3V8MA

Crystal structure of nad kinase 1 from listeria monocytogenes in complexe with 5'-azido-8-bromo-5'-deoxyadenosine
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
257
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKYQKVSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
total genus 72
structure length 257
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v8mA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v8mA01
5EJFA 2BONA 1SUWA 3V8NA 4L02A 4WRRA 1U0RA 3VZCA 4WERA 2AN1A 3S40A 1Z0UA 1U0TA 2I2BA 3VZBA 5DHUA 3T5PA 2I2CA 4HAOA 2P1RA 2I2FA 5EJHA 3V7YA 3V8RA 3VZDA 2Q5FA 4DY6A 1Z0SA 3V8QA 2JGRA 2I1WA 1Y3HA 5DHRA 3V7WA 2QV7A 4V24A 3V7UA 5DHSA 2I2DA 5DHPA 3V8MA 5DHTA 3V80A 5DHQA 1YT5A 5EJGA 3PFNA 3V8PA 2I29A 1Y3IA 3AFOA 2QVLA 1Z0ZA 5EJIA 2I2AA
chains in the Genus database with same CATH superfamily
4LTDA 3D7KA 4WZAB 1N2CE 1YB2A 1ORDA 1QZTA 5KTRA 1S9DA 3DE3X 3DV0B 4FGSA 1I4TD 2C8VA 1DEVA 1AB5A 1M1UA 1TLTA 2WK1A 4M7RA 4NNPA 4F12A 1JHPA 1YS2X 3GW8A 3VZRA 1NA5A 4BNVA 3GCZA 3H2GA 2DPHA 4ZCTA 3EPRA 1O96A 1Y98A 3G7UA 1SXHA 2H1LA 2NZVG 3OUUA 3RSQA 3WWCA 5E1BA 1JDJA 2QS9A 3W8FA 3U7RA 1Z2AA 4B4VA 1OI7A 3Q5GA 4XR9A 5F2KA 3RO7A 4D9EA 1XMSA 1V71A 4GEKA 5KJFA 2P9BA 3TCNA 3HCEA 4BEJA 2GO7A 2PMDA 2O0MA 3CRW1 5J23A 1NDQA 3BH6A 4OHKA 4E2FA 3IP3A 3FPGA 4EJ0A 4ZCIA 4I5DA 2MINA 4RV5A 3VVMA 4J1QA 1F2DA 1CFJA 4FT4A 3EZ2A 3GGDA 1E63A 3O2NA 3K31A 1DDGA 1MH9A 1SD5A 4R54A 2JKZA 3U39A 4A7PA 4F1KA 2VH1A 1GTMA 3EXFB 3KOYA 2IZ0A 2VZ9A 4U5XA 5KVAA 1AMUA 4JI2B 1SBNE 1AIPA 3BSSA 4FEEA 4XD7A 3QVXA 1Q5PA 1BGWA 2V1XA 4P7KA 3MF4A 1LPMA 4PG6A 1MTOA 5ICSA 4BV9A 4ZGBA 5T6BA 3IELA 4I4LA 4JJIA 5E4YA 3IQZA 4MVJG 3BL5A 3LV8A 3FSRA 2WI8A 4DN6A 5AM1A 5KWJA 2I99A 2W2LA 1IBRA 3ETCA 5CVJA 2QRMA 5JE8A 1KI8A 1Z0AA 5B58C 3ZLVA 1XZDA 1KYXA 1PTKA 5JSUA 1RXSA 1YZKA 2LKDA 3P2KA 3LH5A 4CMEA 4LY9A 1AKUA 3PPWA 4ALKA 3RSGA 1NNLA 2Y1XA 3ORSA 1Z2DA 2V5UA 1KH2A 3DLIA 4PU0A 1L5KA 1RM3A 5KYUB 2G36A 4BMVA 2RHHA 1W35A 1S1MA 2E9SA 1CF2O 3CE9A 3TW6A 4MTLA 1PDWA 3DNPA 3FJYA 3GFOA 3NGLA 4O4JA 1MO6A 3RLFA 5BSVA 4F97A 2XGMA 4O08A 1M2OA 4MRAA 2NO0A 1D4ZA 2NUAA 3SF8A 3OOJA 4AMBA 2YWFA 1L7RA 3DJYA 1BXGB 1A8UA 4M0CA 5IFLA 2FR8A 5A4KA 1FE8A 1PYDA 5CNMA 4UNRA 1G18A 1NW8A 2OZKA 2QD1A 2CUNA 1Z7EA 3DTVA 2QZSA 1SBZA 3MMXA 2V5VA 1JXMA 2EFJA 4ID9A 4RU1A 4OK5A 5CH3A 4B17A 4DYHA 1R37A 2ZSHA 1FUIA 3NYWA 4BL5A 1GV1A 2EWWA 4RXTA 1Q1GA 4EECA 4ZCRA 4F96A 1SG0A 3LQFA 3LM8A 4GBED 1W8IA 3LCUA 4FYXA 3FHCB 3WHKA 4D9IA 3VTZA 2C7VA 3LK6A 1S8FA 2C3PA 3P4XA 2P5UA 1KMQA 1GLGA 1NZFA 5L3ZA 3RAJA 5KHLB 2F64A 3HU5A 3D6AA 3SBOA 3GEGA 4PHHA 1TO6A 1F0NA 4JP3A 4WNAA 5EJ2A 1BH6A 1EP1B 1QDUA 1IXRC 3D4PA 5EA2A 5KNDH 2C4WA 4YP0A 1VJ5A 1ZVKA 4UUOA 4F3RA 3AV3A 4FI3F 1KI4A 4KPUA 4CM8B 1JG4A 4M1EA 6CHYA 1XTPA 5GONA 1IPHA 3C74A 1DWOA 4ZAZA 2PJRA 4DANA 5BY2A 2MYNA 4AJNA 1E89A 4XWTA 1MFPA 2I0FA 3DWGA 1J21A 2E1RA 2C99A 3C14C 2PKRA 1QIFA 4ZIRA 3QX3A 1L1QA 2D1YA 3D6VA 4HEQA 1FLDA 1TE2A 3RFTA 5DYGA 1KEKA 4M89A 2QU8A 4B33A 5FUWA 2NG1A 4WINA 4KQEA 3S28A 3Q85A 4FGZA 4QQNA 1H2BA 2HV8A 3C16C 1TTPB 4IF6A 2GPAA 2N42A 1SXJD 2OUIA 4N1AA 2ZJZA 2SKCA 3B3AA 1Z0DA 2X0FA 4NMXB 2CLIB 3GFQA 1T5IA 3L04A 4D43A 4Q15A 1UJMA 4M88A 4D46A 1H69A 1YJAA 3MTDA 4ARSA 4JLOA 2ZE6A 2GNAA 4JOSA 3G59A 4Y2PA 4B44A 5F78A 2IY9A 1GUBA 4BVEA 3VNVA 5BSMA 1GLVA 2CBGA 2R7AA 4HQ6A 5DI3B 1TW3A 3W9SA 3RS8A 3JQAB 2QL9A 1VA4A 1U3CA 3FWZA 2NM0A 3HC7A 3MGBA 3HABA 3OJFA 3PXUA 2DPXA 4N3NA 3AL0C 1VDZA 4X0EA 3C7AA 1BKDR 4RAQA 3UJHA 1B0UA 4J1SA 3HCOA 2V7XA 5JMOA 2X19A 3PL5A 1RBQA 3IHLA 1LH0A 4NP6A 2ZM6B 1GL3A 2ZSBA 1QHEA 4N03A 1UBRS 2WJ4A 1YVRA 3VJKA 4YQZA 2W2QA 3H1TA 3WLPA 2YWJA 2J5KA 1I01A 2GEUA 3TMYA 1JAYA 2ASEA 1FSGA 3GBVA 2V0GA 4D0RA 1OBCA 2GK7A 4UCQA 3MT9A 4Q47A 2HZBA 3Q6NA 2GZRA 1M1ZA 2TMDA 4U7GA 4Y98A 3WRXC 1GYRA 2QD4A 1BFKA 1LX6A 3CPEA 1QUEA 4FS3A 2DC1A 4LXGA 5EZYB 5A4IS 2Q8NA 5C51B 5HCNA 1DT5A 1ZBDA 2PBZA 2A8YA 2EEPA 4WMLA 4RQBA 3ZY2A 5JNVA 3NC4A 4PYRA 3DFUA 2DFKB 1R16A 1PX0A 3A6HA 1EFHA 2JASA 5B57C 1ZHFA 2C2XA 4LYAA 2BKLA 2H2AA 4FD2A 1DZIA 4DZTA 3H9QA 2HFJA 4Y1RA 3O38A 1YAJA 4PQRA 3TQQA 2QRQA 3HRIA 4WXHA 4RTSA 1UOQA 4GI7A 4II7A 2HK9A 3BJIC 3N59A 3PIRA 4RSMA 4J7XA 3AV0B 3N2LA 3SF0A 2QMOA 4EI2A 2HH9A 3WGGA 3NUZA 3D6FA 3OA0A 1F5NA 2NUPA 2R62A 1DCTA 3HVKA 1BEUB 3L0YA 1GA6A 1IY0A 5A62A 5GZ3A 2Q9CA 2CLMB 3KPWA 4RM2A 1HYBA 2YYYA 1QIEA 2Z4TA 1MO5A 2ILVA 2WWXA 1SUAA 1T9HA 3CX8A 3FZGA 3VO9A 3WI7A 4F8YA 3AWDA 1ZCJA 4BP9A 2ZCJA 4D9HA 5EWMA 4KJXA 3LA8A 5I9LA 1KJ9A 3B1VA 2ZUTA 3FMIA 1KFCB 4COOA 1YMVA 4OLBA 4OJMX 3ND5A 1KQ3A 2P62A 3NAQA 4XDGA 1VG0B 3GPIA 5JZBA 4P0PB 3DDUA 3L7CA 4IIBA 3X1DA 3ETEA 2HREA 3WWPA 4I50F 3K9CA 2NU7B 3I04M 3P52A 1K88A 5BUQA 3U5ZB 4QCJA 5IT5A 4IWXA 2NPFA 1YZHA 2AI1A 3E2PA 5DBHX 2I4LA 1YDGA 4IW3B 5JAPA 4K9NA 3I6WA 1EHYA 3MMZA 4LI0A 3HMKA 4MUIA 5ALRA 5JDIA 4AL4A 5JJIA 2PRSA 1ETHA 2F4VB 4RA6B 1KVUA 2ZYTX 4IY1A 4ND1A 4S2UA 1Y9AA 1XZPA 4BC0A 5FPTA 4BV3A 2VDNB 3OEYA 1JDPA 1RCFA 4ND7A 4HVLA 3JTEA 4RETA 2P5YA 4MEBA 4KTTE 4QG3A 5ECYA 4EHKA 