEXC 1VCOA 1XQ6A 4H3KB 1TI7A 2OKCA 5C52B 1AKNA 2XYRA 2YXPX 3ZVMA 1QC5A 5EMJA 1FSSA 1YQ9A 2EP7A 1U0LA 2QWXA 5IJ0B 3BQ9A 4CCSA 1I94B 1I2BA 4BO5A 4CF5A 1WMBA 4OLJA 4M7PA 2F2TA 5BSTA 2BTOA 4YMVA 5A06A 1GPDG 4I7EA 4V3BA 2DM6A 2Z3WA 5A4KA 4WXPA 1X94A 2WHYA 4PYQA 1PJ8A 2AZTA 4NHOA 3QE0A 3RYHB 1RLJA 1RPJA 4F5WA 1HRKA 2ISQA 5CIQA 1J4OA 2WUWE 1E0AA 5HF6A 2ZIEA 3M83A 3NYRA 1D5WA 1I01A 5AJWA 3TR0A 1VIVA 5T3UA 4ETMA 3GRUA 3GJSA 4LC0A 3NV9A 3SX2A 4HRXA 4G5XA 4N0QA 3VO8A 3MT7A 4UVGA 2D1FA 1E3WA 4BN5A 3FKSA 3PLRA 4N8DA 4MRAA 4Y2YA 5AOAA 1T0PA 1XHEA 1GV1A 2CLLB 2QIOA 3LHDA 5IUNC 2LXNA 4IF4A 4KSYA 2MCFA 1XDDA 4GGMX 4JBWA 1J5EB 3HL0A 3UJPA 2GAFA 4CMAA 2OQVA 1CNFA 1J1ZA 2X8AA 4LQ4A 3RAPR 5A3JA 1N34B 4D8UA 2IC5A 4QE3A 1X1BA 4JLKA 3I42A 3I12A 4LWOA 5CW2A 1YJMA 5DIZA 3RHZA 3RIYA 3WZ2A 4TKVB 1T15A 5TEVA 3EZNA 2CVHA 5JYBA 2O1SA 5EHGA 4X1KA 3SNHA 3TQFA 1FFDA 3EGIA 5LM3A 4OYRA 4OHVA 1MLDA 4A27A 4ISBA 1AX9A 2BDTA 1R0CA 3G2KA 3ND6A 3DLIA 1HT1E 5CXXA 3GLRA 2PRZA 2X3YA 4B6SA 4WLOA 1YJ5A 4BMCA 3I61A 4DC9A 5KU7A 2F4VB 1CUUA 1MPXA 1YBMA 3H9JA 3CT6A 2CHFA 4X97A 2AN5A 5BV2P 3SIRA 4BVLA 1N9ZA 4MQUA 2BFMA 3TS1A 4B9EA 1IM2A 2R66A 2E5LB 4MWOA 2AJLI 2R6JA 4OB6A 3WK5A 3FFWA 4TKLA 1WDMA 5FOTA 3F96A 3MJRA 4JVNA 3FWHA 2J0UA 2WE8A 3H7AA 4YROA 5WRFA 2HSGA 2R8PA 3L0PA 4P2GA 5DWVA 4KFCA 1QVAA 2OO3A 4FILA 4MDEA 1GZVA 1P0MA 3LX4A 5HR5A 1WEKA 5A1TA 2WT8A 3X1DA 3ABQB 3TLJA 1I3NA 1FDIA 4WNAB 1XRNA 3KEMA 4M0LA 5D7NA 5JT1A 2SHKA 3GJ7A 2GRUA 5JYEA 5M2QA 5G1OA 4YPVA 3QF4B 3U19A 1X39A 2HRDA 3A04A 3QPWA 3KIPA 4CVNA 5IF3A 3K8YA 2W98A 1NYTA 3EJWA 5C7LO 2XKJE 1N0VC 2ATEA 2FXVA 1G8PA 2LW7A 3CEMA 4MRSA 4X8OA 4OBXA 4FYMA 3AG6A 3TJRA 1S2NA 2Y0CA 3DLTA 1C41A 2HB6A 4HYTA 3TRDA 3K0SA 2XQGA 3GP8A 2C82A 3B85A 4C21A 1QH1A 2YHSA 4O5AA 4IDEA 1ZS9A 1T4CA 3PXUA 3AU9A 2VTBA 2P2CA 4PQEA 4DTCA 3OTQA 3OZGA 5EZYF 3TD2A 1TGVA 3B9BA 3TTSA 4BRUA 4EM6A 4MWEA 3VC1A 5L7WA 3V1NA 2QU7A 4ZANA 5I9NA 1YFZA 2DR0A 1YRQA 3LCMA 3GIWA 3L6EA 3Q98A 4OY3A 2NPFA 3MMXA 4TRMA 4EFLA 2Z08A 5LCXA 4O2BF 2FSUA 4EHKA 3KQOA 3FOFC 3KB1A 4FT4A 5D3MA 1W5TA 4PSKA 5K3CA 4P83A 4CDRA 3O8OB 4BHTA 2V6FA 3H9CA 4QRHA 2V1UA 3RRBA 1OH6A 2ET6A 2RHBA 1VL8A 2PL1A 2FF4A 4JJ6A 2QJTA 2PLAA 3MUOA 4TT3A 3VNVA 2JRLA 1AOXA 5KJ6A 5L40A 1T6NA 1WCXA 1OE0A 2H7CA 3GRFA 1YB6A 1CUEA 4JL6A 4ARCA 4JLOA 4KO2S 4MDYA 4MV4A 1KKLA 3L6DA 2L2QA 3N74A 5LFAA 2OZVA 2G8LA 2ZATA 1P62B 2PUVA 1NY5A 1F2UA 2WAOA 1C8LA 1F20A 3N58A 3S2GA 2A14A 1QE5A 2JGLA 4ZVOA 2ZCUA 3LLUA 3ZZNA 5C8VA 1PL8A 1PTJC 1FXSA 4GD3Q 3KT8A 2DWQA 3FTPA 4HZGA 3IOBA 1TA0A 2CFTA 5G4KA 5IABA 3SQOA 4W5HA 1M2JA 2DFTA 2EZ8A 3R0VA 2OGSA 1ETHA 3MMSA 3O2NA 1XD9A 5T41A 4M38A 4QDZA 3JZAA 5BV8A 2Z3VA 4XEHA 3TPCA 4W5QA 4LYEA 1W73A 2EW2A 2HA2A 5KDLA 5LYJF 3G0HA 4JYCA 2QMQA 3RLFA 4C01A 2F43B 1F6WA 2RI0A 2X2FA 4PLCA 3OZWA 2FPXA 4LEIA 5JNUA 2X3UA 3QKSB 4DMMA 2OILA 4JLJA 3UICA 3ZI4A 3GFOA 2QGZA 1V8FA 1C7IA 2XH8A 1BFUA 3MRSA 3O4IA 1L7MA 2V59A 3VR6H 1Z39A 2O07A 4QTYA 4LF7B 1SEPA 4Q7QA 1R21A 4OHCA 3E23A 5K0FA 2V9PA 3W5DA 2Q62A 3L0ZA 5IKXA 5DULA 4OTZA 1P4GA 1AGYA 3LHKA 5HKKA 5EXTA 1GEEA 2ZSHA 4H17A 2IZZA 2WFLB 2XEDA 1GNRA 4FOSA 4GMFA 3SX4A 3VU1A 4XD2A 5BSVA 3SYNA 4RA9B 3BMCB 1NUUA 1Z33A 3K6RA 4ZPJA 1J90A 4X3CA 3NANA 3KR1A 3SJ7A 4Y2SA 4Z1MA 2XA9A 2PJUA 2PWYA 3DF7A 1RRMA 3WZLA 3EDOA 3A1UA 4XLLA 2ZRHA 4ZMSA 1UBFA 5JFGA 1QSGA 5DBEX 3HZOA 1VC2A 1PNRA 2FEXA 1IJEA 4EHHA 1KH1A 3WYEA 3OIFA 4FQ7A 1IY8A 1G291 3NWJA 2X5XA 3KPUA 1T5IA 4GRIA 3VHRA 4B44A 2PLNA 3JWPA 2AOUA 3QXCA 5SV2A 3P2JA 1EP3B 4TLCA 4WLNA 2GNOA 3PE3A 3UGJA 4CIXA 3EFOA 3K16A 2PVSA 4IX1A 1YVUA 2QOEA 3QU5A 3WV4A 3GUVA 4KXLA 2HPHA 3SJUA 3SEAA 3I2KA 4I36A 4FLMA 3EYAA 1XAIA 4HNUA 5LWQA 5CB4A 1XXHE 5CLLA 5CDSA 5EJ8A 3HJAA 4PZ0A 5HE8A 1DBVO 3UZUA 2JIOA 3ZW7A 1DADA 1Z9BA 1KSHA 4UAGA 3LNCA 1GPUA 2JLUA 1E9CA 1QLJA 1X8JA 1XMQB 5DV9A 2FSSA 1BJKA 3C3JA 2H1IA 3A1NA 1Z25A 4CT5A 4AJ4A 3B8HA 1SBNE 2GMWA 4US2R 1QQBA 1GJRA 1R0SA 2AZXA 3AV3A 2B5VA 4HTFA 1DHTA 2R5WA 2XMBA 4UM8B 2F3TA 1D8TA 4QQ8A 4CM3A 1OC2A 4WBXC 3UTDA 3X1XA 3LQ2A 3TR6A 2VQDA 3ENKA 3O3CA 1Q0UA 3KKZA 2C4VA 2BTQA 3H2BA 4BVGA 1BDIA 4AI6A 1V8OA 1Y3BE 2WJHA 4C0BA 5B1HA 2ANCA 1DEVA 3HJTA 3RFCA 4QYTA 3GEHA 3OD5A 3W5VA 2O5EA 3BFJA 1VSQA 2ZRBA 4IQ4A 3CUUA 4I2VA 4J1TA 3GLUA 2QTVA 4TXHA 3THYB 1N6NA 2YY7A 3GVXA 1NXXA 1XYYA 3JV7A 4MVXA 4DSUA 2RGCA 4Z6KA 3K0KA 4KL8S 5L51A 4GPIB 4C03A 2WHRA 3MSCA 4OKIA 4CRWB 1BXRA 4DQLA 1KVQA 2PYDA 5I47A 1N0UA 3CF4A 3V00A 5JU6A 2LWIA 1FNMA 4QD3A 1YMUA 1H3FA 2IUUA 3Q7QA 3MAAC 3S44A 1V37A 4MQ4A 2CMGA 3TOZA 4B84A 4RIHA 2ECQA 2QD5A 4DL9A 5AUNB 2IL1A 2ZYAA 1SU6A 3B1VA 3CZ9A 3KZVA 4I5IA 4J2TA 4P80A 3GRRA 3MIIA 2Q6VA 4FFNA 4BZWA 3QI2A 1H6CA 4OHFA 1L4BA 2P3SA 4ZHQF 4MUMA 3O4GA 2VCEA 2FFQA 4ER6A 1P4RA 2PBFA 2XRYA 1A7KA 1V39A 4WACA 5TNXA 3CEAA 1JIXA 5CB4F 1SIOA 3SLKA 2AFHA 3KOMA 4XFDA 4PNPA 4LMBA 2D1RA 5CU7A 2JFHA 2FCAA 3F3SA 4P3PA 1BHQ1 2Z2KA 1ISJA 4NC9A 3WHKA 4QXMA 5DYYA 3A37A 1ZOOA 1MB9A 1NBME 1OR8A 2GDZA 3V4RA 3Q3JB 4D6XA 2XRFA 1O8CA 1Y9AA 2DT8A 1A2KC 2QAGB 1HDEA 4I4NA 4IDGA 4OM8A 3VO9A 3AIKA 3D7RA 3NWEA 1UPXA 2D2IA 4B79A 4EJMA 4XRGA 4AVYA 4BQEA 3OZDA 3WBJA 2H08A 4BN0A 4CL0A 3R74A 4EP1A 1WCWA 2IHYA 3B2NA 5KDOA 3DFZA 4COOA 2XCUA 1DTSA 3H04A 3LP6A 4JEHA 1UJCA 2Z2JA 4PHHA 3U80A 1II0A 4A7PA 4QYXA 4E31A 5ENDA 2DTXA 1O58A 2BFFB 3ESAA 3A6GA 4C5CA 2FWPA 1R4AA 3IQWA 1P7CA 4HDRB 2OEPA 4Z9AA 4EGCB 4X3OA 4LMAA 3K35A 1S2OA 2UZ0A 1JFFB 2JCSA 4MX8A 4WW0A 4B34A 1Z75A 3EGXA 3D4BA 3GELA 4BC0A 4DVJA 1FQKA 4MQLA 5IDQA 4PLHA 2P69A 4GUAA 2WYUA 4FSXA 4D79A 2HV8A 4FR2A 1GNSA 3I6ZA 4KDRA 4QGAA 1IY1A 3HBFA 5A4IS 3BK7A 1R5NA 1VMEA 1FXWA 3M82A 2HK6A 2ZR8A 5P8WA 2GTIA 2IEYA 4FI3C 1J00A 3T38A 3ZGVA 4BATA 3AR8A 2PYZA 4G5OA 4LTMA 1MJGA 1Z73A 2VJAA 4MR7A 2DQ4A 4WLVA 4M54A 3V1KA 5A0VA 4FHGA 3D8TA 1RXSA 3AHCA 1X1EA 5THKA 1MK2A 2WJGA 3EQ9A 5M34A 4GU5A 5IT9A 3GJYA 3GZTB 2RHLA 4TSRA 4TZ6A 2O7RA 2ONCA 4ZRDA 1RRCA 3KQLA 3RYIB 1TUEA 1E3EA 1CJMA 3LECA 3V34A 5HJ5A 1N3IA 1Y9ZA 3PI6A 2XXAA 1N5RA 4R05A 5B64A 1PO7A 3TK1A 3VC2A 2XKAA 4PZLA 5DFAA 2C9ZA 3K1JA 3AFNA 3GFBA 1TJPB 3K72B 3MK31 2O7SA 4JKYA 3H1AA 1V6SA 3I73A 3GQVA 3IAAA 4Y2XA 4TQUS 1GQRA 4MCJA 3U3RA 5I3CA 5KC9A 5CIYA 3BVPA 4PFKA 1VXOA 1D04A 3KZKA 3QJ5A 3ZC3A 4PV7A 4D3XA 2XUPA 2QRHA 2AMLA 2BEUB 2RIRA 4PNZA 5C4IA 2WU1A 5FXMA 4B43A 5EQDA 1K2NA 3BGIA 4TGLA 5KYVA 4G0UA 1XZBA 2OG1A 1EFKA 5AVUA 2Y27A 1B74A 1VJ5A 5E9JA 2RGYA 3I34X 4GI1A 4LDRA 4UHKA 5AIAA 2XB6A 2DP4E 4LYFA 4Y6RA 1IG0A 1Y3IA 4AP5A 3OOJA 1U28A 1PAUA 2VT3A 1H85A 1FDTA 1M2GA 2PVPA 5TJHA 3WRYA 1JAIA 5I7HA 1QC5B 2BCJQ 3ELVA 2VF7A 3PGKA 2F3SA 3Q3VA 3RBAA 4NZMA 3V2IA 3ZJTA 3PNSA 4AU1A 3PXBA 4YY3B 2C2OA 5ALIA 3WTCA 1JIIA 1NVDA 1YS7A 3BZUA 3L5OA 1FVFA 2YWJA 1JQKA 3K32A 3LT5A 3U17A 4EPYA 4IIJA 4CKBB 4AYWA 1ZJZA 4BN4A 3ABRB 1FZTA 4C89A 1G4UR 1SWWA 3QLUC 4QICA 1OFUX 4RCYA 1YRHA 5CW1A 1KOLA 5E8RA 3ZGXA 1O9GA 3IE1A 4WHMA 1N1EA 3KQYA 3VYUB 5I9SA 3UOGA 4EKNB 5EMMA 3ZCTA 2CXNA 3WYGA 2BM9A 1P60A 2ZUCA 3FBTA 3KPWA 4TL8A 4C14A 3KEFA 1YBVA 1KNXA 4N76A 4EAAA 4IINA 1XDSA 3OJEA 4Q4HA 2C0CA 2CMDA 1GSHA 3FPHA 4DBLE 3OEYA 4RQUA 1KWKA 2EQBA 1BWSA 1Y80A 3E61A 3DWEX 3WLNA 3QQ5A 2AE2A 5H81A 2BFDA 2CZQA 4B5LA 1EJ2A 1PGOA 1G5TA 2HF9A 2JW5A 4NF2A 1GVNB 2GN0A 2ODNA 3LSYA 5F5XA 5CEFA 3PFNA 4YA6A 2KBEA 5G3YA 3RT7A 2AOXA 1AK9A 5HP4A 4QUAA 1B6RA 5CA1B 1E4OA 1CY2A 4ZCLA 1H42A 3WHLA 1DT3A 1E1NA 2CV1A 1IWOA 4OFBA 4MIKA 1IB6A 1G5IA 1VIAA 1T8SA 3P0FA 1G8SA 4M9SA 3BHIA 3TLAA 1AKVA 2QT9A 5ALXA 2XDYA 4U2FA 5ALMA 3RJ5A 1JZQA 2G3YA 1U3TA 5AJTA 1MC5A 1Z07A 3DC7A 2PY6A 3T3GA 1II8A 4CPDA 3S5JA 2GM3A 1YFLA 5J1SB 3R6GA 3UJAA 5AKYA 1A8IA 5ELMA 5GM1A 5JEDA 1JDSA 2I3AA 2PWAA 2QNIA 3KZMA 1Y5MA 1UC4B 1YVRA 3ZE7A 1UJMA 3NHRA 5B1YA 4LJ8A 3MJCA 1Q12A 4MVYA 4YP0A 5JAMA 2OORA 4LGYA 1AQJA 4DR1B 1TJYA 4KW7A 4CKCA 2ZXEA 1BD4A 2CB0A 1QV7A 4ENRA 1RCTE 2V03A 3NNNA 3FGPA 3I3SR 4TS1A 1F12A 2J5BA 3LO5A 4PICA 1RKVA 2W6QA 4OYHA 1PW5A 1U1EA 4A8JB 4AG6A 4EHBA 1QU3A 1QIDA 2A33A 2AUTA 1U7FB 1NSTA 3DAOA 4MAFA 2R0QC 4DJJA 1RPTA 3ZNPA 4R0VA 4YTEA 4HDNB 3DHEA 4GR9A 1U8FO 2I2CA 1R2QA 4OHWA 4QWMA 3U4DA 1GPWB 3IB3A 4Q9IA 1XQWA 2RBGA 3W5AA 1UDAA 3G1TA 4UZFA 1EGVB 3BXHA 5JFOA 2NTEA 4M9UA 2RGDA 1T4CB 2HHJA 2VATA 1IM8A 3EDYA 2MYUA 1AUOA 5FTMA 3QFRA 3I4CA 4RVCA 4AJ1A 5JH7F 4IGKA 4Q7LA 2Q1UA 4L4ZA 3TB6A 4P0QB 4IOMA 2FN3A 2NU6B 2R4TA 1K2WA 1UPBA 1IZYA 2P9FA 4EYOA 5K2OA 1T9ZA 2JJMA 2VTKA 1L4YA 3TWOA 4EHDA 1UANA 2WWIA 4KO1S 1UC5B 4EY6A 1L7AA 3BKWA 5EIBC 3OT4A 3ETJA 4IJ6A 3BIJA 2ZSIA 5IJ9B 1M2KA 3MHPA 2A7QA 3M34A 4WSOA 3KQUA 2AMFA 1RAAA 3BMNB 3OKAA 5KINB 4P0PB 4YALA 3HFJA 5C1OA 3KE9A 4DOMA 5FNVF 4LZJA 4RLFA 4Y67A 2P79A 2EDAA 4MKHA 4X8MA 5REQA 2GNPA 2H7YA 3DDZX 3FPAA 4DLUA 4OXKA 4UBMA 4WZBA 1A2QA 2QTTA 2Q7DA 4LJRA 4RHXA 4JCCA 4YI3A 1BN7A 2FZVA 4LZPA 2UUAB 1EHYA 4HRYA 1HFWA 4BLQA 3OD1A 3GG9A 4TV8B 1SA0B 3VVMA 4WKPA 4DW8A 1EUZA 3BRWD 5KQGA 1VSBA 1SVOA 4Q3BA 1F2UB 1LRKA 4MI6A 5CX4A 1SWVA 2Q5CA 2VUIB 4IIEA 5DE3A 4OLBA 2OK7A 3HXKA 1WXDA 3L06A 4KI0A 5ADUS 3JQ8B 5EYPA 2IA5A 4O4HA 2W8BA 2OC4A 3MNFA 4IMJB 1NN1A 4UDYX 3KQNA 2FZ4A 1NWHA 1A4XA 1HT3A 3OX3A 4NCNA 5BNIA 5IAAA 3DZBA 4OMUA 3T8YA 1YZQA 2OCYC 3FZNA 3KDPA 1PS8A 1RHQA 4DJTA 2PZFA 