4F92B 4Q7KA 1XNRB 4IG9A 5DX8A 4IAOA 1GQQA 3AHFA 1XK7A 4I0WB 2R79A 1M7HA 2AQ8A 3C3AA 4CM9D 3QA9A 4C43A 2OYCA 4R9PA 4MQLA 2VSNA 4P3YA 1KWKA 4AG3A 1DWUA 4RZQA 4CDNA 4DS3A 5HQ3A 4KK4A 3TTYA 1JEDA 1LWNA 3JZMA 4ZZ2A 1TKCA 3OUZA 1NQTA 3GLVA 1UMCA 1K68A 2WYHA 3GPDG 2LWIA 4PZUA 3WGMA 3ES9A 4E5KA 4XVUA 4GPIB 5FTLA 1QLJA 1KO7A 2XGGA 2PX4A 4XJTA 5LIPA 5C53B 4EY8A 1GA4A 2J6IA 5HMLA 1E69A 4YI5A 4HDSA 4Z9XA 5D84A 4RDXA 1VHTA 4G6ZA 2ORWA 5TQ0B 3E58A 5JSZB 4JVMA 3C5CA 2EJCA 4JEUA 3W5IA 5LQSA 3D6NB 3L8MA 1EK1A 1DKMA 2Q3JA 3LSYA 4KXFB 3UT5A 2F1RA 5C7OO 1H3EA 2ZTUA 2GXSA 2ZP1A 2WSMA 5B3LA 1Y5RA 5LA6A 1K0FA 1JHYA 5ALIA 4AYXA 1W5EA 2GUGA 4R1PA 4NQZA 4CUZA 2VUUA 4D5EA 3IURA 3D7MA 1N1EA 2QY9A 1W88A 4WJLA 2PV0A 3D0RA 3G9ZA 2UZ4A 4M83A 1T91A 3P9IA 4UPDA 1RPZA 3DULA 3RT9A 5HM6A 3KTAA 2A94A 1MC1A 3QENA 1KQOA 4D8TA 1HDOA 1QOZA 2VAMA 5J2UF 4BJHB 2J1LA 3DF7A 2DJ5A 1DAEA 4E15A 2QL6A 3PZBA 3VR6D 4KH1A 3MD9A 421PA 1YJ8A 2B3DA 3E7PA 3UHPA 4XA8A 1SOMA 2PGIA 3I76A 2XUIA 2Z58A 3AG6A 4IL5A 3PWZA 3VSAA 2FQYA 1FTWA 3CKYA 1N5DA 5JQWA 4DR7B 1Z6XA 4G81A 1SCUA 1NASA 1MQ9A 1VL8A 3DBRA 4LZPA 2C4UA 2WYIA 1C4XA 3JPYA 4OHWA 4WOCA 5FHQA 4UZSA 5JNSA 3VDXA 3IHTA 1X7WB 4BV8A 3RG2A 1EP2B 1QVZA 1FJGB 3C0KA 1RAEA 2HJVA 4RV4A 3WBKA 5ALGA 3HO1A 2YJ6A 3OLWA 2X9GA 3RF7A 3TMAA 3WL6A 3T3NA 1P9OA 4I4TB 4Q3NA 4KR6A 5E8JA 2F67A 2GNPA 5LWHA 1T4GA 5MFPA 1FP6A 4CMBA 3AUSA 2A1UB 1N8KA 2W6IA 3A1NA 3K9GA 2WVHA 2IUTA 5E6UB 1NSYA 3NOOA 3O83A 1PWEA 5CLJA 5IBCA 2J9RA 3LT1A 4E03A 4NJEB 4Y3UA 3V8RA 5HIKA 1P18A 3CH6A 4ZVUA 1Y6QA 2FKNA 1M1YB 5SV2A 4RBNA 3R7BA 5JI2E 3VR2A 1ZMOA 3R2JA 4ME6A 3A4IA 4K81B 1SN7A 2WTNA 1PYGA 3BHIA 3EFEA 3FZEA 1JJBA 3SS7X 3AR5A 4K6FA 3FNHA 2XTNA 3M1YA 1CZUA 4IPTA 4CV0A 4DCGA 3ZVMA 4ZYZA 4DMCA 1Z4PX 4QDXA 2Q6OA 4EG1A 1PNQA 1XU4A 5DW0A 2ADFA 1N7GA 3BOSA 1RHUA 3F6RA 1JXOA 3BAZA 4RQTA 2AC4A 3VZCA 4F4IA 4LDJA 1BKSB 1NUSA 1O5OA 4CJXA 1WF3A 1VSUA 2W22A 3GDGA 5EIHA 4B7UA 4KI7A 5CLFA 1BFUA 4PGHA 3VV3A 1N25A 2G4LA 1QF9A 4IFBA 4HQ0A 4TSRA 5BSHA 1XLTC 3ZYCA 1YONA 5IKXA 4PFQA 5E7QA 1ULBA 2IEYA 3DGEC 3EIHA 3O21A 4EGJA 4QTYA 1AN9A 4WUTA 5IAEA 3OFSA 4H17A 3BZBA 1Z7BA 1KEEB 2IITA 1PR1A 5JXJA 3ZOKA 1ZD9A 4LV8B 4P3PA 1XDSA 3KFVA 5HOQA 3Q2IA 1Z39A 4IVNA 2W6ZA 1ID8A 2KKLA 2IVZA 1UMDA 4IEFB 3B78A 4Y1FA 4XWWA 2P1ZA 5BWMA 1G8GA 3EEBA 1Y4UA 2BEUB 2ZBEA 2O5CA 3CSDA 2XD9A 3ZZMA 3PDWA 3IP1A 5A5GA 1L5GB 2FRVA 5K03A 3T9EA 3AVXA 1U3TA 3CLTD 1SVOA 4CCWA 4PWZA 2ST1A 2V6MA 2HA4A 1HNXB 2IE0A 4R5HA 6PFKA 1RE1A 3C15C 3K96A 2GWRA 3OQHA 3QOWA 1I4EB 1QP8A 4I50A 4M53A 5J5VA 5B37A 5KPDA 5JPIA 1X19A 5D5HA 2BJHA 3MQFA 5B7PA 3IMKA 3K5PA 4G07A 4OG2A 4P7JA 1KC3A 2PMFA 4NYMR 1XEXB 1AU9A 1O0BA 4Z4QA 4XLTA 3F7OA 3RUCA 1IFXA 1WKVA 4LJKA 1UFRA 2CCJA 3OZFA 4D6XA 4CDRA 3FTCA 2ZM5A 1RXEA 1XFAA 2XVXA 3B60A 3HY6A 4CV3A 1KHUA 2GBFA 3LD9A 2GASA 2IODA 3AZOA 1WAMA 4LGYA 3P9CA 2ZLBA 2HF9A 3CLVA 5JXGA 3GJXC 4B74A 2J3JA 2WB2A 1HNZB 4OAPA 2R6JA 4MV9A 1HT3A 1SUIA 5CMLA 1WSDA 2AJTA 1ORRA 3PQ2A 4V2IA 1QB8A 2FDRA 3IAAA 5MHTA 1TAUA 1SCBA 3HJTA 1UBKS 2O2ZA 3JVIA 2IYPA 2JI4A 1W19A 2XDQA 3GCWA 3I30X 4AZVA 5TMPA 3C98A 3RAEC 3WZMA 4WKGA 3ZCQA 3PFBA 5I9SA 2P9YA 4PG5A 2E85A 3T94A 5IF3A 2EH0A 4FDLA 1U7XA 4YBZA 3MIIA 1OGYA 5FUMA 4NMLA 4YJ2F 5JXWA 4MGIR 1GD1O 1WNTA 3S7TA 1QGAA 4OOFA 3ZU5A 3CNBA 1BXGA 1RWNA 1TJ5A 3JCZA 5AW6A 1IBLB 2Z5LA 5LB4A 3A77A 3HKCB 3LC7O 1RBYA 2HPVA 2P3OA 1E3EA 4ZYVA 2VYCA 2VZ8A 4KMRA 3QM1A 1QTNA 3QSGA 2FU5C 3HWSA 4XJSA 5FORA 2AZ4A 1KAHA 4PQFA 4Y2UA 4E07A 2YVLA 1ZIXA 2RFLA 2FX3A 2XWSA 4Q02A 2XDQB 2WUWE 1CZNA 5TF0A 1LPBB 4P36A 3IUPA 2H57A 3NAZA 1I3LA 1NQVA 3SLRA 4GS5A 1D8AA 1FLNA 1ECCA 4EHFA 1K8RA 4EHNA 3ESYA 3A6FA 2Z56A 3DEFA 1KXJA 4G89A 3KG2A 1EA5A 3ZI4A 3K2QA 5A7FA 2C4NA 1NW5A 1ZZEA 5CA0B 5LA6F 2N9UA 4TTJA 2WWRA 3WG9A 2B92A 1VKNA 2DUMA 3U4GA 1E1YA 2WKRA 4MROA 4WZAE 5JAMA 4TM8A 3GNQA 3NXSA 4KIJA 1DAIA 2IU4A 5LXTF 2BT4A 3QXJA 1GSIA 2HHJA 4QL3A 1DNPA 1SXIA 1L5FA 1XTTA 3MT8A 4TTIA 3B1FA 4D3YA 1YFJA 2EBFX 2FEPA 2JLBA 3NXKA 2EGGA 4EKDA 4U2FA 2ESRA 1E3TA 4IHAA 3FMFA 3L0SA 5IT4A 5LOVB 3QY0A 2YXBA 2GD6A 2PKCA 2QMYA 3QVSA 3R7DA 2LD4A 2YZ7A 3A1WA 3ANNA 3VR3D 3RK0A 9LDTA 1U0RA 3SN6A 3F1LA 2J3QA 3WKAA 4C7OA 1TA9A 4EAQA 3G89A 3BCRA 1JPVA 5CB0A 1IRXA 2ABWA 1M0TA 4WL0A 4EELA 4EPTA 1Z8HA 5BUZA 4KZPA 5DTRA 5EIEA 4QTTB 2AYYA 4RFLA 3VUFA 5C52B 1DCFA 2DWQA 1TYDE 3T3GA 1U2DA 2FHSA 4C0KA 1P0MA 1C50A 3T8YA 2ODBA 4WZBB 3ZNQA 4JYZA 3AERA 5AVQA 1S2GA 1XAJA 2P4QA 3RJ5A 3J7TA 1WXIA 3LU1A 4JCOA 4HJXA 1JDTA 5A6VA 1CXZA 4HR7A 2EX1A 3VSCA 4DR3B 3QEKA 2HJWA 1EHIA 3NKVA 3I1JA 3PPXA 4FLEA 3ESQA 2OHIA 3RVPA 5DKFA 3E23A 2O7RA 1K6JA 2CNWD 1M8PA 2CW5A 2HBQA 3AP2A 3RFCA 3WC4A 4P92A 4E14A 3LLMA 2FEWB 2XE8A 1VHJA 4QBGB 2UUBB 4KR0A 1PWYE 2OXTA 3ZI0A 1R2QA 4EPXA 3PWKA 1ZGHA 1EMDA 3K1AB 3HWRA 4W8HA 5FOSA 1JBQA 1MC4A 1RACA 4CLHA 2C3YA 5AJZA 1WXWA 1TRHA 1UM9A 2BEWB 4BNLA 4KFUA 3RS7A 1PFWA 1YBAA 2HXYA 3D8UA 3NT4A 4CCAA 1RYFA 1HH4A 3G3EA 1TGYA 2Q29A 4B80A 3ANLA 2PD6A 4DSUA 2RAUA 3F1KA 1B6SA 1XVVA 2PZLA 2C42A 4GXNA 1JE1A 4ZKEA 5TIIA 1SUBA 5HFJA 2XXSA 2FZKA 