4IXWA 2FWNA 3IUJA 3M5DA 4JSYA 4TMKA 2COKA 3ZHVA 1ZGCA 4IRMA 5MHTA 3W4JA 4RMIA 3GGJA 2B1GA 3AR4A 1H94A 3THXB 2ADOA 4A10A 1C0EA 4ROTA 5CFNA 5CT6A 1ORVA 4NFLA 4URYR 4B2LA 4CLRA 3SIPA 4WFKA 4PHCA 4ZVMA 3WAKA 4BEBA 3DZ8A 4H1TA 5G0WA 1E61A 1UFRA 4DUGD 3GGPA 1RKQA 1XALA 4PTYA 3IR5A 2FR1A 4F9GA 1F8YA 3B1FA 3RLIA 3VO2A 2AKAB 3EVEA 2WMOB 2ZQYA 1M2EA 2JCGA 3GN1A 1Z35A 1CR4A 2BJVA 4UQPA 1DJQA 2LE0A 3BTOA 5CIWA 4YK7A 5T8KC 2CW5A 1RYNA 2OC9A 1EFRD 1PYDA 4WLFA 2Y67A 2X0DA 2A0XA 2PRYA 3P9KA 1NMYA 1CNEA 1WMFA 2NYUA 2OESA 3DBVO 3UK2A 5FUMA 4LV5B 1V2GA 1D0SA 1ZSVA 3AKEA 3FW1A 4EVRA 5BYKA 3JVDA 1XZLA 3FM9A 4HY3A 1XWWA 5DCWA 3DNMA 4J29A 4I5EA 4M8SA 5E7JA 4JXZA 4ZK6A 2PMBA 3BJZA 4OQ4A 5HQJA 4A1OA 4JZKA 1C2TA 3JARA 4ME6A 4AYTA 4C4AA 3FTEA 1XK7A 3L4BC 3R0XA 2LCQA 3P9PA 4O4HF 6CHYA 4D25A 1W29A 1VBFA 1CDEA 2PKEA 2ZM6B 1F17A 1GU7A 1PLKA 3Q7TA 2J3EA 5KHOC 4ARAA 2JJ2D 2Z83A 3LKVA 5HXAA 2EF1A 4FHDA 2XUKA 4GVPA 5IVDA 5T3YA 2PJZA 3PUIA 1OGYA 1VLMA 5EOVA 2YKGA 3ASZA 3EFOB 4Q7MB 5TX7A 2XNCA 4LHWA 3U4AA 2X2EA 1ECPA 3FB4A 3KL4A 4EVSA 4Q01A 3M2TA 3D6HA 3AF3A 3FFTA 1WVIA 3ODPA 2JLBA 4ENVA 3ZWMA 4MJ7A 1OZ0A 1HOTA 4E1BA 1YVPA 1VHWA 4MV7A 2KPOA 4R6XA 5E3JA 2JGEA 3DM5A 5LXTA 4XEUA 2NNWB 2WD9A 3UV0A 2REQA 1DJNA 4N3NA 2RGGA 1PHPA 3KB6A 4OGLA 1XHLA 2BI8A 4US0R 3STXA 4DNFA 3BAZA 1ECCA 3QVGA 1G21E 1Z06A 2PH1A 4LSGA 1JNYA 1F14A 1T24A 1CQXA 1XWFA 2HDOA 4YBZA 3UMGA 3PDJA 4C1NA 4EX7A 4YT4A 3IOMA 4RESA 5CGZA 1SZPA 4LXXA 1WP4A 3T9BA 3CG4A 3GA5A 2II6A 4GLOA 4P92A 3DAYA 3P71T 4ZOLA 3TNLA 1MAWA 3BDIA 2C92A 3KK0A 5COBA 1AUQA 1MJGM 3B3AA 4DA4A 1HQKA 1NBWB 4PW0A 2EFDB 3CURA 3WL8A 2Q0HA 1L4FA 2J9YB 2OBMA 4NMLA 3HSYA 5IVHA 1IEWA 4NCBA 2VCYA 1ZM2A 1QRUA 2O9JA 4QHSA 4AF8A 1SQ0A 1I3LA 5AVRA 1U0BB 3B9RA 1XZHA 2N46A 3Q8XB 1HKHA 2JB9A 1YJXA 5TY0A 1TKAA 4TL6A 3R20A 5IBCA 1OB2A 4V03A 3SQWA 1TVKB 4CR7A 2GR9A 2P1ZA 3OPYB 4G23A 4PX2A 1SUIA 3ZHUA 3E1KA 2PGOA 5KYGA 1SNYA 4BMNA 2H59A 4IUDS 1O96A 4F7WA 1P45A 4QLOA 1YS6A 1W94A 2DR3A 2OXIA 5H68A 1MZKA 1CUJA 1M1YB 3I9JA 1Y48E 4M55A 3EXHB 3WMEA 4AJLA 3LRXA 3CUYA 1W0KD 2GILA 3DW3X 1VKZA 2GJ4A 3FMFA 3GT0A 4ZAGA 2R62A 2GPSA 2DC1A 4UC0A 4U63A 5LXTF 1WPGA 3VR5H 4KE6A 4K8RB 1OFIA 1ODSA 1V5WA 1NP6A 3GMIA 4EG1A 5A6VA 1KDRA 1Z74A 3Q0EA 1X92A 2Q07A 4TSFD 4AY4A 1RWKA 2XTNA 4RFVA 5JNWA 1E0JA 3HK2A 1XCMA 1XUOA 1XZKA 2R751 2G77B 1Z5ZA 2UZ3A 3DPUA 2GK6A 2GEUA 2Q27A 3LUHA 4H7DA 4KQHA 4MW6A 3BAFA 5E4JA 3RIGA 3VA7A 5L3RA 4DC1A 2FUG1 2ZUTA 3ZWXA 3NCTA 5JNLA 4CMJA 4F3KA 1Y8AA 4Z3KA 1JT2A 1RW4A 2ECFA 4H16A 5D00A 4ZOLF 4ZEVA 4PM4A 1FIUA 2FUCA 4HNQA 2NVWA 5I8PA 1RNLA 3COSA 1ABBA 1GA1A 1Z5NA 1ZW6A 3DMNA 1ISSA 1UC9A 3LT0A 4IIUA 5DLEA 4UNRA 2O8DA 3BCSA 1BE8A 4F4UA 4U8GA 2A0TA 3DMTC 4IXMA 1EK0A 1HBJA 3FAZA 2YFHA 2YASA 4FX5A 4WE3A 3Q8KA 2A0YA 4ZYXA 3L8HA 4IS3A 4WQMA 3LTNC 2PS3A 4G36A 2H92A 4AJPA 5FOXA 3VRHA 3LK7A 3OF3A 4QLAA 2OHIA 3N8KA 1W0JD 2D7DA 4AKGA 3KRTA 1T35A 3ZHZA 3HCCA 3HYNA 1J7JA 4HFNA 4A8HA 4F9TA 3CXUA 2JLWA 4MVJG 4C05A 5H7XA 4WNIA 4DMHA 5LLTA 4RD3A 2UXCB 2EF0A 3PGMA 4QAQA 1B76A 4BMYA 3BFVA 3H4TA 3WX0A 1FFXA 5CYFA 4CR8A 4I66A 4Q05A 3USZA 5L3QB 3OLYA 4OREX 2EH0A 2ZQZA 1U9IA 5CEEA 2EZ4A 2GZHA 2CMKA 3FLBA 2B34A 1N2BA 1P6XA 4RZ3A 3S8YA 3FLMA 2VJMB 1I2DA 2P40A 5HG0A 3T7KA 4Z4HA 2Q7XA 4REOA 2R60A 5CT4A 3WMGA 1KZ9A 2UDPA 5EQJB 1AF7A 5DPMA 2D7CA 2XWJI 3KUKA 4HDMB 2WKSA 4J6EA 3OO0A 3U0VA 4GPBA 4MKFA 3MT0A 4E5KA 4XVCA 1WBBA 1QHHB 4DCJA 2DHRA 2Y6UA 3OHPA 1USIA 4J16A 1KI4A 2VNKA 4JFAA 5ETJA 4DMCA 5H9WA 2R84A 2ZTLA 3OHSX 3ZGYA 3C3BA 1KEEA 2EKBA 3UO8B 1BW9A 4OL0A 5IWAB 1DCTA 2BKXA 4ZZ0A 2BH2A 2XYQA 2KQUA 2WJPA 3FFXA 4EJFA 3WJ1A 2IUTA 1T5OA 2QKYA 2EZ9A 3TTXA 1EWRA 5AHRA 4IR7A 2IH2A 3EZGA 4G56A 3S70A 5A4FS 1XVUA 1X7HA 2QX8A 1UMBA 4URUR 4F84A 3QFTA 3R9XA 2PR2A 3Q7EA 4JX9A 4DCUA 1HI9A 5EERA 1LPNA 4GX0A 3GLHB 1BQ3A 3SP1A 1BKSB 2ERYA 2BGWA 4QO8A 5JS1A 4EGXA 2CNOA 4DMGA 1TCAA 4TN5A 2CNBA 1SMKA 5JPCA 2ZS9A 3EBLA 2WYHA 1R4MA 2HJ9A 1Q0ZA 2IPXA 1U7ZA 1G4HA 3AFIA 1GFZA 3AUFA 2ZIVB 3ENWA 2B8WA 2V5AA 3TD6A 3ZVLA 5IMBA 4DB4A 4Z53A 1Q7RA 1M9NA 3FR8A 4GBED 2J9FB 3NHZA 3M1AA 5BOSA 3WIDA 2VYVA 1TAHA 1ECBA 4GLBA 4IIJB 4CTNA 5DHUA 3A6PC 4JC8A 2JBHA 3UAXA 5I3ZA 1EXMA 2BH9A 1OFUA 2C7PA 3P2OA 4WA7A 3NQ41 5TS3A 4CKWB 5B4VA 1M1ZA 4L07A 1ZOSA 3U4MA 4LYJA 3DDNA 1SUWA 4X85A 2UZ1B 3H6GA 5B2ZA 3STUA 1ANKA 4EZEA 1M2WA 4FEGA 4GSYA 1YJ8A 3LUPA 4P36A 1XNQB 4Q4HB 3PTAA 4AXXA 1IOWA 2CXSA 4D4JA 2GPBA 4GXRA 2D74A 4ONEA 1B43A 3SS8A 3V46A 3AZPA 9GPBA 5DT2A 2JFBA 2AYYA 4KSCA 2OO5A 4NCHA 3WKAA 1KJZA 4GZ3A 4RZHA 3PQ8A 2NWQA 2G7ZA 2BFDB 4YLGA 3WLSA 3M4XA 1ID1A 3OE4A 4GKBA 2V0GA 1V0JA 1L5YA 3WISA 5IU6A 1RFLA 3PGXA 2QVYX 1KGDA 2W4QA 5K8VA 4KAAA 1FLAA 1JZTA 1QBKC 2OFWA 3ETCA 1Q84A 4PG5A 4AZ3A 3U4QB 3GCGA 2PYIA 1NLZA 1NXOA 3HVHA 3M3PA 1PYGA 3RIHA 4EO9A 3AYZB 1ESCA 4YJDA 4Z4FA 2AC2A 4YRCA 1M34B 3EF0A 1FVOA 1JG7A 1WXGA 2BKUA 3D7LA 4M9CA 3V7NA 2OCDA 5SY6A 2GYWA 1WBJB 3V1LA 1P8AA 1AXEA 3B82A 1ZKMA 1EP2B 4YXWD 5E7QA 1KKUA 3U2QA 1GZ5A 1RC0A 5MF6A 1S8OA 4WLUA 3RVMA 1QRAA 1YVDA 2C9OA 2E82A 1RT9A 2QLTA 1KBZA 1NXSA 5KQRA 2TMDA 4DCOA 4GYJA 4IOLA 5T57A 5CB6A 4DWOA 2ZT7A 3HRKA 3TQTA 5J59A 1CE8A 3DS8A 1U3FA 2DERA 1OHHD 1R8YA 2GN9A 2EDCA 4YRZA 1HNWB 2L18A 5J43A 5DLYA 1T2FA 1ULZA 4NSNA 3D3KA 4DADA 4JI2B 1VYHA 1QQ5A 3M9WA 1H2EA 4D44A 3WB2A 4CKCB 2XGGA 5DTIA 1DRWA 4L1KA 1G8FA 2NYVA 3TD9A 4KVZA 4CKYA 3NPAA 3QUBA 2PV7A 2BMWA 2WFAA 3KU1A 3EMDA 1A27A 3ZG6A 4MWGA 1I7DA 1DTWA 1D07A 3RRFA 3GZNB 5KYWA 2TMYA 2Q4OA 4BX0A 4W6QA 3VU0A 2O7VA 3E4CA 4FYYA 3WMRA 1QS0A 8ATCA 1WMDA 3KT3A 1ZH0A 4KOAA 3C7AA 1XZQA 3U61B 1A4UA 1RLUA 2B7LA 5L3SA 4B3IA 1K86A 1BRMA 1I3CA 2GD2A 4TPKA 3N2YA 2NXCA 4ZKEA 2XBUA 2FRXA 1MB2A 2FFRA 3MLEA 4UUPA 1NKTA 3DAFA 5P21A 2PGJA 2GBIA 4RZXA 4BQPA 3A7DA 4Q3DA 4DIBA 5L6LB 3SC2B 3FDJA 3DLCA 3KV1A 3T7SA 2AJ8A 2IF0A 2QR5A 4HUJA 4JQSA 2EVWX 1LNQA 2FQ1A 4KN5A 1A72A 4F93B 3K9LA 4AUEA 3L0DA 1UXIA 3TYXA 2QJOA 3CZAA 3KCNA 3HCDA 3PUYA 3KJEA 3AC0A 3BBLA 1M8KA 3RQIA 5FI3A 4PX9A 4HGQA 1F0NA 4TWZA 2XWPA 5DGTA 1RKUA 3AF4A 4A16A 4EPXA 1Z15A 5REQB 4WZBB 2NUAB 2CY0A 4V2UA 5M29A 3AGPA 4IJKA 1G7SA 1ZO8A 2ZANA 2C4WA 3O03A 3RK4A 5DRYA 1PX0A 1HM5A 2YYAA 1MVNA 2ZT5A 1FP2A 2WF9A 1WNTA 3AHFA 2VZ9A 3ZTYA 3EA5A 1X9GA 2D1YA 5DHQA 3OCYA 1Z8FA 2UVQA 3ELWA 4JU8A 1Z6ZA 4P5EA 4XD7A 1Y8RA 4LC9A 4DQ0A 5JZOA 3F3KA 1VGQA 4JP5A 4DYDA 1U5CA 4FFRA 4U7HA 4ZI5A 1OX4A 4PPFA 4FXOA 1KEKA 5KCMA 3OH8A 4KQWA 4NNPA 1H0KA 1RJGA 3P9IA 1OY1A 2O05A 4MMYB 2M6LA 4U2CA 4AKTA 4JKOA 4MKGA 5IEBA 4N18A 4EKEA 2G4CA 1XMXA 1UBEA 2PNFA 1QTIA 1BX0A 1NPYA 1U4NA 4YMIA 5C53B 1YUMA 4URWR 2A9PA 3T06B 5KOJA 5JCOA 5ESXA 2QTRA 4MYCA 2VTDA 4OK3A 1W9MA 3FYHA 2IGTA 5K0ZA 4BRSA 3U7RA 1XCBA 3JQ6A 4GMDA 5BUQA 2CJPA 4FOOA 3PQ2A 4RTOA 2W2XA 5ESRA 1UODA 3E7FA 1EVKA 2P6RA 2J87A 5EWLB 1KU6A 2FEWB 4OLFA 2FZCA 4RIGA 5SICE 5BSGA 4DQVA 1I2ZA 2Z98A 4BLRA 3E7WA 4ZVSA 3WGKA 4DN6A 2QB5A 4EY5A 3P97A 3GDOA 3VISA 2VDRB 2VNHA 2VH1A 4TUYB 5TPWB 3UTCA 4QOGA 4D42A 1EA5A 5L7TA 4NCAA 2V9CA 3QE2A 2PGIA 4DPMA 2DULA 4MGIR 3N6VA 1KMIY 3DKKA 4KQCA 4BQNA 1QG4A 1LI4A 1XC7A 1ISRA 3NHKA 3BULA 1ML3A 2I9KA 3GZ4A 4KITB 1Y6JA 3WRVA 3R8FA 3FB1A 3ZCRA 4BFXA 4Z4QA 2VNAA 2Q3CA 4IZHA 2Z6VA 5C8YF 3WSWA 2VL7A 3TEMA 3DB1A 2CWWA 3DTVD 5JWHA 2DJ5A 3TRKA 1HSOA 4GIBA 4CQLA 4C4SA 2G71A 4KQGA 4ZVKA 5J2TB 1ZH8A 1QLHA 1T13A 2ZSFA 1J2JA 4BQIA 1VYUA 2V7QD 1Z0SA 3PCRB 4JYZA 4XKJA 2FWMX 4WI1A 2P2SA 3RYCB 3AFMA 2LIVA 1GLVA 1GQYA 2C3PA 3GRZA 3PC2A 2QP4A 4HH4A 4RGBA 4R7GA 1Q83A 1EPUA 2OZEA 1C9YA 3P52A 4NZOA 3GG2A 3RFUA 1DWQA 2P6NA 3CBQA 4HAYA 2JG3A 2F7SA 1X2BA 2O2CA 4QNRA 4MICA 1JDUA 3DOIA 3GFQA 1QCYA 1V3TA 2YMPA 3UNXA 4U9IS 5TMBA 3VKUA 2VDQB 3IQDB 4DLNA 1SK8A 4ENWA 3LHIA 3A4TA 4P54A 4W7SA 3GLGE 2PCLA 3R7SA 1IYZA 3JWEA 3SZRA 5I8WA 4UBOA 2VXCA 2WVAA 2WKQA 3C15C 3L84A 2Q3HA 2VDNB 4LG1A 4LWQA 4A3SA 4C0XA 4DLPA 3E48A 2F55A 4EUNA 1Y0BA 1NF3A 3OA0A 1WXIA 3G85A 4WCFC 2IUFA 2EIHA 2PV0A 2XVAA 4DR6B 3A4IA 2EG5A 3ELUA 3HXTA 3F0TA 1JFRA 4ZCTA 2HWUA 2WUEA 1GN8A 1RFGE 5I6DA 1DCFA 4MS3A 2W71A 3HJGA 1Q0TA 5GONA 3WLMA 3AXSA 4UM9D 1UM8A 3SXPA 2OXTA 4C3OB 3HYTA 3FNFA 2GXAA 4UDXX 1YR9A 1T9HA 1TCBA 3OU2A 2OCBA 3QOYA 4YJHB 1GG9A 5AVOA 3HLTA 3UC9A 5AM3A 3EAGA 1HLPA 3D2CA 1NI3A 1K7CA 2JK1A 4RHEA 3OM0A 3X1YA 3PHLA 5DCUA 3H9GA 3ZV6A 4WH0A 1M2VA 2VZ8A 4RENA 4LDQA 2Q5EA 3NMUF 5GIOE 4I14A 3R7LA 4BMVA 4AMBA 3OPXA 2YINC 3DZHA 2NU7A 1ZRMA 3B6KA 3VOAA 4HQNA 4C76A 1R0RE 1Y82A 4E12A 2W6CX 3IT0A 5D01A 3B48A 5LOVA 2AX4A 4H2DA 4OHMA 4ZMBA 2LTAA 1MC4A 1PSWA 3I8XA 3AHGA 3LC7O 1ZHOA 2JL1A 1RP7A 4NU0A 4Q3EA 1GXSA 1R88A 4Q4LA 3O8CA 3MW8A 2HW8A 4NICA 3WLHA 1G5PA 4P4NA 5H70A 3EWSA 1FLVA 1UWKA 2JJ1D 4S1PA 2HBZA 3T7AA 3ROKA 4U7WA 4B75A 5LR6A 2P9CA 1ZCJA 2WZBA 2HHCA 3KD3A 2UVPB 2W9XA 4N5IX 2Y0DA 4NBWA 4G97A 2OCIA 1FUYB 4A5SA 5LQSA 2HNKA 3CGGA 3I01A 4XQEA 1RXYA 5EINA 3RHSA 5EIXA 2VDWB 2R85A 3CMCO 4KVFA 4DA6A 5DNAA 2O8BB 1O4VA 2O4UX 3GMDA 1QRRA 3NAMA 3H5TA 4XDGA 4YQFA 1LV7A 1KOGA 3CISA 3OE1A 2IUYA 3ZVRA 2C1EA 1V5IA 3JALA 3R5JA 1IAVA 1DIGA 4L5IA 4KXXA 2F3QA 4C78A 1ZIPA 1GV0A 2IZ5A 5GONF 4ZTBA 5GZ6A 3RE1A 5KWSA 3LLVA 4IDFA 3IA2A 2J45A 3TIGA 5EE9A 4X63A 3OKFA 5FBKA 1JF8A 1MB3A 2YYYA 4XWOA 2MHCA 4GX1A 2Y3IA 