2LPMA 1I10A 3FPAA 1WCIA 4QA9A 2GPSA 4Y2HA 4ZO9A 2C57A 5HF6A 4KLRA 3KQKA 3D8BA 3IQWA 1CUFA 1FBNA 4IJMA 4Z2AA 4KRXA 2NT3A 1GAXA 1FUYB 5EKUA 3RAGA 3GLIE 3P0EA 4IIXA 2YJTD 5CVUA 4AP6A 1XTVA 2OO5C 3EDQA 4ZAFA 2GXUA 4TXHA 4F6RB 5EQFA 1TAGA 2A1TS 5I7VA 5T3UA 1P9WA 2MSEB 1G4HA 1ZSVA 3SPXA 5THXA 4DOMA 2R87A 1MB9A 5P21A 1D1QA 1DTWA 1O3YA 1WY7A 3OWOA 4A0RA 3ENNA 4S05A 4EGAA 3LUDA 4RTOA 3L5OA 2G72A 1JG1A 1RJDA 2J0UA 1RPNA 1YR3A 1J2FA 3ADKA 1N6PA 4R5MA 1SU6A 5F4BA 4AN4A 1GZ3A 4QPCA 5ALTA 2PIEA 3LPLA 4IRUB 5ARCA 1YZVA 5CGZA 2J33A 2GH1A 1HRDA 4IX9A 4J9VA 1U8XX 5JAQA 2GJSA 2B37A 4AO6A 1DFHA 3HGMA 4LSWA 4EJQA 1UBHS 5HFAA 3T5CA 1C41A 3R5SA 3UWKA 4CL3A 1M2GA 5SZHB 3D1VA 3MT7A 1J1IA 1SU8A 4DSNA 3CKMA 4P5DA 3BBLA 2OB1A 3PR2B 4I1OA 4HNHA 2XPCA 4MV0A 5G1NA 3OM9A 2E89A 5T41A 1O6FA 4L85A 4I5FA 3V1LA 4BRSA 5EXXA 4H1WA 3TM5A 4ESOA 2P30A 3K6JA 1JKJB 4JWKA 3L01A 4PR0A 2QTHA 1TCCA 1RQRA 1VJDA 1XWIA 4LOKA 3TQTA 5JS6A 5K8IA 3L7DA 3OLXA 4FFOA 1P8JA 1FW8A 3KZCA 3ET5A 4LJAA 1ZIPA 3FB4A 4RPHA 1A9SA 3CLRD 3QA3E 1PJ8A 3PU6A 4GP9A 3DZIA 4DIMA 3H11B 3ZDEA 3L5KA 3GDWA 2JCSA 5TT1A 2PWYA 4GPAA 3AX6A 4RH1A 5G3ZA 2QOEA 3RRMA 4DTCA 4FJ1A 4GR9A 2ZIAA 2XSZD 2I1QA 2I33A 3UPUA 1FDSA 2FPWA 2Q5FA 1G8YA 3EN0A 2RG7A 1SCQA 4IUBS 4FGJA 3TSYA 3CCCA 1F9AA 3KQQA 1LPAB 4CL0A 5EZ6B 1M2VA 2IT1A 1CC1S 2PRJA 2WA1A 3INYA 1DAOA 2OBLA 3OFNA 4YTEA 5JXIA 4E21A 4Q1DA 4YPOA 1ISIA 1PAUA 1NX6A 4UCWA 3BE8A 5AM4A 2K2QB 4ZOLA 2ONJA 4WE3A 1SNYA 4IIEA 5CUQA 5GJCA 3RHSA 5LQCA 1NURA 4B0PA 2N75A 2OFXA 1N2GA 1T24A 4YC7A 2I7TA 4J6FA 4ARZB 2I2WA 2V7UA 2DG2A 2IF2A 1PO7A 1P1BA 3A2MA 1MPTA 3B51X 5B7NA 5IRCD 1HFJA 1EE9A 3EGWA 2RH9B 5AI5A 2ZS7A 3RHFA 5EHGA 2Z6QA 1VG8A 5T5QA 3DPUA 3JD4A 3OE5A 3OQNA 4C2UA 4CKXA 3BL8A 3UATA 4IKPA 5J2TA 1Z16A 1OGJA 3HJRA 4OQEA 4C7XA 1C1XB 1N2BA 3ROFA 3EGDB 2FPPA 2GERA 2PUHA 5ALSA 5L40A 4K8RB 5JZMA 2XIQA 4CM3A 3PUWA 1V1RB 1SOUA 1CUJA 3EFBA 4Q5IA 1V1MB 2D8AA 1SC4A 1Y37A 1SQ0A 4O29A 1GYPA 1W46A 1TCUA 3LUJA 3OIVA 4G01B 1UMKA 4NZOA 4PC7A 4N3BA 5DFAA 2PTHA 2BFCA 3P2YA 4I6GA 4YH1A 3RC1A 2A0KA 3T9CA 4PGMA 5JZVA 3R6LA 4XW2A 4LDAA 2ACWA 4NEHB 3WBJA 3KYBA 4IDNA 5IWAB 2F3QA 1KORA 5DGIA 4OVKA 1ZHOA 1OH7A 2FWMX 4JUAA 4HDMA 3AOEA 3N1UA 5K6AC 5LOVA 4CEIA 4Y2GA 3LPAA 5ADVA 2Q4RA 2YFQA 1IK4A 2G9UA 2ZJOA 4IV5A 5CGQB 3DM5A 2CLDX 4E7OA 3GEBA 3L7LA 2F1OA 3BWXA 2F6RA 3DFIA 4JUBA 2QRNA 2QTFA 3ZYZA 3U37A 4KNVA 1QANA 3QQ5A 2AF3C 4B31A 4R81A 4IDEA 1QRAA 2GO1A 5EJ6A 3FE2A 4LOHA 4KXNA 3KSAC 1FA9A 4S12A 4OSPA 3EC7A 3OZEA 4KG7A 4JZYA 1SY7A 4NCJA 2R48A 1TAHA 3L4SO 4L07A 5CXXA 1PZHA 3C3YA 1P74A 3WTBA 4QFDA 3AQIA 4AJ2A 2Q62A 4Z53A 4Q12A 4NX2A 3JTMA 4U5QA 2X0EA 3VQTA 4JI3B 5EJHA 5EYPB 2TMYA 1BE6A 3MN1A 3FPLA 4HWTA 3FMPB 2DPMA 2VNIA 3NB0A 2BTOA 4EB3A 3OZIA 2PQ0A 4M22A 2PNJA 2KWIA 2X0JA 4KGVA 1E7RA 2BFWA 4M9XA 4J7AA 2FK7A 1W4BA 2QUAA 2V7QD 4J9UE 1YR8A 4ZVKA 5SY6A 3IKTA 1DMRA 1PL7A 3AY3A 3GCDA 1XDBA 3E22A 2WHPB 3R6TA 3AVWA 2JIMA 2X3YA 1N78A 2PMCA 4AB1A 2Y92A 3O2JA 3WWYA 2ZITA 1QO7A 1X87A 2I8CA 3VR5A 4BJ6A 4EG7A 2QX8A 3OOHA 3ZXSA 3MBOA 2P6MA 3IUJA 2JC3A 2JFBA 1BA3A 1HG0A 4HS4A 1EXNA 3T5PA 2ZXFA 1XAGA 4N5DA 4NE9A 3FPKA 3VZSA 3FWNA 2Q9AA 1GRCA 3L8ZA 4RF2A 4ZODA 3EIEA 4TMYA 5KINB 3GLUA 4IGAA 3NM6B 3K70B 1JQJC 5LLSA 1S2NA 2W6PA 4NKRA 3EMVA 4RF3A 1KAQA 2FK8A 2XKBA 2H1FA 1FTSA 2ZAOA 3JR7A 4A6XA 2NO1A 1UK6A 3UBTA 4JXKA 1DKQA 2F43A 4MV4A 4GL2A 1U2SA 1RI4A 3GMIA 1BSVA 1Q0PA 5B6JA 4XSHA 1QRSA 4GPTA 2C92A 1P0IA 4ZVVA 2ZRPA 4CM1A 2HRZA 3C3PA 1TM3E 3HEBA 4V1CB 4X1IA 4MWEA 4QXPA 3TQFA 4L3VA 1KPIA 3RRXA 3OX1A 4CQJA 1Y1LA 2ZAGA 3D0OA 1VPTA 4L76A 2C7PA 4ZYYA 2ZZKA 3ZCTA 2NTVA 5IM5A 3BS4A 5IEJA 3LQ2A 2CUTA 1UXOA 1U5BB 2NSYA 2W8BB 5EKXA 4AU1A 3KBBA 1SVSA 2Y68A 4L6IA 4OI2A 3SSOA 1NMSA 5EIBC 3FH0A 3LOPA 1HM5A 2ZJ5A 4H0CA 2OP0A 4KFSA 1GNRA 1I13A 3PENA 5DTMA 5J4YA 3KQWA 2G8NA 3S6JA 5AK4A 1CY7A 1ZUD1 3SQNA 5TLSA 1RM4A 2C88A 2J9ZB 4E3WA 1BVYF 4FILA 1CDDA 2D2IA 1Y8QA 4M9SA 4PLZA 5BURA 1R4MA 2I2BA 1J8YF 4GZ6A 4KDCA 4AZWA 3O7MA 1TU4A 2BKXA 2ZT5A 4JJ7A 1GRVA 3R3UA 4R1NA 4O4HA 3T5MA 4YFVA 4D8VA 1YF3A 3ZWAA 2SICE 1J8QA 3HYCA 2OK7A 1MJSA 4MQUA 3ZE6A 1GRNA 5BR8B 5TMEA 3BDIA 2RDMA 1AQYA 1GUYA 1RHMA 4GC5A 4DJAA 1SZCA 1YZGA 4Y9SA 3WHPA 4F6RA 1A77A 1PL8A 4MMYB 5T4BA 1RP7A 4HB4A 2D1FA 3IX7A 2BM9A 5HFNA 5GZ1A 4MS3A 1HURA 3HR8A 1UH5A 3U7EB 5LD2B 1U7VB 1P60A 1XXHB 2Q1XA 2DHDA 3IPLA 2GJKA 3QMVA 5B3AA 1YRBA 1U0HC 3N2EA 4KPGA 4RF5A 3TOXA 2WF9A 3Q3VA 4NZMA 1X0XA 4V3CA 2QX9A 1ODSA 5DCUA 2VTKA 1QG4A 3QU9A 3ZY6A 1LCIA 5HPYB 1KEPA 1UMBA 3VM6A 3CRRA 3GLRA 5BQFA 4HWOA 4NV1A 3UAGA 1ECBA 1QPBA 3ELUA 4BNZA 3VO8A 3A06A 1XNGA 2ZQZA 2LTAA 2V9PA 1H2XA 4BLWA 4QXOA 1SA0B 2JPEA 1K5PA 1P4AA 1CJMA 2AG6A 2GLXA 3BF8A 3DV9A 1VLZA 4R84A 4X7BA 1OUMA 4GI1A 4IBOA 4L74A 4IIDA 2WWVD 4L4SA 4FCTA 3TDKA 5TDHA 2N1MA 1J06A 2X40A 3PVZA 1E3LA 3FD8A 2RH4A 4EKEA 5J4VA 3AEKB 3IOBA 4G0ZA 4MUEA 3ETNA 1MOSA 1QHFA 4AJPA 4A4YA 4DAOA 4OIFA 5HGXA 5JJKA 3C1TA 3ED5A 1JJAA 1OAOA 4DDTA 1BWRA 1F6DA 2P78A 1V7QA 2O19A 4D0GA 3U3XA 1WZ2A 2ZWPA 4RABA 1FF9A 5LZ5A 5IJ9A 2ZBQA 2AMVA 3KS9A 2VI5A 