5IYZA 3IJ5A 3ZE9A 4DIMA 1ZGHA 3GD5A 1XJ5A 1XYGA 4JQOA 3BCHA 2JFPA 2H11A 1M76A 3QIAA 4FZRA 2JIZD 4IUCS 1FS5A 2QX4A 4X1OA 4IFEA 4L5BA 1UQUA 1YQEA 2KB0A 1IHPA 2BL4A 2NTJA 3FNGA 2V5VA 4QUEA 2LCIA 3KUUA 3V5NA 3ZU4A 3FHOA 4IDDA 3TOXA 2B8EA 2WMDA 2JVKA 3VDRA 5IKMA 1OFHA 4BZQA 1JBKA 4BUCA 3Q8MA 3CNLA 5DNVA 2VVTA 3R5TA 4CM8B 3SD7A 3B1ZA 2FXIA 3C5WP 4L3VA 2OCAA 4K40A 4BVKA 1E1RD 3ANXA 2FMUA 3BWYA 4IHJA 4MP3A 3OWOA 4TV9A 3SDZA 1GA4A 5T4HA 5ALSA 4WOPA 3VHLB 2ZTSA 1NQAO 1RYFA 2NX2A 3ITKA 4HSEA 2VP6A 2QYSA 3AJ8A 4FB5A 4KN6A 1P7PA 2O52A 3A1VA 1DAPA 1UK8A 3BMQA 1WXWA 2FEPA 2R8BA 3CEHA 3FPKA 1K0FA 1MF7A 1TPZA 4Q48A 2VLIA 2X9VA 4UVDA 4ASUA 5JD4A 1YTUA 2JEYA 1A9XB 1QR6A 3F9CA 3FUWA 1UDRA 1UHTA 1CRZA 1Y4ZA 2FUKA 2YHIB 3EIQA 3PCTA 4K9MA 4K26A 2UUOA 4LVUA 4QRIA 4CGZA 1B2RA 1W59A 4PIVA 4F06A 4IKEA 1LK0A 1RCUA 3MBIA 4YPOA 4PR3A 3MVEA 4NBVA 1IFXA 3TCKA 1KPIA 2FZGA 1QFJA 4HNSA 1HNXB 1TA9A 1K08A 1M3SA 1NOJA 3FPSA 4ARUA 4JT8A 2ERXA 1X7WA 1UAAA 3ZDCA 4NV3A 1S9HA 5IYZF 4UJ3A 1N78A 3FYUC 4I9GA 2AHRA 3NDRA 2VP3A 2H1HA 1JUDA 1KJNA 3JQFC 4PLZA 3E8MA 5BMVB 3BXZA 4XR4A 1RQ7A 4ZYYA 3OPQA 2JCXA 1GL6A 1YCFA 4ALIA 2V7BA 4J4TA 4TWJA 5TB5A 4W5RA 4M2LA 4BWGA 3MTGA 4GNKA 1JGTA 4LOHA 4MI9A 2Y0BA 1ZI6A 9LDTA 4OQPA 3V4ZA 1JAHA 4R16A 3EIUA 4ZQBA 4DQDA 3EGWA 3FUTA 3REGA 1S6YA 1COWA 4P7KA 3VPDA 5ITVA 3NT5A 3OC6A 1EUCA 3OZTA 4LRTB 1EH5A 1VE3A 4JGGA 4TV9F 2JGKA 1R4MB 4OXNA 4CFYA 1ETUA 3DEKA 3OP1A 1O6GA 1X3LA 5B7PA 2R44A 1VI6A 1UPTA 1E6UA 1JILA 1M66A 1N5MA 2B9EA 4D96A 2WJAA 2QZZA 1JU9A 1JG1A 1UWCA 2W0SA 3MILA 3ASUA 5E6UA 2FX2A 3OQ6A 4AKIA 1XEWY 4GICA 2OXCA 1S4QA 2PT9A 3BF7A 3RB8A 3EMBA 2PSDA 4LNUA 1U0TA 2E9SA 2PT5A 1JDVA 2FKAA 1U1FA 2GKSA 5TC4A 1H2BA 1SOVA 5A2GA 3HBAA 5AT1A 4GOLD 3WLPA 4I4TF 1ZGBA 1PK9A 1RJFA 2HRBA 3K9CA 4LA4A 2IKSA 2WTMA 2ZWMA 4Q1EA 4TXMA 3WIUA 4C9BA 4QFMA 1US8A 3C85A 1T25A 2BUBA 2OY0A 2QENA 1RHRA 2B4KA 4B09A 3QFHA 4ZAZA 3MCVA 4A1FA 1FNCA 2O1EA 1PK8A 3G0BA 4OXQA 3SSAA 2FQQA 1BKDR 5KQSA 5EKTA 3PNQA 1LLQA 1V96A 5ANRB 3H4MA 3BS4A 4CF3A 3KZXA 2Y1XA 3O2SB 1XX6A 2QLBA 3NZEA 1NBHA 2CXHA 1W85B 2OECA 4O2LA 4X91A 1ILWA 2QRNA 4CHTA 3AW8A 1WETA 1OREA 5K0GA 2IYPA 2UZ4A 1E3IA 1L4HA 2B92A 4M0UA 1M8PA 1AHIA 2OM6A 3BKXA 4PC2A 8OHMA 1JEAA 3WMXA 4I5DA 4UNIA 1UEJA 5A9TA 1H2XA 3RPEA 1IPFA 1C0PA 3HB0A 4XCQA 2AJDA 3TVTA 3KR2A 4DQUA 3BZBA 5EXDA 1SGWA 3V6LA 1CCWA 1P5ZB 2QDXA 2WIAA 3NORA 4R84A 1U7WA 4X7PA 1NQOA 2I3ZA 4E5YA 4YNBA 2XSZA 4NZYA 5E4YA 3PHIA 4R4JA 1J4KA 1YKSA 1QVVA 1CNMA 1DZ3A 2I33A 2FW6A 1RWQA 1ZONA 3FPCA 3R7WA 3LK6A 4LZAA 1GGKA 4R2MA 2I8AA 3R77A 5GPBA 1YIAA 1PWEA 4EF4A 4QLBA 1FRNA 1XVTA 1WO8A 2Q4BA 1CS0A 1AQYA 1E7RA 1YS9A 2O3RA 3EZ6A 3A28A 3PDWA 1W35A 2C61A 5L3ZA 2Z58A 5KVSA 2IHNA 5DNCA 1TJ5A 1BWPA 5J4YA 4LECA 1F4PA 1U3WA 2FR8C 3HHPA 3NATA 4WGFA 1NONA 3SOZA 5KMGB 1S5PA 4B6QA 3JYQA 5F98A 5GV8A 2ZR7A 3D8NA 3K5WA 1FMFA 1UJXA 2R1TA 5I7OA 4TN1A 5E50A 1FNDA 1IZ8A 3L18A 2VRCD 2X14A 5K3OA 2AN3A 1IONA 5FORA 3H2GA 1O5IA 2ATVA 2JH3A 3X1ZA 1VCNA 2IYUA 4JR2A 1JLLB 1XFAA 1RQXA 3OIUA 3I32A 4RFSA 5FOWA 5B2FA 4QXOA 5JI3E 5L8VA 2DPLA 3FBWA 2BMDA 3E82A 2ZJ7A 4DIFA 5M3BA 3HNOA 2VUUA 4B7UA 4H87A 1USGA 2NO7A 1NW3A 2Q5JA 2NUPB 1BH6A 1FU7A 3TNJA 1K3TA 2HL6A 4KI7A 1HURA 1MXHA 3BXEA 2IYSA 4L9WA 1ZSYA 3PHHA 4RY2A 3B38A 3W9BA 1Z2NX 4CFZA 4R81A 3DTNA 5KJCA 2ATCA 2P90A 2X0KA 5LN1A 3X44A 2P11A 2FX3A 2VPTA 1PT8A 3LVQE 3ZDEA 1H8EA 4U2DA 1YZNA 2AKEA 1M1NA 4O4IF 4G2TA 4C0LA 2ZREA 5J40A 1Z4IA 3VGJA 1DJLA 2ES4A 4CNBA 1RABA 2NMVA 1MVLA 3KHKA 3U3OA 5FTNA 3WMFA 3NWOA 5LMCA 2ZWPA 1X13A 1YZFA 5JS2A 1WU7A 4FYKA 1J49A 1WF3A 2A0WA 5J58A 1BO6A 2SCUA 4D4KA 1HQCA 2AGVA 4OUDB 1IJFA 1T1SA 4IUYA 4PLWA 3K1ZA 4YJ3A 1LSSA 2VK4A 4YT8A 3W6PA 1VL6A 5KYXB 2PX8A 1SD5A 2YWCA 4MUXA 4Y6QA 5D6OA 3EFEA 5A4MS 4FCVA 3B3JA 3PNOA 1DJOA 1M8FA 2BF7A 2GCIA 5DIFA 2VDLB 4C22A 1NF2A 2ECOA 1EZ1A 4YWJA 2ORYA 4G1FA 1FJ2A 2ZXFA 1ZCFA 8LDHA 3PFGA 1U2GC 1X0VA 2FU5C 3AESA 3EOBI 3IP7A 1OA1A 2IPAB 3Q9LA 4XVHA 3ZW9A 4DXAA 2J6CA 3O9ZA 1X8LA 3IPRA 5FL3A 1NF8A 1X6VA 4X1YB 1CUBA 2HU7A 3MGGA 4FFLA 2ZULA 1NRIA 2OBXA 3HUDA 1NW8A 3WBFA 4CGYA 3INRA 4DJFC 2H7XA 3B1XA 4Q3LA 5KOHB 4W5NA 4H1UA 2FSIA 2D3WA 4BNTA 3WWEA 3HBMA 1E2JA 2ZB8A 4CV1A 3PFWO 5BVGA 1E60A 1P5HA 2Y68A 3K73O 1RAEA 5EEHA 4E14A 2DBQA 3QKUA 4IGIA 1Z5UA 4JJKA 4Y1RB 1OX5A 3PJGA 4EL5A 1VPVA 2R47A 2GN1A 1SCUA 4RS4A 2R8YA 4TS4A 4IDPA 3AL0C 2C97A 2DBRA 3PC7A 4Z86A 5AI0A 1DFHA 3D2BA 1AG9A 3ZNNA 4R3UC 4O33A 2FZEA 2BCEA 2B36A 1FFSA 1JIUA 5LPNA 3HJCA 4RS3A 4Z3OA 3A2KA 1R15A 3UPDA 2UU9B 3UYLA 1G6OA 3D5QA 5EHIA 3JZMA 5CYOA 5HCNA 1HH4A 5I5EA 