3LK7A 4M9QA 4BGUA 3AF6A 1CUUA 1ISMA 1NKTA 3BWDD 4OFXA 1ZS9A 2BFEA 3ZNNA 4BTLA 2OQRA 3QELA 2G5GX 1LF0A 2NZWA 2ENUA 4F84A 3H1BA 4ZOCA 3BFVA 5DHSA 1Y48E 3HZZA 5K0TA 4UUAA 4TKUB 5K9ZA 2QRUA 1VB3A 1AMOA 4BZZA 1JTVA 1WB9A 2RGNA 4MB6A 1T6XA 4KHPB 3QU5A 1EFAA 2G0AA 2YY5A 2ZQYA 3W34A 1A5ZA 1W9HA 1E7WA 4CQMB 4DV2B 4B87A 5D7NA 3DOIA 3OIDA 3VH3A 2XRFA 1ST3A 1DX4A 2B8JA 5CTAA 5I9BA 4TWRA 1E58A 9MHTA 4MQEA 1EVLA 4IP0A 3RS4A 4DCUA 1U2ZA 3FB1A 2JBHA 5FWYA 1K9SA 4KR2A 4YRPA 1GUAA 1U5CA 1FS4A 2P5SA 4KQ9A 1XQ6A 5HE8A 2HJSA 5AKGA 1A27A 4BNKA 3Q0IA 1HLPA 5B53A 2A59A 2R7MA 4KXQA 1I4LD 4RS4A 1PDVA 4Y2VA 1AK1A 2MR6A 2W8ZA 1Z73A 1SBQA 3RDPA 1CJCA 5ESXA 4P6VF 5J3JA 2WHEA 3KU4A 4FR5A 1WP4A 2PBLA 2PUEA 1O2DA 5ALKA 1N3YA 2GM9A 3LECA 4CMJA 2QNIA 5IXSA 4XARA 5DTEA 3QRWA 2E21A 2DUUA 5B30A 1T6YA 5UKDA 1OKKA 3J81k 5GONB 2XWQA 4QLAA 1R9JA 2CVPA 5E6SB 2X7HA 4KX5A 2YVQA 1EFCA 4RCZA 1O9GA 4EY4A 3CT4A 2FH5B 2BZ1A 4IH1A 2CXSA 4W4TA 1NBIA 3O4RA 1RKUA 3I2GA 4FN4A 5EHQA 5CAEB 3AHJA 5KTYA 2FUKA 1RWVA 1APBA 1D03A 3ZLJA 3A0RB 4QQRA 3MW8A 5JSQA 5CDGA 4HB0A 2RHMA 5CBPB 2Y0EA 1QUFA 3EZ7A 4DQXA 4YONB 1G291 4U6NA 5IARA 2CVQA 4C05A 3TECE 2OFPA 4O2BB 4OJNA 2TSYB 5BP7A 1GQYA 1WABA 2VHVA 2FZWA 3WNBA 4CF4A 4GYYA 3IB6A 5F33A 3TLZA 1U8UA 3STTA 1I36A 1UP6A 4FNAA 4KVZA 4OA8A 4TRJA 1OYYA 2JLCA 1ONSA 4QGFA 4EMBA 3WLEA 1OTXA 1RT9A 3PHLA 4HB2A 4Q1BA 3NBQA 4TTPA 1RCUA 2PH3A 1HEYA 3SJCA 1ZCFA 1TYEB 2QSZA 2H5EA 4MUAA 3ESZA 3V2UA 2XAAA 5GJWC 1PK9A 2JVKA 1MT3A 4D0SA 4B5KA 1EZZA 1YR7A 5CVCA 5F98A 5F2NA 2IFTA 5JUWA 2OBYA 2EJVA 1OY1A 4M1QA 2REXB 3AY6A 3DWIA 1FTQA 3M3PA 4PX9A 4O2BA 2L42A 5EXTA 3B6JA 3U9TA 4AD8A 2QUJA 2XXBA 5CW1A 4DXHA 1G21E 3NEJA 1QMGA 3IH5A 5EJ4A 4E5VA 2O8DA 3MWYW 4CCYB 4Z0TA 1PQ4A 1CUSA 1UJNA 1VXOA 2FSIA 3O3OB 5KJ1A 2H65A 3FCYA 3OZWA 1L7DA 2L82A 2ZULA 1P6QA 1D2HA 4Y7DA 3B13B 1U11A 2OOSA 2QJOA 1L7MA 3HSKA 3HR7A 1DAFA 1E9EA 3QFRA 3QLEA 4Q4AA 3SG0A 1YACA 1JQ3A 4XIYA 4OSEA 4CGZA 1R8YA 1J9EA 2HPHA 2HO5A 3CLUD 1R00A 2WFLA 5DPMA 3QJ5A 4JBGA 3SXUB 1VCMA 3IV9A 2R751 3QVJA 4MICA 4L2IA 1KJ8A 5B6IA 1QNFA 4E6PA 4BNDB 1Z5OA 3IR5A 4HZIA 2MOKA 3AUFA 2GS9A 4JBXA 2AR0A 4QNRA 1N4DA 4HCJA 1RZRA 4UJ3A 1IH8A 4M98A 2BR4A 4WFJA 3QPBA 5EPEA 5BWBA 2NQ8A 1FFYA 3CNNA 2QAGB 1ATZA 5JBQA 3QEAZ 3VHRA 3E70C 4Q3DA 3UC9A 4UAVA 4YO8A 2ZGVA 3ITDA 4X8MA 3ZWQA 1H9BA 1YDHA 3IP9A 3FNBA 3G0IA 4LF6B 4PHFA 5JQGB 3AM3A 1ACLA 4LJ9A 3DLHA 1QH9A 1E3QA 1FP4B 1H1DA 4IDDA 1A9XB 4I4TA 5HWSA 2YYSA 3ZUPA 1H66A 4LF8B 1B1CA 3PD0A 1NLFA 1WG8A 2DEUA 2HBYA 3NORA 3GZ4A 4TRRA 4ARBA 3QK7A 4CV2A 5EJEA 1VGVA 1CP3A 3O3CA 4FNGA 4Z0PA 3KWLA 5KZMB 1YZQA 2A9QA 1PT6A 3RUPA 4X71A 1YJ5A 3K5WA 2HMTA 3DKVA 2C2KA 2KYRA 3WLRA 1TMOA 3ZDFA 2HCFA 3HB1A 3IVGA 4RVSA 1HBJA 2KS6A 1Q44A 2QN2A 1WZNA 3EJ6A 1A9QA 5BXQC 5C46F 3Q8MA 1B6RA 4TZKA 2R1VA 2FGJA 4ND4A 4LKRA 2PIAA 2KFUA 4IJVA 2FRDA 3HDTA 1MO3A 4K6MA 3RC7A 3VC1A 4G84A 1VKRA 2ATCA 2CB0A 2P9TA 2VDLB 3HJHA 5E7IA 3C4VA 2DY0A 4CI9A 2C9BA 3BE6A 5JDIC 4ZAWA 3QPDA 3WTCA 1E0AA 4KPYA 1X1AA 2B98A 4CLOB 1BMDA 4AJ4A 5LZ9A 1EWQA 1M1XB 4F4FA 4O4IB 5BT8A 2OESA 1I2MA 4QO7A 2W58A 1FC0A 1U8AA 4TSFD 1PWHA 3BMCB 1PV4A 1H2RS 3FKSD 1CJKC 1B76A 2BSXA 1YC5A 4AXBA 5BNWA 2OV2A 3C3BA 3P7MA 2CMKA 2IGTA 4LJ5A 2CY0A 1CB7A 1JHVA 2A67A 2VK1A 2X5KO 3TNDA 2BHLA 2LIVA 4NCXA 5DK4A 2QRGA 1JN0A 3EIUA 4X3CA 5IH7A 4KAJA 1HLGA 4XQGA 2Y1FA 3E9ZA 4V24A 2YHIB 5K0JA 2IWHA 5BOSA 1MIHA 2QY6A 2QYSA 1IZ0A 2PMWB 1AD2A 1NQOA 3I2JA 4G1MB 4DCNA 3TF5A 3G2KA 1P2SA 2VRWA 3PUYA 2MJLA 3NCTA 2M1XA 4MA5A 5EJ7A 4AZ3B 2C84A 4H87A 2HJGA 1OW3B 1KGDA 2IH2A 1R9GA 1USIA 1A5AB 1YGPA 3P20A 2JLWA 4C5AA 3F98A 3NH9A 4FCWA 5FI0B 1KH3A 2EFEB 3ZVKA 3EOBI 2YR0A 4NNJA 1KY3A 1OIWA 1RRVA 1YC2A 3PICA 4JLUA 4LC0A 4RANA 3RNLA 2RBKA 1E92A 3K1TA 1L4HA 3PKJA 4G67A 1Z45A 3OQBA 4U0KA 1P62B 2WPDD 3HO6A 4ILEA 1XU9A 2R00A 1KHXA 3L4BA 2HR1A 3UM9A 1AKWA 1C30A 2I22A 1G16A 1QYCA 1CJBA 1I0IA 2Q4OA 2R4TA 3GB9A 5LQDA 6ADHA 1DC6A 1YI0A 2I4RA 3D4IA 4E5PA 3RUIA 1MJHA 3L7IA 3ZX5A 4BBZA 1SH7A 4M0KA 2DT8A 4XB1A 3I92A 1CFZA 3H75A 2HIHA 1MN6A 3FNGA 3L93A 3TFQA 5BR1A 2VVTA 3E5RA 2EYUA 4PGFA 4XYGA 4YT8A 3UGJA 1GJRA 2XOEA 2GUWA 3IALA 4V0SA 2FWJA 1LTHR 3EE6A 2VQ6A 3SC6A 3TUZC 1DHTA 2HNAA 5E2BA 3TIGA 1FVFA 2QAIA 4WK4B 5SZKB 3IRVA 3OZVA 4CMIA 4LYGA 4QOFA 3INTA 4GMDA 1NSFA 3ZHBA 3LMKA 3DBRB 3BQNB 4H3SA 3FTFA 1DELA 1E4EA 1OVGA 5DHPA 2XMDA 1E6MA 2QR5A 2WM2A 4DUPA 3PNSA 1ES9A 1M72A 2NV0A 4DDMA 4N5IX 1Z25A 1E4YA 3Q3IA 1PNOA 5IZ4A 4GYWA 3BDAA 1MQSA 1NPYA 2LZ0A 2Q6VA 4MUMA 1H2EA 1N9GB 4UD2A 2NWQA 5D2CA 1F6WA 3IKLA 4H16A 1M7BA 1KK1A 1SEVA 1YS6A 5ALJA 4YYZA 4ZHSA 2YCBA 4G25A 1JEQB 4I1PA 3IDOA 2WAAA 3PC4A 4OU4A 2ONZA 5AJUA 4ZV9A 2V55B 5G3YA 3IEKA 3N5CA 5DASA 2JKDA 2QZZA 3IUSA 2XCUA 3NJ8A 3BB3A 1I0LA 2KSQA 3SK0A 1ISGA 5DTQA 2P2YA 3B53X 3KYJB 1CUZA 3BG5A 1DEAA 1UDCA 1RQXA 3JWHA 4GGPA 1EPUA 4QDOA 1WCYA 3F47A 1SKQA 5AK0A 4E4TA 5LL6P 3EAGA 2O2IA 4V39A 3R44A 3THSA 4ZJPA 4YR9A 2RAFA 3AVOA 1MIOA 1PHRA 1V0JA 5JATA 4RJLA 1DAMA 2GYVA 1T3HA 2IIVA 1T2UA 2VOEA 1XMPA 3JYQA 4PFJA 2Y0PA 1PJ3A 1R5BA 3CBQA 3LKVA 2LRHA 3UMBA 3QVGA 2LC1A 1EQAA 1KERA 1CR1A 4GBMA 1Q0SA 4DQVA 4DAEA 1SUPA 2MR5A 2UZ1A 1T36B 3R5TA 2PT9A 3A1FA 3OPYI 3OT1B 3W2EA 3WS7A 3EIOA 1V8OA 2I6QA 3OICA 3UOGA 3OFVA 3G5LA 4Q19A 2PO7A 4X66B 1OGIA 3VA1A 1TTHA 3BRSA 1YB4A 4MIEA 3HKEA 4BLSA 3L1IA 3Q7SA 1OHHD 4CLRB 4AJKA 1OI4A 5ITSA 4Y2XA 1OX4A 3E35A 3OUNA 1QNLA 2J0VA 2XUQA 4MVJP 1C2YA 2VC2B 121PA 1BMFA 1W30A 1YUNA 2B8TA 2IPLA 2R11A 3CWQA 2QI9F 3FCXA 1WXXA 3MWLA 3OLQA 1OX5A 2OZPA 2Q50A 4GVXA 5THKA 1Y9EA 1HYEA 1ATIA 5A5EA 3WK4A 2V58A 1NVUQ 2C94A 1GNLA 2QAGA 3GRRA 3KEMA 2ZWMA 2GBGA 5SY9A 3T7EA 4BNXA 4QATA 5EIOA 3A2KA 3LRPA 4JB3A 1QIKA 1V8BA 1PZEA 5EJ8A 2JGFA 3HVJA 1LDEA 721PA 5IK2A 2ZAMA 3RIHA 1P7CA 4PFKA 4UNSA 2BGMA 4D4GA 1QVVA 2CXOA 3LC1O 3C6BA 2QN6A 4O1MA 1SQSA 1VPLA 1BOOA 1DX6A 1W581 2ZU6A 3NTQA 3BMNA 5AW1A 2JLXA 4OY3A 4KXMA 1IULA 3C70A 3OEED 3T5AA 5K3BA 4D42A 1ZOSA 1ZOOA 3D1JA 1U3UA 5GM2A 3ZZ1A 1MXFA 2X4IA 1B3RA 1E2IA 4CKBB 5F77A 4KJZA 4EDFA 3HNPA 4RZUA 3FVQA 4PE5B 3FDZA 1L1RA 2O07A 1CRWG 2Z6VA 4YJKA 2QLMA 4DEVA 3LLUA 4EVRA 2VPZA 4FFBB 1V4VA 4LV5B 1EX7A 1ULTA 2QA5A 3DDZX 3IBYA 4BAZA 2NAPA 3ZGLA 1H5QA 1OPXA 2PX8A 4LRWA 3T54A 2HW8A 3ETLA 3O8OA 3B8EA 5LC1A 5K3EA 4HS9A 1ACJA 2IGBA 3U7QB 4G0NA 4Q9HA 1J97A 2LVBA 4RGVA 4YXWA 3ZE8A 3Q4GA 2I7XA 1V8ZA 2RKOA 3ETJA 2FPIA 4QXAA 5DSZA 4XDYA 4YP6A 2X8AA 1Y7HA 3OJ0A 5IDWA 5A02A 5IBRA 2MU1A 3HCAA 3EVGA 3FDJA 5E50A 3ZJ5A 2CXUA 1SVUA 1T9GR 4HGZA 1SCAA 4YGYA 2O20A 1D9XA 3C1UA 3GEIA 3FDIA 5E4JA 3S8YA 2OCPA 4LMPA 1FB5A 1A9YA 1G5FA 3IUQA 4PVCA 2QR3A 3EA5A 2X1LA 2ATXA 3P5SA 2NPIA 4DCMA 1HDRA 2I3GA 1Z74A 2EZ8A 3ENZA 1YNOA 5IH3A 1T0HB 3Q6IA 3GD5A 4U3JB 5AOAA 2JCYA 5AI4A 2DQ4A 2AOUB 2HPZA 1C1XA 4IQGA 4YACA 4PSAA 1AUPA 3A4LA 1C9JA 1XC7A 3LKDA 2ZBFA 4MYRA 2VNJA 4A0QA 4QC2A 3RSCA 1GZUA 2O0HA 4CF6A 4CN8A 3R74A 1DGQA 1FCJA 3E8SA 4GPBA 4PAMA 4X7MA 4D4JA 4W5OA 3F6SA 5I9TA 4ZU6X 1QGUB 4J8PA 3RYFB 1UJBA 3NBYC 2B8NA 2DUNA 4L22A 4KQWA 4ESEA 2VHCA 5I45A 1YSCA 2Z9CA 3Q72A 3LPCA 1UJXA 2ARKA 2X4DA 3K0EA 4W1PA 5KTOA 1IE3A 3I01M 3Q1LA 3KSBC 4B8YA 1QTIA 4CLOA 4YMWA 4FMDB 1YBHA 4AJ9A 3C6MA 4LX8A 4JLBA 2V8BA 3N0TA 3QLUC 3HKDA 2IYZA 3RH0A 3STXA 4QOGA 1X77A 3N70A 1JHQA 1KJIA 3C3KA 1TJNA 3CVYA 1JDVA 2RCYA 1L7QA 1X7GA 5ELMA 1ZLXA 3H13A 2A4KA 3KKKA 1EP3B 2WT4A 3THOA 1JEQA 2WTMA 1WUKS 2J45A 2R96A 2XZDA 3CIFA 1GN8A 1ZQ9A 2CL0X 3GAZA 1Z2OX 2EQAA 3Q7PA 4J1TC 4Q34A 4XUDA 3SQMA 5DNVA 1L2TA 4B3DA 3HK2A 2CGEA 4MWDA 3U80A 2ZOSA 3SZLA 1KKUA 5JFGA 2VYND 2AK2A 3BREA 3ORFA 3L3BA 4BPRA 2TMGA 1NGSA 3E1SA 3OCJA 4YP1A 3ZU6A 4WK0B 3P0FA 3V4LA 3VTFA 5K6RA 4P3NA 1QIGA 1TB4A 2VQ3A 1FTNA 2ZJFA 2JH9A 3LQYA 4UBIA 1HT2E 3UFXA 5AKKA 1OAOC 1XLWA 5A9RA 1AF4A 1E7QA 1G4UR 3O8RA 1T5DX 2R68A 2IHKA 2HSDA 1II8B 3VPBA 2OLKA 5DM70 3IAFA 1ZC4A 3B8HA 1TPZA 1J8FA 5ED0A 2GPYA 3Q40A 1GDDA 1MJFA 2WM3A 3EXFA 5D3QA 3U7IA 4Q93A 7MHTA 5KTTA 1IHUA 3OZGA 1RQNA 4MVJA 3TAHA 3EZXA 3S5JA 1DBIA 1LXCA 2REOA 1XYVA 2EAUA 4FZ3A 2B30A 4DCOA 2WSBA 4ANFA 4YS6A 5U1PA 2FMKA 1JQDA 1KK3A 1OC4A 2ZYDA 3C48A 4KRYA 5JCPA 2IXBA 3WQRA 3V32A 4XUCA 3VR4H 1QO0A 1K7EB 2EW8A 3ZXUB 1BIFA 3N07A 2ZVDA 3M4JA 1BG6A 5K0LA 1L4EA 4IX1A 5H4GA 2XCQA 3OKFA 2WZBA 5C4GB 4B6OA 1PDOA 3VA7A 1KAEA 5L95A 1W4LA 2FW6A 3PUJA 4U8HA 2C31A 3TTUA 3EXHA 1HTBA 2VJNA 4XWAA 4AX4A 4BVKA 4AQYB 1ULUA 3R7AA 1M6VB 3OZRA 1QZZA 1VHLA 3L1VA 1JDNA 4H2DA 4IJWA 4O6VA 4QU5A 5DW3A 5F52A 4Z3KA 4DMFA 5C5CA 3L92A 1EUZA 1RXUA 5C80A 2PKYX 1RJFA 4G8BA 1TYCA 2ZWAA 5C8DA 4EHLA 3QGMA 1RHRA 1QYXA 1ZMRA 5A03A 3I5MA 3H05A 1Y1PA 2KHZA 3AF3A 3PV0A 3WL8A 3WP1B 1EXVA 5AIAA 5AI0A 4D0NA 3K9NA 3BM5A 2ONKA 4IHJB 1QH1A 4O02B 3GLQA 3Q3EA 4ENWA 1G21A 1M5TA 1J2YA 3ICEA 3GD7A 2XYRA 4D2IA 1G5IA 3P8ZA 1BC5A 1Q91A 2IK8A 1JRLA 3VPFA 1XKTA 1X3SA 3CF2A 1ZNQO 1RAIA 2K6GA 2VN8A 3WYGA 3KV1A 5HW0A 4OV6B 3BCUA 4YJGA 1NVMB 5CRIA 4DLZA 5LVAA 4F72A 3D7NA 5A3RA 3EEQA 3SX2A 5IJ0B 3GFGA 2A5GA 2DM6A 3A9UA 5JNLA 4OAQA 3KQVA 4ZCQA 1VL2A 4GKVA 3NPMA 3WGTA 2E18A 3GGJA 3BGSA 3L6OO 4JI0B 1E98A 2G4CA 4G4JA 4G8CA 4CGYA 5FV4A 1FTGA 1CV2A 4P0QB 1PJCA 5I4IA 1S96A 3SR3A 4DJDC 1V1MA 3KCNA 1KDPA 1FTYA 3WMGA 2XBMA 1QIJA 2PX3A 2XXJA 1VBMA 1KK2A 3LL7A 2DPLA 3DC2A 4N6OA 4ZRDA 1I3CA 2D5CA 3NG1A 4HFMA 5TF4A 4BRWA 1WW3A 3SDBA 4C87A 2H9AA 3CCFA 4E30A 3REQA 3LX6A 5KEIA 1K5DA 3TTXA 2LW7A 1AUQA 4FUTA 4X64B 4ZDKA 2FFHA 2NXNA 4N9WA 1Z5ZA 4OI0A 3Q8XB 2R47A 4PIMA 1Q0HA 2ZANA 3GU3A 4K7JA 1EVEA 3KJIA 1JKJA 2OVFA 3FGZA 2ZYWX 4LOAA 4GNKA 1U6KA 1RNLA 3DQQA 3E8XA 4GIBA 3SEFA 3IQHX 3PUIA 4G0YA 1ZVQA 2PCJA 4IO0A 4PZLA 4QEZA 4ZVRA 2B7LA 1B0AA 4PBTA 1JDUA 1UZLA 1NW4A 2O0JA 3C8HA 4PICA 4QT0A 2VKQA 2HX1A 2EJUA 2C0QA 2QEQA 3N2GB 3KEOA 1WB5A 3KYIB 3QLVA 4OA5A 3EEFA 1G8SA 2CLOB 4P80A 2Y0CA 3ORYA 5IC6A 1OD6A 4A6PA 1YBVA 4B85A 2V96A 1IM2A 2WWTA 4D4MA 1OFUX 1FFXA 3R6WA 2J46A 4UARA 3LUKA 4IJKA 4DLWA 5KTNA 1V3UA 2O7NA 2CHGA 4NEQA 5F2OA 2ADMA 1F7VA 3CEMA 3WQQA 2P2GA 1PWXA 3HVRA 1FNBA 3S2EA 2W2OA 1SQ6A 1SIWA 1AT1A 1W36D 3IEUA 5FBVB 2IYUA 2FXVA 4MWZA 1PBNA 2FSPA 1WCWA 1YL5A 1Q19A 4S1PA 4ZQFA 2DBZA 3IEIA 3UCEA 2QRLA 3MLBA 4OHYA 3ZS8A 4WCFC 1NVAA 2Q7DA 4WOKA 2HA0A 