5J23A 2QR2A 1B6SA 3EODA 3LHFA 3PIRA 5FADA 4X62B 3ZJUA 4CV0A 3A1DA 3IP3A 3KX2A 3PGLA 4IDQA 4B6JA 4WZAA 4CQMA 1YDMA 4EGFA 3COJA 3L7DA 1ATZA 1GPYA 4Y9TA 3PHCA 1N57A 4Q18A 2HLDD 1CRQA 1RAFA 2NGRA 2WSBA 3OKPA 1EEXB 4I1OA 2RHJA 1Y34E 3LBIA 4KXYA 4OQYA 1WVMA 3ILSA 3NHBA 1XQYA 2AX3A 4WK2B 4CQLB 3DMHA 1ONOA 3L04A 3I23A 1E59A 1M33A 3I01M 4N3GA 4HN2A 5DU2A 1IJBA 1Y4UA 1NE2A 1RP1A 1GZ3A 2Q2VA 3C7KA 1YKFA 3I53A 4TV8F 3DE1X 2AXQA 3EDQA 4QOEA 3I4FA 4N5HX 3TZEA 2XR1A 1U65A 1F8XA 2ETXA 3GMTA 2CYCA 4FJ0A 4N0PA 4JBNA 1JJIA 4HQRA 1GD1O 3TW4A 5HQTA 1NZJA 3CH5A 3KUDA 4BZPA 2WSLA 3ZWKA 1OGIA 2K6GA 1Q19A 4DV3B 2VAMA 3ICWA 2PX4A 2IDKA 3VBCA 3K0FB 4C0WA 2NQ8A 4F6RA 4NENB 1U8ZA 4HWPA 2EX1A 2HJVA 1U2DC 3OOYA 2QUZA 4O63O 3PEYA 3I1YA 3PGJA 3D3QA 4FFWA 1UK9A 4O1MA 3WXBA 2PIDA 3PKIA 4MPRA 1R6VA 2Y4OA 3I37X 4O4JB 2W70A 3OJFA 1PEDA 4ZQGA 1ISMA 4RTMA 3I2HA 1ILEA 5AFSA 4MEBA 2DWUA 2N0SA 4INJA 2F1KA 1SULA 2YC4C 4X0EA 2QI9C 4M8KA 4P3YA 4PFQA 3CR7A 1ZMXA 3PP8A 3ICPA 4N4AA 1VPTA 3INNA 3IURA 2V7VA 4K9KA 4PPYA 1VECA 4Y9RA 3WGYA 2Q3LA 4KTTE 1QK4A 3PKJA 1QYVA 1NIJA 1CR6A 3O21A 4Q21A 1VP9A 1AUXA 1VLLA 2FFBA 2HGZA 4FGLA 1TC1A 2QZ9A 3PD1A 4IVQA 4K6OA 4F8JA 2OENG 2JI9A 2XOEA 5TPZA 1QVRA 1Z5WA 1XAGA 5LZ7A 1M2VB 2I34A 2ZRFA 3C5VA 4J0QA 3TZCA 1JH9A 2NP7A 3HACA 3OIDA 4RL6A 3BGOS 4JLUA 3CTPA 2PWBA 1WHSB 2WQ7A 1MDBA 1KY4A 2O5VA 3OM9A 2Z6AA 5HKOA 1BHO1 4P8RA 3OUNA 5LOVB 1KP2A 3ZIUA 1SXJA 5HDQA 1SC6A 1N6OA 3GLIA 3G2HA 3JAKB 4PC3A 5L4NA 1W36C 2IODA 3W79A 2ZJOA 1TIPA 1WKCA 5DBOA 1UDXA 5TARA 5C1IA 4NAVA 4S1WA 2AF4C 1I0LA 1MB0A 4GYYA 3JW8A 4CEJA 2G08A 1NULA 1W6UA 4FB4A 3WLIA 1Y9EA 4K3UA 3ONWA 3IMGA 4MKRA 1DEXA 3N0WA 4A9AA 1RRVA 1AKQA 3D9QX 3U7GA 2AN4A 2ORIA 4OKSA 3GNTA 4RVOA 4FCCA 2IPOA 3A9VA 2ODTX 1YR3A 1CUDA 2Q6KA 5CNJA 4Q7KA 1RVV1 1XTBA 2PU5A 4HWTA 4RBNA 3FX2A 3RUFA 4CM9A 2YDXA 2AE1A 3LDFA 3P0IA 3E58A 3OWHA 2O0JA 4NE7A 3TL2A 2QZPA 3I28A 4MQFB 1TMOA 4UOQA 4M1YA 4ZQFA 1G7RA 1TQ2A 1XPJA 2ORWA 4B3XA 3EWIA 3SQLA 3I9V1 4FWTA 4FJ2A 1QOPB 2RI1A 1E2DA 2GPAA 4KNYA 4HZUA 4R2WA 3MGKA 1GVHA 3SDBA 1MV5A 1N2IA 3B1KA 4M88A 3OUUA 2PANA 4NJOA 2LUOA 2XNDD 3BF8A 3OT1A 1UT8A 5CLIA 2IQIA 2ZAIA 3IP1A 3O74A 5JVDB 2XE4A 4ABTA 1OLSA 4ML3A 3SQMA 4BO7A 1YB2A 2XDWA 3ZKWB 4RTJA 3FRIA 3P9CA 4LX0A 2BHNA 2WWRA 4KXQA 2WF8A 5FJIA 3UJNA 2EKDA 1KDOA 2P0YA 3C7TA 1EBBA 2Q9CA 1TJNA 3FG9A 3K6KA 3UQZA 1UZMA 4M1OA 4M9RA 1EESA 1QOQB 4YCSA 3KSZO 3DEYX 3IVGA 2VTEA 4BMZA 3FCAA 1AGXA 2R2AA 4J03A 4HZIA 1JA1A 3L3BA 3LPLA 4BMSA 1LA2A 2KLBA 4ECAA 2BM1A 2LPMA 1AVTA 3FTCA 4GC5A 3DBIA 2V7XA 4XYLA 4V02A 5A9SB 2ZE7A 2WB4A 3RAEC 5TS2A 1NJFA 4R1UA 2O8CA 2OWDA 2PZBA 4LHEA 3NEAA 1WM1A 3FDZA 2EZTA 1OWNA 4OBEA 2VSYA 2WU4A 2ZI4A 3ER8A 1G20B 1UM9B 3PRYA 4IEEA 2EU8A 3C3CA 1L7NA 3BWCA 3UXEA 2J7KA 3W4IA 4EELA 2D5CA 1E96A 3PQ4A 3VMMA 2J4CA 2VHZA 1HG1A 3N2ZB 3QUTA 3AHJA 1P2DA 1R3DA 3DO6A 4JUAA 4M46A 1ZK3A 2FW7A 2GPYA 2JFNA 3O8QA 3JWGA 2HF2A 2LD4A 2AIRA 1XZPA 3ORYA 1IJKA 3PDCA 1TKBA 4QBFA 3RG2A 3OFND 1AUVA 3GLFB 1X7WB 2QP9X 2JFQA 2EBHX 2SBTA 4LE0A 3CKLA 1U94A 3S1LA 4W1SA 1B0ZA 1MXFA 4EFNA 1H93A 1MJSA 2FRDA 1G3MA 2VNJA 3KWMA 1KI3A 2IW1A 2V7EA 4JUFA 4POAA 1ZXXA 1JMVA 3LHSA 5CX1A 3KQKA 2NO6A 2X7XA 3BH0A 3VR3D 2PAFA 4E51A 2HSEA 3WO0A 2XMQA 5B3JA 1N1GA 4CMGA 2G40A 3FOEC 1FBNA 4O8CA 3ULKA 3ZCQA 1F38A 4HXYA 1CEQA 1FQJA 1TZ2A 4DT1A 5LNK6 1E3JA 3FCOA 2PAAA 3ETNA 4RHFA 3EDRA 4RVFA 1XMSA 3RVBA 4QBGB 2C2HA 4ZRNA 2MMGA 3K4QA 2IYNA 2VQFB 4MWZA 2BGIA 3ZBPA 2D2FA 1ZRNA 2GFQA 2BSXA 1JI0A 2GWRA 4NZZA 5BRJA 2XRMA 2PUGA 2YS7A 1V4NA 1EUCB 16PKA 4WFJA 2RKOA 4QHTA 5H1YA 1ZK1A 1E1YA 2FQYA 3FVQA 4P58A 3RUEA 3O31A 5JARA 3DFFA 2FP3A 4FMDB 1QRDA 2DHQA 1XL1A 4I5FA 3TCXB 3HXPA 4UBJA 5B7QA 1HTBA 3DCJA 1YSCA 2PPVA 3WLRA 1RACA 3NFYA 4HPXB 2RH4A 3EIFA 4NS4A 4D8XA 1P18A 3HVKA 1YQDA 1OT5A 5CAEB 3X0DA 2YJ4A 1M5RA 4CL8A 1S2MA 1BZYA 4R7TA 4PRZA 2CHVA 5ADVA 4W7IA 3LZDA 4ZC8A 2HRCA 1H3EA 3AERA 3C5HA 3R4CA 2CSXA 1H4TA 2C99A 1ZC3A 3T3NA 4FWIB 3ZE8A 1CHNA 7REQA 4AF7A 4JKIA 2VJYA 1UJBA 1ZM3A 1CUVA 1US8B 2QY6A 2WSYB 4QYIA 2R5FA 5IBRA 4BNDA 5CFMA 1UT6A 2I2XB 3FOBA 4DV0B 3A2MA 1MQAA 4ZC1A 1RZVA 4O4LB 3LT1A 2E37A 2HFJA 2QTCA 3VPSA 3B36A 4BCDA 2HSWA 3IVCA 4IG9A 4Y6PA 2PD3A 1AKUA 1PJ3A 3EAFA 1IN4A 3EUEA 2OCPA 1ZP6A 4B6FA 4GKJB 2GK7A 1YU6A 3G6KA 4I8DA 4KO8A 1F2TB 1TAGA 2CLKB 2NXJA 2ONKA 3PG5A 4NKRA 4RADA 5JBQA 3BHMA 4KWHA 3RS2A 5AOBA 2H07A 1VIDA 5KJFA 1TVCA 1EXDA 1K5DA 1SXQA 4ID9A 1R9JA 1GTL1 4JUBA 3NNDA 4GOMD 2A9FA 2B5WA 3HBNA 3QKRA 1ZXBA 3CW9A 5DM1A 2H2GA 5DTMA 4I08A 3RC3A 4BZZA 5KB3A 1ZCAA 1ZY2A 3QBEA 1L5GB 1DKOA 5FQNA 2DT5A 