1X3LA 4G1UC 1TEXA 2LCFA 2O3RA 1M2JA 2P8JA 3Q7QA 4MKFA 5HXAA 1A2QA 2FXIA 2I34A 5EZYA 1IAVA 4MUJA 3UMFA 1NC1A 2WTXA 1GRQA 1Q7CA 1IEXA 2DZDA 4WJKB 2ZI9A 4GU5A 5NULA 4LZNA 5ESRA 4NHEA 4WIAA 3QYJA 1MTZA 4BYMA 1GL9B 4UTRA 2A30A 3AVVA 5JYBA 1FP2A 1U0OC 4HLNA 4Q4JA 3RBAA 4E5UA 1XKLA 6REQA 4IXWA 1UAAA 5CVTA 2X5XA 4TS3A 2OP1A 3GT4A 1RRGA 3NW9A 4EJSC 4DLTA 3KOUA 4TMTA 1A4RA 1DQSA 3AIIA 4YJHA 1NVVQ 2JS7A 2RJNA 1ZN8A 1S3SA 3FDFA 4IDHA 4MEAA 4FOOA 1FYXA 2GRAA 2ZPAA 3ECAA 3N58A 4OXYA 1YGYA 5CYPA 2ID8A 4RL4A 4JT9A 1GXCA 1HDEA 5HDBB 1PRYA 2AFHB 4HRXA 5KU7A 1V16B 1DUVG 3DHNA 3DR3A 4PV7A 4A10A 4CODB 4Z4EA 4HNTA 1WB6A 3HZRA 1ESEA 3PG5A 3EG5A 4G24A 1U28A 1F9EA 2QVBA 2XZLA 3A70A 1CRPA 4TXNA 1GKIA 1HY3A 2CVZA 2G28A 2X5NA 3QWIA 1VJGA 2NV6A 4MARA 4D97A 2BMWA 1SIUA 1OLSA 3GRKA 1B2RA 2FRXA 5JI3E 3N8IA 3UW3A 1A4XA 3UNNA 2HWKA 4RESA 4BRZA 4IHJF 1D5CA 1PGQA 4F4CA 2OXEA 4XCVA 4XQ9A 4NDAA 5K09A 3AM4A 2Q1TA 2VXCA 3G6KA 4FUQA 3TBKA 1Z6AA 1VLLA 4LJ7A 3Q41A 1J8MF 4DYVA 1BXZA 1KEZA 1WXGA 4A8HA 3WRYA 4WI1A 4AZSA 2QENA 4BFTA 1ZRSA 4LJYA 5HOEA 3QI7A 5DGDA 4QGSA 4AUEA 1SBTA 2FW9A 2Q5EA 1EJ2A 3GO4A 3IQDB 3KFXA 1PUJA 1RRPA 5M7EA 5TQVA 1Y8ZA 2W2KB 3IESA 3Q7EA 1QFSA 5HS6A 4E6EA 3FUXA 4EGCB 1K4KA 3L79A 4U9UA 2ZTSA 5CXQA 2GEJA 1CJVC 2WJWA 3IVRA 3SVZA 3DMPA 5FP0A 4B79A 2A1UA 3ZBQA 4D57A 4E46A 2H1OA 1SOWA 2CNDA 4R0VA 2Q4BA 4XXHA 3VAZA 3A04A 5DDIP 2AG0A 4HDOB 1O94D 5JO9A 3T7KA 4DA7A 4DR2B 1JH9A 5AM3A 4JJ8A 4M6WA 4ZU3A 1DJPA 1IMOA 1C2TA 1Y1TA 3A37A 3V97A 1D4FA 2WIGA 2GM4A 1QZUA 1PUIA 4MS4A 5CVDA 3ZK9A 5FTJA 2DR2A 4HNGA 1JHDA 1KL7A 4M0DA 3MMSA 4DGSA 1G38A 3ZZTA 2WT8A 1PFQA 3A36A 3PA6A 1C3OA 1AQIA 4H4DA 3U62A 3S44A 4AMVA 1I24A 2XX3A 4RPGA 5HVNA 2JGJA 3CGGA 2P75A 4RFSA 4D3FA 1R6TA 5TGZA 2XMPA 4LOLA 4TKLA 2OWDA 1WY5A 3A6LA 4JC4A 2I4IA 3Q7TA 4IIVA 1RVV1 2DF8A 4ZVLA 4YIHA 4TZ6A 1U2TA 2CMDA 3TIXB 2HCBA 1LW7A 4J90A 1L3CA 4FP9A 3G1UA 4B32A 4ZARA 1XTUA 1XF9A 2BMFA 5REQA 5ALMA 1NN5A 3KZKA 2HK8A 5JVDA 2ZJAA 3NDRA 2OM6A 3EOZA 1C29B 3V7UA 4CKCB 3X1YA 3A4MA 3FAKA 3O4VA 2DERA 2XWBF 1CNEA 3P1JA 1CDZA 2ZIVB 1XZNA 3PL1A 3HU2A 4KYTA 4DQUA 5HQTA 2IS2A 5A3QA 3TTTA 1BU5A 4YCNA 1K2NA 1C0IA 2BBWA 3ILVA 3NYIA 1Y6FA 3H6GA 1D7OA 2MIIA 1WZCA 5F3DA 2B0JA 2R85A 4FS8A 5HKOA 4Y9TA 1I2AA 4Q66C 3IA7A 4EATA 3M5CA 4GPD1 2IBSA 3M81A 4CDMA 5DCLA 5JU6A 3VNUA 2Q3DA 1T8SA 2WEKA 3W3ZB 1L8XA 4BLVA 4EHJA 1ODFA 4HDKB 5F1KA 2QQGA 2PK3A 5KNLA 1NUPA 1GADO 5TEVA 4AS3A 2XCIA 1OWNA 5C81A 1PNVA 5JHGB 2C7BA 4Z86A 3QKUA 3LE8A 4QUAA 3TVTA 3SI7A 1EG2A 4UBNA 1PFYA 1XZGA 3IBTA 1OFUA 5ILOA 2NO7A 2WHXA 1MZPA 1CK4A 3TMKA 3KLBA 5CFLA 1YS4A 5M34A 1ENYA 4AY2A 4I36A 1Z28A 2O54A 5B4UA 4OQLA 5AKYA 2V3WA 1HDCA 3VYWA 5AW0A 3UWDA 1J0XO 3V2HA 3GZTB 4CYMA 3JYPA 3GFVA 4D3ZA 1PI3A 3OP4A 4G0WA 1T5LA 1HE2A 5HF5A 3GFTA 4HFRA 3CUYA 1IN6A 2C1XA 3TKLA 5CBKA 3B2EA 2LE0A 3IT1A 4OLJA 4QGAA 4M1YA 1XCBA 1PJQA 2XJ4A 1ID1A 3H6HA 5L3RA 2EBUA 3P32A 1EX1A 4P3KA 2CD7A 4A6EA 4B3SB 1BJTA 4MHTA 3I9JA 3B38A 1W36B 2A35A 1TIBA 4HSEA 4X41A 1TKRA 2O3SA 1KZ6A 3VR4A 4XIJA 5E3IA 4AMUA 2JHGA 5BW8A 1G20E 3D7SA 2DWCA 4WFQA 4HEHA 3CEPB 2JCXA 3EGDA 3ZCSA 2Q0HA 3MINB 3WSWA 3OH8A 4JL8A 1JHRA 4YRCA 1L5MA 5B1EA 1FYFA 3CRZA 2FP4B 3EQZA 3OBIA 5BSKA 5DJOA 1U2EA 1ZI8A 5TPWA 2BEVA 1QR2A 5J2UB 3OJCA 4RDHA 1G17A 4EG3A 4OBEA 3AU8A 3OPVA 3PGVA 4GR4A 4MX8A 5DP2A 3UWPA 4GYKA 3UMZA 1T4CB 3RFFA 3FFTA 1SHJA 4QVGA 2P7HA 5KYYB 2Q3LA 2FY8A 5HKKD 3B2QA 3MSCA 3PK0A 4GGOA 5HKKA 3DEKA 1Z7WA 5FWXB 3M1AA 4CLXA 1T5HX 1JFTA 3HFJA 5DU2A 2P3SA 4P2BA 4B47A 3U0VA 5K0ZA 4A5SA 1GGVA 3LPDA 1W94A 2IYLD 3KALA 1NJSA 4FMCB 5I7OA 5A06A 4NMMA 1IPFA 3TZQA 2YFKA 3AF1A 1NJ6A 2ZR0A 3LGXA 4W8GA 3AQ4A 2YVKA 1U2RA 4ETWA 3HCCA 1IUKA 4LNAA 3TRKA 3V4OA 1NBMD 2OY0A 1JYEA 2BHRA 1AY0A 1Y1RA 2QRZA 1M1YA 2VBGA 1SVIA 3GYGA 3B36A 4LGVA 4XSVA 4GMXA 4RPJA 2ERXA 3ZHQA 2X58A 3HADA 2RHLA 2XUFA 5G53C 1WHSB 3UCFA 4K9RA 2VYFA 4FXOA 4BYGA 5DHUA 3C3CA 2JLZA 1XP5A 2H4ZA 2EKDA 1II8A 1Z5GA 4UNQA 1SU7A 1KI9A 3LP8A 2D0PB 1K4YA 1QGZA 3GCXA 3QE2A 3SLKA 2ZYHA 1TM7E 3GHHA 4BMYA 1MF7A 5B36A 1TTTA 2SKEA 4F3CA 3IQIX 1VE1A 1WIWA 4D9BA 1QCCA 1TIKA 4J0HA 3L02A 1IJBA 1NWHA 3FW1A 5F64A 9LDBA 2NLOA 3PIIA 4KQIA 2GILA 5A8IA 5KSPA 3DVLA 4NU5A 4YN3A 1SVMA 2AQKA 3FTEA 3GZJA 5JDCA 3FA2A 3TNLA 2YN4A 2FN4A 1Y5MA 3FSJX 3I34X 2HFKA 3M6VA 1BRMA 1GQRA 1WTAA 2WJ6A 3AXTA 3H4MA 4UUMA 4YAOA 1ZVVA 3RTEA 1AXEA 2CC2A 4LVCA 1RKBA 1ONOA 3KK0A 1FFWA 4C1BA 4PPFA 5DZSA 16PKA 2QTTA 5KVVA 5BYJA 1JG3A 3GP5A 3WV5A 5ULLA 3CG0A 3FSGA 3CA8A 1XPOA 4ZDJA 2JL1A 2KPOA 4X62B 3FHTA 1OBFO 2QLBA 3DT8A 3ROMA 5EGNA 1TQ8A 3WBBA 3A6EA 3I4FA 1T1EA 1E1CA 3BHNA 3DH0A 4QBKA 3ZR4B 1E6WA 1Z82A 1RC1A 3PQ4A 4IINA 4QVKA 3O92A 2GBCA 5FLKA 3T7CA 3VJLA 3SIRA 3UA4A 4ZOBA 5LLDA 3A3NA 2QTCA 3DLTA 1T8WA 1FXSA 1E0KA 1H6AA 1E5DA 1H2WA 2GD2A 3SOPA 4UOZA 3RYHA 4ZI2A 3U56A 2FW7A 2VA8A 2WSSA 4W9RA 3JQ8B 3KB1A 4BKUA 6ABPA 3AI1A 4N65A 3I52A 5ARBA 4JIVD 4Z7QB 1OT5A 2CNNA 1M34E 1XHFA 4WESA 4XQCA 2X3UA 3MMNA 4R7TA 5CX4A 3THRA 3BTSA 3JZAA 3ZCPA 3CVXA 2A5DA 1DBQA 2TS1A 5KDDA 3Q9SA 4RK6A 1UEJA 2NPOA 3PQ3A 3NHLA 4V0KA 2BN4A 2X2PA 4N6NA 3F9RA 3VNQA 1A96A 3ITEA 5JQGA 1I33A 3EW7A 3HXPA 1QDEA 4A91A 5K0CA 2R8PA 1QP0A 3I4CA 3IDAA 1UK9A 4TYNA 2EP8A 3SNKA 3PB3A 3SJUA 3TAUA 4DEXA 1CYEA 1FFBA 2OHXA 2EKBA 2Y1WA 3R4VA 4LVNA 3C5HA 1F5SA 2YS7A 3FPEA 1YVDA 5CHEA 4U39A 1DLIA 2ZYIA 3RJZA 2GN1A 4OPMA 5FUVA 2WU4A 4P2GA 4YVFA 4MCIA 3DMTC 3VAYA 1CLUA 3W1WA 3S7ZA 3ZE2B 4L9RA 4DLAA 2V97A 2BDUA 1WOMA 4UE2A 3R09A 3V80A 2W83A 4RY0A 3PTLA 4JLNA 3WRXA 4A8JC 4XM0A 4ENSA 3IJEB 1JMVA 3PWSA 2B61A 3OPNA 1SK8A 5FI1B 4TZTA 5G41A 5IJAA 4OLHA 5CNJA 3HWWA 3HVUA 1AF7A 2VSQA 3RK1A 2O6LA 3RVQA 4Z2YA 3D4BA 4CIWA 3W2TA 3CPHA 4YRGA 1VKOA 4ZO8A 5SYAA 4AKIA 4NI5A 1GNTA 5HRUA 5JZOA 4RD3A 2OO7A 2E4XA 5K3FA 3VKVA 4X97A 2JD1A 2NVBA 5ECDA 1YB5A 4NATA 2NAFA 3DFKA 5HQJA 1TD1A 1E5VA 5DSXA 4ZWNA 4OQFA 1OXVA 4MW9A 1O03A 2BFBB 5DX0A 2ZJBA 3TH5A 3TRDA 1QO9A 4X6YA 2FZ4A 2ZUUA 3OM8A 2M6RA 2QU7A 4RVNA 1F12A 1IWPB 1U7TA 4WXYB 2JIDA 4CT4B 5JSHA 3D6MA 2G3YA 3HDQA 2JEOA 1NYTA 5JCOA 5JEOA 3H5OA 3TOZA 2CMGA 2W2NA 1NF8A 1JLMA 1VFPA 3VR4D 4HEA6 2EL7A 4INAA 4TS9A 2BM0A 2VHTA 5G2OA 5JAHA 3INGA 2O2CA 4MI3A 1C7IA 5FL3A 3UA3A 1WPGA 4H7KA 5LSAA 3R7SA 4TS4A 5B1YA 2XVMA 1Y9DA 3GK3A 4JXXA 1LJLA 1PFUA 1QG6A 3CE6A 4N5NA 4E33A 5K0GA 2VDVE 1YJXA 4C7MA 3QVGB 1WETA 2PUJA 1Y8RB 2QUIA 3PPYA 2KQUA 2JAWA 3I6BA 4ALLA 3CSUA 3LIIA 4POOA 1NRJB 3NTLA 2J6HA 3HRHA 2JGLA 1NL3A 3V3KA 4JI4B 3O5AA 3LFHA 4XE5A 2LKCA 1KPHA 1WQ3A 4H6PA 3TGLA 5JELA 2Y67A 1HT1E 1YWGO 1CRLA 1G2QA 1X15A 3BMOB 1VI2A 4PYKA 1VKJA 1ZH0A 4R40A 3WBFA 4KQ2A 4BMXA 3P0JA 3TEFA 4DJ5X 5JHHB 1EK2A 1MZKA 4BP1A 1ZGCA 3PF9A 1YB6A 2NO6A 1RMQA 2ID4A 3B7GA 3I8SA 4NMWA 4OGFA 1JJVA 3H42B 3IAUA 2VAVA 2ZDHA 4Q16A 3MBIA 1AG9A 4K9SA 2WJPA 4YMUA 5C9ZA 3VPYA 2GEKA 4NU8X 1PG2A 2WIDA 2GEVA 1P6UA 2EWMA 3V8QA 3ABSB 4GX0A 4IJUA 2MYTA 4G2TA 4AY3A 2AR7A 1N7IA 3GPBA 3ZDRA 2I78A 2IZ7A 4GF5A 3DKIA 3UH0A 3MHPA 5LLTA 3O90A 4QEDA 1A71A 2R5WA 2IKQA 3GQSA 4R7GA 3S1AB 3OJLA 4TWJA 4NENA 2ZBGA 2GZ3A 5CM9C 3OX4A 3KAQA 4HLDA 2OZLA 4L6AA 2BFCB 3L6CA 3JQQA 4O2AB 3RSHA 1DIHA 4B84A 9ATCA 3C8MA 2C5AA 2FB9A 3DDNA 2AC7A 1IU9A 1R0BA 1H5UA 4J2TA 3D6HA 4RLQA 1ISHA 1YFKA 2PLAA 2RHTA 4CR8A 1XCOA 2MHCA 3LBFA 1QOQB 3KVNA 4NZZA 4BO3A 4B3FX 2NTNA 5KKCA 4WGGA 1CULC 4FQ5A 5L3QB 5EQTA 5EP4A 4GM0A 1Q83A 4H1TA 3DE7X 3T38A 2VJYA 3H83A 3B5JA 4IRXA 1T1GA 3GLIA 1D4OA 3IJ5A 4A8JB 1T25A 4LNUB 4X63A 2VYVA 1UWCA 3EVDA 1H9AA 2JGAA 2QGZA 2ATIA 3NR2A 4QUHA 1Y5IA 5FXMA 5HJ7A 3BSYA 3B9BA 3OTIA 3NI2A 2Z3ZA 3AP3A 4NU0A 3WQHA 5B7GA 5BVIA 3PFHA 4LWQA 5ALZA 3RJMA 4FYMA 1O94A 2AZDA 2YIMA 4B4UA 2IW1A 2XA2A 4RVGA 2F59A 4RA9B 2DKOA 2J0UB 2NQTA 2C04A 2VWHA 4J1TA 3SKVA 3M4XA 3RFVA 1E3WA 3VI4B 4JH0A 5BVGB 4FLFA 3VZPA 2WZDA 3GEPA 3MOIA 4QDJA 4UTZA 1GGJA 4F93B 2ACKA 2XCOA 1V1JA 1VIDA 3PHIA 3VSEA 3ZZ0A 4G1EB 5FOUA 2PWBA 1AGNA 2QTMA 1FFHA 2XYQA 4ZI7F 1N1DA 5JRJA 4RGQA 1JHZA 3BGWA 4HN9A 4H3VA 1D1TA 1QS0A 1EWVA 5IM4A 3CUUA 5EUQB 5ENZA 4ENPA 3ZHZA 4FHEA 1DG1G 5LU8A 4YQYA 3F49S 2P68A 3OESA 5C2JB 2A4MA 4RAOA 3QTLA 3KOXA 1QFMA 1IXKA 5E9JA 4CMHA 1H4QA 3NHWA 2FG5A 2QMZA 1E2NA 4BO4A 3UMJA 3UMVA 4IQ0A 3IR7A 4ZVSA 3TZBA 2WTBA 3TEJA 3V1TC 2QUZA 3DONA 4IS2A 5J2TB 3KB6A 4IMPA 3R0QA 1KY4A 2WVAA 3AIOA 1KJZA 2Z2IA 3F5DA 4XVQA 2QX7A 3ML1A 2DLDA 4DPKA 5BSFA 1Q3TA 1B42A 2JAQA 4GWKA 4XFJA 4PS0A 4ZMBA 1GLNA 1G42A 2PS0A 2XCLA 4JUFA 4EPRA 2ZCVA 5A5VA 2JIQA 4R0NA 3FOBA 4YPFA 1BN7A 5H59A 1LRKA 4UE3S 3ESRA 3IP8A 2PSEA 4Q4HB 1M2VB 1GNVA 1E5QA 2FPRA 3WLMA 4ED9A 3HUFA 1WV1A 1C1DB 2M1ZA 1PW7A 3H2BA 3Q1KA 5KX5F 2YXPX 1Y5NA 3OQJA 1JLKA 1FMLA 2GN0A 2PSJA 3FF4A 2P6UA 3ER6A 3O1HB 3TNYA 4KWEA 4YT5A 4YV0A 2Q27A 3MNFA 4B3MB 1B6GA 1JR3A 5IKMA 3QU7A 4G2NA 1E8DA 2IUSA 1DV2A 1ZD1A 2ZI3A 2WJ3A 1HFKA 1FRZA 3SC3A 2Q99A 3EYAA 4UEOA 4ABYA 1JQAA 1A7KA 4E2WA 5FOQA 4RSGA 3B2NA 3NBKA 2G7MC 2ZB8A 4RFVA 4WKNA 1DAGA 2XA9A 5D00A 4JI8B 1K3UB 1G5QA 1K89A 3N2KA 2VNSA 5DT9A 4B7XA 5E3HA 4YXFA 1TKBA 3CN9A 4OTZA 2FSGA 5AMXA 4Z6KA 1VECA 5HKBA 3T1HB 1WUJS 5DBOA 2Z1NA 5JARA 1L7AA 1VDMA 2QTVA 2X6RA 4CEJB 3ZHYA 4Q18A 4S1VA 1TUGA 3V7YA 4URYR 1TCBA 5FT9A 3B9PA 2EF1A 1IHPA 1E2KA 3E05A 3HCBA 2WWFA 3O8LA 5JR3A 5AT1A 2C5LA 4F7WA 4ZMSA 1XMQB 3D4OA 2EIHA 2JFPA 5K8UA 1T8PA 4Q82A 3S55A 5JEDA 4ZQEA 1ZKMA 1W1IA 1T5BA 2GRJA 1XRPA 3CVJA 1A9OA 3EIFA 4AN0A 2GBLA 1I5EA 5BT9A 1AZLA 1LI5A 2EWVA 2XB9A 2G4VA 2XHZA 4KO1S 4BNMA 2PWAA 3MJVA 1HNNA 4JYAB 3VZBA 1USUA 2QAJA 1D8TA 1ADJA 2ZIUB 2I6FA 3NHKA 3QF4A 3OEEA 5EMMA 4EB6A 4BQQA 5IVKA 2ZUBA 4HEA1 1YZTA 2ZK7A 4B8WA 1VBFA 4AKGA 1X7XB 4UW9A 2CXTA 3EH1A 4I19A 4XX1A 5K3CA 3EODA 1GFWA 2A9VA 2WICA 1WKBA 2G76A 2CHFA 4X85A 3U3RA 3V4ZA 5INTA 5JZ9A 3GLFB 1EJ0A 1ICIA 3H8JA 1C3XA 1KS9A 2V59A 1KO1A 1JZQA 2Q0XA 3QFTA 1EFVA 1OLSB 2X1MA 3E27A 1M1YE 3UN1A 3T7RA 3HE3A 3H17A 4UXJA 4QYSA 2GQ0A 1CP2A 4G4IA 4F9EA 5IYZA 3CUWA 2P67A 4JLJA 1JFSA 2WA2A 4L2IB 1R5OA 4JEMA 3GRFA 2IYOA 2ZSEA 3WWZA 3F5MA 1PL0A 3ODGA 4YDQA 1JVBA 2C61A 3TB6A 3FGOA 3O75A 4X61A 1G98A 4TS1A 1U0EA 2E3JA 3HEMA 1XEWX 2GGSA 3ZJUA 5CP8A 2AB0A 2PQ2A 3L8FA 3VDNB 3HRKA 4C0JA 3TW8B 4JX8A 4R6WA 3E2IA 3NUGA 3WRVA 4UTVA 