1U81A 1G60A 5I5GA 4BFLA 2FWIA 5BN3A 1MGOA 4BNZA 2UYHA 3CPEA 1ZL0A 3T95A 1RAIA 2EEPA 2FPIA 4AAYA 3JRXA 1KFJB 5C8DA 4OAPA 4YASA 3R7WB 4JDUA 1DRVA 1FPMA 2VUTA 3U44B 4GZ5A 4GDFA 2ZRAA 4EA8A 4IMPA 1ZK4A 4ZZIA 3BZWA 2NZXA 4ND6A 3ELBA 3TRFA 4JX8A 1TC2A 3OZUA 1TVEA 5G2OA 1TT5B 3OCCA 5DM0A 1XLVA 1SZDA 2ZUBA 3ZVKA 1S02A 2FPPA 1M75A 3PUXA 4ZIRA 1YA6A 4HUTA 2Q3JA 1X1QA 1BE6A 3IBSA 5AOCA 1AMOA 1XF9A 2VHYA 2FPSA 3IAXA 4DEYA 5HW0A 2PZ8A 3ZI7A 2PZLA 1EWYA 4IV0A 4CV3A 4L8YA 2W6JD 5FA6A 1ODTC 4Q5IA 4FE7A 4CEIA 3RC1A 4DAOA 4EPWA 1QE3A 1WULS 3H2KA 3TAXA 2C5FA 3LBAA 5K2MA 1R66A 5LZ2A 4C2TA 1CY7A 1X80A 2DSNA 2O6HA 4GMGA 3L6RA 4L85A 4OQNA 3M8KA 1X7YA 3NTQA 3ED1A 1ZZEA 4O5OA 4REMA 2EFYA 4EMUA 2I4RA 2X8JA 1D2HA 1AQUA 2E85A 1K8XB 2A3RA 3DEJA 3E5HA 1DINA 5DEOA 3L0IB 4ZU3A 3DMGA 2YIVX 4K7JA 4W99A 1JLHA 1CUGA 2PU7A 3ACBA 5CM8B 1CEEA 1BHJA 2YX1A 2GLXA 3HKBB 5TEWA 3W5JA 1UMKA 1Z2DA 1X74A 4XAQA 4GGPA 1W4RA 3R24A 1SKYE 1WTCA 2Q9AA 1SUSA 1IN8A 2HM7A 1KQNA 3NTRA 3N53A 3N2IA 5ESWA 1XXHA 4ZJUA 1CZHA 3AF6A 2XQVA 3AEUA 4FDUA 4NLLA 3B1JA 1FJXA 5JJLA 1M5TA 1Y7PA 1RHKA 5JZBA 2DVMA 2VT2A 4WMLA 4KU0D 3NW9A 1T0UA 3L1IA 4EYKA 3C6YA 1G7TA 3AJEA 4DLRA 3PUWA 1N3BA 1M2OA 3V2HA 2IY7A 1ISFA 5ICEA 1L5HB 3WLLA 3LRTA 1JVNA 1SURA 3GVCA 5ALEA 4D8TA 2O19A 1JHXA 1CETA 4J0IA 2EJVA 2RHTA 2ECPA 3H5OA 4RF4A 1PQUA 5LZ5A 4G86A 5ALJA 4ZEWA 1VL0A 4BQQA 4RDCA 5TMDA 1YF3A 4EHJA 1LVUA 1YZKA 1KQ3A 4HDSA 1NQVA 1XIVA 3AESB 5DNDA 2I65A 2C9MA 5J2UB 2B6NA 5K8LA 4JXXA 3L93A 4E5MA 2XE8A 3E4DA 4JIGA 5CT8A 4S0ZA 4GEKA 3T3HA 2PUAA 2B94A 4NK4A 2XPCA 2AC7A 2H6EA 3K0CC 3LKDA 1EVZA 4QUKA 1VL5A 2G9VA 1LPPA 2IYAA 1QHIA 3QFCA 4PYOA 1BE0A 2Q4RA 3PYLA 3F7TA 3FYCA 3WDLA 1QQ7A 2A4MA 2HO4A 2HJRA 3M4NA 5DXAA 4B80A 3RUIA 3ABZA 1DEAA 1ZLXA 3CZPA 5EXPA 3WIBA 1QP0A 2Y9MB 3GPIA 4E30A 1K1EA 3MYYA 3QPAA 1PFVA 2BFAA 1WZEA 2X5NA 2HA7A 2XB4A 2Z2ZA 2X2PA 3JSAA 2I4LA 1WZNA 3QBJA 3UMCA 1YFJA 1NVVR 1SCJA 1GTRA 1CY4A 2PX3A 1E98A 2C4TA 4MWDA 4II3A 3WHPA 3TMAA 1E6WA 1P7ZA 2JFXA 3M3DA 4ZICA 4F5ZA 1FS6A 2DECA 4HPJB 3FMGA 3UQYS 2B1RA 2J32A 4HYQA 4YYEA 3MOSA 2X8WA 1XTZA 5IJAA 2VDJA 2XOXA 5IANA 1C1HA 4Q4JA 4PXAA 5KEIA 3GEIA 4H3VA 2C4MA 4KO3S 3QOWA 2YXBA 3C6QA 4HAUA 1OLOA 5G53C 5CDGA 2RC5A 4Y0VA 4LBVA 5BWMA 2QVXX 3L8ZA 3ZE6A 5JQGA 4WOJA 1U8AA 3A9RA 2XB9A 4BMXA 4ZQHA 1Q7TA 1HK7A 2Q5QA 3KB2A 4D3YA 1JMYA 1V35A 4DHWA 2ZWAA 3RABA 3DE4X 5ALZA 4DRXA 2AMYA 5F1PA 1U11A 4EATA 4Q9KA 5H5JA 2QTLA 2RK3A 4GMKA 4NESA 1CHDA 5A4AA 2ZBVA 5D2CA 2OYCA 5LQJA 4NPHA 3C14C 1HV8A 1AHHA 3CLTC 4UNSA 4K9LA 4XYBA 2JGDB 3RHFA 3SE0A 4F12A 4ZZ1A 1ORHA 3S1SA 3AG5A 2QTNA 4PXYA 1I0IA 3M7IA 1GU1A 5JJIA 3Q9NA 4AZ0A 2P68A 2ZZMA 4K6MA 2ZI3A 3WKCA 3K1YA 1LS6A 2Z57A 4EVQA 1J6UA 6LDHA 5FFFA 3UMMA 1FJGB 1BS1A 4F6RB 5LLSA 1WDWB 1Y5RA 1CUCA 1J21A 4LMRA 4F4JA 5JC8A 5TLSA 5SY9A 1BROA 3P27A 4Y6OA 3BEOA 2M1ZA 2WD8A 1XKTA 3H75A 2WD7B 2R6R1 4KEAA 5JRZA 1LU9A 4JZYA 4RKQA 3VDXA 5AVSA 2IFTA 4P4SA 1SOUA 1B93A 2IE8A 2P9YA 3NUQA 2Q2NA 1GLNA 3LYUA 5LP6C 4WN9B 5DHPA 3SYTA 2PUJA 3E9DA 3N07A 1DXYA 2V1XA 1UBTS 3DE0X 4P4UA 5JXWA 3OP4A 2IYRA 3CZQA 2ZJBA 2FWJA 1L4GA 4E5DA 4E3ZA 3I8OA 4TTSA 3CEJA 2BI4A 4TVOA 2OK8A 3ECCA 4BLWA 5M7EA 4CKEA 4JEUA 4I81A 5AHWA 2BGMA 3GMJA 3A3NA 1LW7A 3DL2A 3AP3A 3CVVA 4PZ9A 2ZXUA 4IHKA 1DELA 1QHXA 4WOBA 3MB5A 4DQXA 3S1AB 3A6ZA 1WXXA 3KKMA 4PXSA 1NVAA 4M37A 1EE2A 5H83A 4MRNA 9MHTA 1UXKA 1MC1A 2O8EB 2VT6A 2F6RA 2K4MA 2WMNB 4MI1A 2J3QA 3HI6A 3Q9UA 1AKMA 1ESDA 1DUSA 1GFWA 1ZXLA 1U0FA 4DA7A 1AURA 5AO9A 3ZWVA 4FGKA 3QPBA 2CFOA 1J22A 2CNLA 2LDBA 3C8HA 3A9WA 3EMKA 3SVLA 3KVNA 3MTEA 4TTTS 3W5SA 4A0QA 3OQBA 4QZVA 5IRCD 3NOQA 9ATCA 1W49A 3JZFA 4H3HB 2G1JA 3HDJA 6ADHA 4QBIA 1XAHA 1HY3A 5J2TF 5IVKA 2A2ZA 1AF4A 1HO3A 3U49A 4INAA 4N0MA 3ABSB 2JHCA 2ZBFA 3B2QA 1AQIA 4HAOA 4GI7A 1UBNA 4GQBA 5KNBH 1CEYA 3K6SA 1OIVA 2WG0A 4IYRA 5L4LA 3EZLA 3OESA 2IPLA 4CEJB 3ML1A 2JLQA 1HPLA 4CMBA 5BWCA 2OBLA 1L4MA 5BV0A 1WB9A 3U7JA 1MQ9A 1U7VB 1MX3A 3EQ6A 5AUQA 1K75A 1FP1D 1DC8A 1RVDA 2IDMA 5CDFE 4XGNA 4KTVE 3PE6A 3T7DA 4J9UE 2ZE6A 3HWWA 4R41A 4IDBA 1FJHA 1TK9A 4MI3A 3ESCA 1DFIA 4FD3A 2RGRA 1Z5GA 1HLDA 3GRCA 3VPXA 1KZ4A 1GDDA 3NWPA 4WBNA 3LSTA 1HMYA 3KT0A 1PS0A 2D62A 3KKLA 4I9UA 4AD8A 3OEHD 2IHJA 3BL8A 3CH7A 5HTOA 1ZD3A 2Q8PA 3BICA 2AWOA 1W46A 3AP2A 4WERA 3HJNA 2AYXA 1TM3E 3P20A 3HKDB 3PRJA 3M6IA 2QAGC 2YWDA 1XVVA 4KQ2A 3I2GA 5DW0A 2P6MA 3OX1A 4MUBA 4IEIA 3BD8A 5IDVA 1YV9A 2JKVA 3TIFA 4F1KA 1GSOA 5JPDA 1RWNA 4BEWA 1A95A 3K5IA 4XFJA 3EQZA 1KOFA 3BD9A 4BIIA 1GUDA 5CVTA 4LJYA 3QA9A 4BTVA 1IBMB 5EJHA 2V45A 4QARA 2PQ6A 2LRHA 3IAS1 3L92A 1L7EA 5EJIA 1TTQB 2BMAA 4DDUA 2BWJA 4RSMA 1OXKB 3I45A 3RG8A 2I7CA 4IBOA 3RJTA 2XB8A 3D4PA 3WK8A 2GCOA 2YIDA 3QE3A 1E1LA 1SUDA 4PC7A 3UMRA 1ULSA 5DNWA 3NAGA 1SCNE 3C4QA 1BA3A 1PF7E 2Y1EA 3GT3A 3PFFA 3FPFA 3GVPA 3LDGA 4IIHA 4V0MA 2WF5A 3C1OA 1VZ3A 3SSOA 4D98A 3UWMA 4CM4A 3ILVA 1QXSA 2QL5A 1F06A 3HUUA 1DB3A 1Q15A 3FPEA 1BFDA 1GP2A 1NX6A 2Z1DA 3VJLA 1KP9A 2NV0A 3ONNA 5A05A 4K05A 1RJ9B 3FDZB 4GUDA 4M8LA 4TMWA 1YWGO 1ZNQO 1A7UA 4XGQA 5BQFA 4G37A 4DQKA 3NHSA 3DSHA 1XEXA 2QMZA 3EBPA 1QFYA 1ZD1A 4UNPA 4EHLA 2VHJA 1TB4A 2ZVQX 3C70A 4F4DA 1K5GA 2HK8A 4Q34A 3JVUA 4FGSA 3UW3A 4JI4B 2VPQA 1K3UB 3I0ZA 4IXNA 4MCAA 2R1UA 4CIAA 4B71A 2H65A 3BMOA 3CNEA 2GN8A 3ICVA 3UJHA 3FSEA 1FSPA 3JRNA 1YL6A 2BR3A 4LDPA 4ZAWA 4D3SA 2P6OA 2PSEA 4D6PA 2XJ9A 1ZIYA 5JEJA 2CLOB 2PSJA 4FOLA 4QECA 4W9NA 1KI6A 2DEUA 3OF5A 2NVBA 1IBLB 4G5YA 2FMXA 4DZZA 4MJXA 1QDLB 2H1RA 2HQ1A 1LFDB 1QMPA 4NH0A 5CX1B 3TEJA 4V24A 5ALRA 3ZQ6A 3CIOA 4HDAA 1QPZA 1KSFX 1K8ZB 2D0PB 3D6FA 3FLEA 4L28A 4YI5A 4L4XA 3QVVA 4TMXA 1OYWA 4MS4A 4WOCA 3W06A 3OJOA 2MYPA 3IALA 1XZNA 3OC0A 1T8YA 2HMYB 3EA0A 4XLTA 3UJCA 5AM1A 3WYFA 4AMUA 4F7DA 1JKXA 1TYAE 1LCIA 2NTVA 4AWXA 4KIUA 3H3FA 1PSDA 2FOIA 4C07A 2IT1A 3BTUA 1SKAA 3M9XA 2APJA 5JECA 2R1ZA 1LBTA 3NBYC 4IYJA 3BE4A 4EI9A 1LX6A 1RPNA 5B55A 3ISTA 1EUDA 2EQ5A 3VR4H 3N5KA 3AI2A 1NZDA 4DZTA 2G36A 1NXTA 3ROGA 3LCVB 3G0GA 3W9YA 4GQIA 5DTQA 1PV4A 2Q50A 2PFGA 1GZ6A 1PFWA 1RQRA 1SD1A 1U7UA 2MSDB 3NPMA 1J24A 1KEUA 4TKUA 1NP3A 5CHYA 3CT4A 4HQ0A 2EATA 3H5NA 3WG9A 3WRWA 1XP5A 1FYXA 2Z4TA 1HWYA 5AYVA 3GHHA 1J4AA 4QU0A 4HDQB 1TVMA 2OYSA 5KNCD 7REQB 1E8DA 2V8OA 2QPAA 1MO2A 4NYIR 3MWKA 2C5GA 4BNDB 5IG2A 4IF6A 1W30A 4BNFA 1J25A 2GAOA 4EMSA 1JG6A 3RU9A 1QHFA 4N39A 5TQ0A 2R6ZA 3RU7A 1V4VA 1J8QA 1EZZA 2MIIA 3NONA 5CM9C 2FHPA 1S2IA 1P3DA 1HDIA 3CLHA 2H4ZA 3S4YA 1OVMA 1IQRA 5IH7A 2L82A 4G5RA 1Q22A 3SMVA 1BDJA 3N9IA 1YI8A 2CGEA 2DQZA 4JBHA 4ALLA 5JSZA 1VE9A 3KYCA 3TQRA 4G63A 1P2SA 1QKIA 3RTDA 2POCA 1NAIA 3FSJX 3LX5A 4X24A 1NMEA 1HDOA 4JYPA 3EZXA 3ANNA 4L0MA 4P22A 3GCZA 4QUBA 2GDJA 5FB3A 2KWIA 5BMVF 1MZVA 4BLSA 5HRCA 2QZSA 5A9RA 5IAOA 2J41A 4G1UC 5BN3B 3RRMA 1ESMA 3A06A 3D81A 3S2IA 2J08A 2HOQA 3C5CA 2BSQA 4HTAA 2TECE 3LRPA 4KX3A 4KGZA 4JLAA 5JALA 1ORTA 4L16A 1YJ5C 1NV9A 2DPHA 5EL0A 3T34A 2VF4X 2DQYA 3OSZA 2A5JA 3TM5A 3OLWA 1V9SA 3OBIA 1J0AA 3G8AA 2E55A 1XRJA 1Z6TA 2WAMA 3VTFA 2R6CA 2ZB4A 2WOJA 3LQQA 4NL4H 5F64A 2EYQA 3EUWA 3U13A 1AXGA 1BKYA 3QLVA 3KL2A 2J0QA 4HC4A 3H3XA 2Y1GA 1P1FA 2CE7A 3W2FA 5EJ7A 1YNSA 4F97A 2E1RA 3ZJ4A 2PBRA 2VF2A 3Q5DA 4YAFA 4PFSA 4TZ0A 2BGKA 1ESEA 3I05A 1UKEA 4LVCA 4OHPA 2DB3A 2IEBA 2H5EA 4UM5A 3VYWA 1CY8A 4ZT6A 2AG1A 3WVNA 2PPLA 2C04A 1OYOA 1FP4A 4G4SP 1GGJA 3ORQA 2JC3A 3IPAA 1Q3TA 4O2AA 5DBFA 4L4SA 1OLXB 4D45A 5F3DA 4E5VA 3KEGA 4NP6A 3DUFB 3W1WA 3FF1A 3FMIA 4MW7A 1M6NA 1O94C 5GOTA 3W8FA 2XUIA 2PXXA 2GRJA 1DBRA 1WSBA 2V65A 2DG2A 3Q85A 4QPCA 4D9MA 1GADO 1IPEA 3GXOA 2IE0A 2OG2A 3IVAA 1ZJ6A 1RYMA 3BRWA 1Y63A 2CDAA 2I80A 4JAVC 2WZDA 4OJNA 4UBIA 5EVJA 4BO8A 2GGSA 5DLQC 5A3SA 4ROSA 5L3VA 1BGWA 2P3OA 2PKQP 3AEYA 3K94A 2C4NA 1Z7WA 5JEKA 5C80A 1BXZA 3AEQA 3IIKA 2NIPA 3EASA 3G68A 3IT1A 4UEJA 3NTVA 1YQWA 2YFQA 3HC7A 3QXHA 4JLNA 2MYTA 4Q02A 1T0HB 2ZU0C 1AD2A 3DL0A 2WV9A 1EGMB 2IKQA 3IMKA 5H16A 5AM0A 3CPSA 2D1SA 2P5TB 1G21A 2WIJA 1A71A 3O84A 1B0PA 4H77A 1KYXA 4PC1A 3ADDA 4KLNA 4QQRA 4BP9A 4QCJA 3O8BA 3D8UA 2AG8A 2QUHA 4FPXA 1IK6A 5EPOA 4CTJA 2GEJA 3NYIA 2QAIA 2JLAA 2OGUA 2IWRA 1CQZA 2JH8A 4Q9HA 2ZRJA 4RVHA 4ZU6X 5AM4A 3ZBUA 1FW8A 2QTZA 2QV0A 3U5TA 4U7PB 2O3QA 3LX6A 3G23A 4R2HA 3D4OA 1HDYA 2QT1A 4L8FA 3UCFA 5GINE 3RUHA 3L4KA 4NFSA 4PSUA 3IMFA 1R6TA 3MJVA 3GBSA 3D7KA 1LV8A 1WQ4A 2G1UA 4DUGA 4U6SA 4O2AF 4KE9A 3NH6A 3ED5A 2V8BA 3GAZA 1P1RA 1YXMA 1MAAA 2GYUA 2YN0A 1K6JA 3FNBA 4KAFA 4BP1A 3IXLA 2H17A 2I67A 3WRXC 3RNOA 4EB3A 1VHQA 2JQJA 4PLFA 1DAKA 1EFRA 4RYDA 3RGGA 1EK1A 1ZQ1A 2UUPA 1KK1A 2BDEA 4OU5A 4R54A 5EE0A 4EUSA 2O23A 4YEDA 4DJDC 3QV2A 3KOZA 4C43A 1KYYA 2G9NA 4KLRA 721PA 1V41E 4KJZA 2ANBA 4R1MA 5CH8A 4BV3A 1Y3FE 2IYWA 3L4EA 2A6PA 4OO3A 1BU5A 3ES9A 4OK6A 4X7RA 2E4VA 1CQIB 1RDFA 4MZXA 2XXSA 3QNWA 4LS3A 1B4DA 3G9QA 2HNBA 3GA7A 1PDWA 3GXBA 4JJIA 2HMUA 3UHOA 3H1PA 5DGHA 5FP0A 5TT0A 4EUFA 4CCYA 1Y8CA 3RSZA 4HSGA 4DY6A 2JJ2A 1KAHA 2D8AA 3IUYA 3PFCA 2ZI6A 2W93A 1Y1SA 3Q8WA 4A2PA 4EYGA 4EDFA 1M72A 3NHLA 5FBQB 4R1TA 1U7XA 3L9XA 1D4OA 4JL8A 1TMKA 1Z4JA 2WWXA 4M8IA 4CWAA 2O8FB 4C6TB 5TIIA 2RGEA 5JQGB 2R7MA 4DR3B 2XB2A 4LHZA 4UTVA 1C4KA 4TTQA 1BVHA 1WJGA 1JQJC 2DYKA 4XM2A 5GQSA 5IKOA 3TI9A 4J76A 3THOA 3W77A 4EB6A 5C32A