1XCJA 2ZYVX 2W98A 2C0PA 3U3KA 2X2EA 1C9KA 1GGMA 2IXFA 4UHHA 3IQEA 3A8TA 4TLEA 3RKSA 1XT6A 2AZTA 2QORA 2W6JA 3K8ZA 2OMKA 3AERB 1QPGA 1BGVA 3L1HA 1J24A 4K5QA 3SC4A 4M1KA 2PZMA 5EC8A 3RBZA 3HXQA 4ZVOA 3ZWCA 3PYLA 3GQBA 5ICFA 1E2GA 3I39X 2WD8A 2Q1SA 3R3HA 1CR4A 1Z6ZA 2P4SA 2WNHA 5JEJA 2IZ6A 2X5OA 4AS2A 3JQRA 2W6OA 3ZQUA 1TDJA 4J0EA 4JOQA 4LEIA 1EE2A 1ADCA 5TPZA 4RHCA 2ZRNA 1Y3HA 3ENWA 2J07A 1YBFA 3FYDA 1U8ZA 1VSBA 2YINC 3CUKA 3NWPA 4GYJA 1JNYA 1M6EX 3QMWA 4NHOA 1ZJ6A 3GLFA 1F4LA 2EQBA 2HHAA 2YHAA 5HZMA 3GFFA 1W6RA 1TNDA 5BQOA 5ITWA 1I0ZA 2WWGA 1UOPA 3A10A 4J16A 3DYVA 4NXNB 1JAZA 4YRBA 5K5EA 4B0OA 4ZGGA 4DNFA 3MJHA 3I64A 4PZAA 2JJ8A 5IYZB 3JRWA 1Y7LA 1Y4ZA 1XNJA 2QTBA 2VBIA 4TOIA 2C2YA 2GCOB 3WJ2A 3ZBTA 4L9AA 4GRAA 3PCXA 3PE6A 2QLLA 3BWBA 1BW9B 4BO9A 3I3OA 1IVNA 4EFMA 3SYNA 2HHCA 2NTJA 3IAM6 2PQMA 1J2TA 1XJ0A 1HE8B 1CUIA 4KWHA 4LKOA 4PAOA 3ZLUA 3VKGA 2Q2QA 3ELBA 1D0SA 2WMNB 4LWZA 3RVSA 1ULAA 2PPLA 3D8TA 4M38A 1LNQA 1XE3A 3U26A 1RXYA 5HZKA 4QUDA 1VE5A 2FJPA 1EVYA 4FFDA 5FTMA 3T7DA 4FR2A 3KKNA 3FHJA 2IDZA 4E51A 4B3BA 1CEXA 3HXMA 3EF3A 1UPTA 2PZEA 4KRGA 4XH9B 2CCGA 3FLBA 1C9DB 4FDTA 2FEOA 2H4JA 2JW5A 3FTNA 1PK8A 4TV9B 1A98A 3PSHA 2XE6A 4M21A 5AKLA 4I4NA 2FAXA 5FR2A 1WP9A 2D5IA 5G0UA 1F2VA 3BB4A 1BEZA 1YFZA 2Q5CA 3BH0A 4X20B 3RBXA 1CUYA 1RRKA 3R6GA 1SBCA 2M2IA 3IOMA 4R83A 3GEHA 1ZWKA 3EXHB 2H07A 3C85A 3ENQA 3G2MA 1TT7A 2JFYA 4J4HA 5FFMA 5IAJA 4C4AA 5FH9A 1ZM2A 3TX2A 1NRXA 2Z6AA 1Z33A 1ABBA 3E3AA 4FKMA 3EXEA 3WLNA 4OL0A 1DC7A 2OCGA 3A2LA 3U31A 3A6DA 1QWOA 1R0YA 2A0UA 4K9LA 4G2SA 1X8XA 3NV7A 1TYBE 4PX5A 2BEJA 2Z4SA 1B8VA 1Z2NX 3K0KA 3WLQA 2Z1DA 1HZZC 4PZYA 3DMRA 3AH8A 2Q0QA 2EFCB 3C7CB 1K2MA 5F1OA 1V11B 2GJ4A 3L4JA 1HYHA 1F51E 3VKHA 4FT2A 3K3PA 1FNMA 2D4HA 2I80A 4WFKA 4AG5A 3F9IA 5KOYA 4JMLA 2HGSA 2M98A 4EGXA 1NQAO 3OIFA 3P9KA 2YOFA 3WYNA 5KWVA 2K7FA 2JGNA 4IJ6A 3X1XA 4G0UA 1YQXA 2IZ1A 2GAIA 1AVTA 3OA2A 4ITRC 4AKEA 3DDOA 1YU9A 3QIAA 1DTWB 2FRDC 3O2SB 2PSHA 4FE4A 4HX2A 4D92A 4CMCA 1AOXA 3IAEA 4BNYA 4EUHA 1FXUA 2ZVPX 3HSSA 4A03A 2HN9A 1Q0LA 4XB6B 3U2QA 4ZYLA 1TF7A 2D5BA 4JL5A 4ON9A 1U9YA 3DEJA 5SYMA 1T4MA 3GV0A 5CURA 1XD2A 1FFXB 4HX9A 4CETA 5K8CA 4KQJA 1L4KA 3DQPA 5CFMA 2ASVA 2HDHA 4FYKA 2CNWA 2QTZA 1U6IA 4WADA 5JROA 2VHQA 1FJ2A 4LBZA 2WQ6A 1OI2A 5JJ5A 1UWVA 1DRWA 1RLJA 1ISFA 2FVXA 3WE7A 4FDUA 3GY0A 1YQ9A 1JJFA 5G0SA 5CH8A 4O3MA 3PJRA 1A1SA 3DMDA 2AOWA 3SZ3A 3WK6A 3USES 4D98A 3LPNA 3VPXA 4KQHA 2DFDA 2HQBA 3VVBA 3EEIA 3AEUB 3QUSA 3M3HA 3HCPA 1TJPB 4ECAA 3UHFA 4IF4A 4LRXA 5LD2C 2H1CA 1NF9A 2XGOA 4WNAB 1XPJA 3AJRA 4PSKA 5BVHA 1Z0UA 1AKVA 3PFKA 3P2IA 5FUXA 1MEOA 3A6GA 3QVKA 5BUCA 4QOIA 1NHWA 1WUTA 2C8KA 5TGTA 3GQBB 5T3YA 1K98A 3N0WA 2ATEA 4JIMA 4KLZA 3MG9A 3LDGA 4B3JA 2BCGY 4N4AA 1OTYA 1UR5A 3SGLA 1ZNWA 2PH1A 2WSIA 3A6KA 2GZMA 2YVUA 3B3FA 4XYMA 5AKJA 5K8VA 2NXWA 4E4YA 4JI7B 1YJBA 1P1HA 3KLOA 4D6PA 2VJMA 1O77A 3QUBA 1VCIA 1L1FA 4DVJA 4F71A 4YCMA 1KMCA 3P71T 4XPIB 3RYHB 3WGQA 1INLA 3W04A 1BHSA 1HE1C 1ZSNA 2I4MA 3JV7A 4K28A 2HQSA 1NVVR 4DMMA 1M1NA 1QAQA 3MJEA 4FEGA 4N12A 3VR2D 4YRQA 1JWAB 1R5JA 3KQMA 3P5BA 3UK0A 3JAWA 5FBHA 2O7QA 3NBZC 4X1YA 5IYZF 1M34A 1VLHA 2GN9A 4BGVA 2BH2A 2APJA 4Y6RA 2WZQA 4DIDA 2GZHA 3UYKA 5IF9A 2PT6A 3TLKA 1GGHA 1Q6YA 3S99A 3LUGA 4TL7A 5HTKA 3ZK8A 3C41J 4MIKA 5IABA 1M2FA 3P9PA 1P9NA 1R6DA 2SECE 1A8SA 2VF2A 1PQUA 4C07A 4E2ZA 3IVCA 1ZK3A 4Q4JB 1K0UA 1U04A 3H7AA 3ZTWA 5KU1A 3FPSA 1IM8A 2KX7A 1J4LA 1NKVA 4FX2A 4XLZA 4AJEA 2YRFA 3T52A 1N8NA 1PVDA 1QC5B 4O2BF 7ABPA 2PN1A 5KQMA 2QWXA 4BZXA 1Z2CA 5SZJA 1CCWA 3H5VA 1KKMA 2BI4A 3BTUA 4YMIA 3F96A 3WDLA 3ZTTA 3S81A 1RAAA 3F5SA 5L7YA 3RS5A 1CG6A 4AUMA 1OHHA 3U60B 2IXGA 3A58B 1QP7A 2NSHA 2O3UA 1QGUA 2BWJA 3M89A 4OP2A 2HF2A 3BRWD 1AKRA 3G2HA 1Z0SA 4MYCA 4IUYA 3WGYA 3IEVA 3LYUA 4N3CA 4YCLA 4AJ1A 3ND8A 2ZYUX 1WLNA 1CUVA 2W00A 2NU6B 4PZ0A 3V8MA 4TV8A 4C04A 4DXAA 1A5SB 5A5FA 2AJCA 2OCLA 5FNVA 1C9NA 3T5TA 4MK4A 1T3LA 1F17A 3UJ8A 3O7WA 4A5OA 5FPHA 4L4XA 4YQFA 3AGQA 3DQZA 4XWKA 3NCHA 1BCSB 1XFDA 4MI1A 4BQFA 1GTRA 2Q3HA 1C3LA 1OAAA 4XRGA 4R1TA 1S4QA 1XEAA 4PCAA 4F5YA 4CL2A 1M0EA 4WLNA 3ZC3A 3JQ6A 3GDHA 1CQWA 1Z4QA 2C1EA 3L6BA 4N3AA 4Q1EA 1DIBA 4Y2SA 1IZ7A 3RVRA 4MWGA 1DDOA 4GKKB 1CF4A 4M1WA 4LJRA 1NNEA 4P32A 2XRZA 4F3TA 1C3OB 4CQMA 3I0NA 3TNFA 1GM5A 2WNSA 2ZWIA 4MQBA 1IY8A 3DXFA 3Q8WA 5DOVA 3THYA 1NLZA 1TZ2A 4KTVE 4GMKA 4KBYA 2BBSA 1DAHA 1TVMA 5KNBA 3H3JA 1WTCA 5JWRA 1G8HA 1P0FA 2Q1YA 2R8BA 2PUAA 5CLIA 4LXQA 1HSOA 2UYHA 2I2AA 3KYDB 5D8DA 5EJFA 4ITUA 3HNOA 4WZ6A 4EUNA 1BNCA 3T61A 4PCLA 3U17A 3UUWA 5BN5A 5KTMA 4DB2A 4DA0A 1W36C 2GESA 2NT4A 4UPVA 3UPTA 4L7QA 1DRKA 1QHHB 1NP6A 1UBEA 4DQLA 2J4CA 5JYCA 5HUHA 1PG5A 4KO2S 1C3EA 4GLFA 4HKTA 1K1EA 2PVPA 4ZICA 4CM9A 4EBBA 3K5HA 1Z26A 4UHKA 2DETA 2BGTA 1JFVA 1P0CA 3QFSA 4FN5A 5LU9A 2AKYA 3F6EX 3V7WA 2HU7A 2JI9A 5AVZA 5T8KA 1IN1A 2G07A 4HZGA 2D0IA 4X60A 3ZY5A 1ELOA 2BKAA 1RFLA 4YCSA 3UAWA 3KHKA 1WD5A 5T67A 1MABB 2QTWB 4EG0A 2OHGA 1X38A 3DPIA 4UUBA 2JI6A 3ZEAA 4AFNA 5KDOA 1HQYE 4CUJA 3LKBA 2GD1O 2QRJA 3P0HA 1ZX1A 1RWXA 3HFGA 3ZEIA 1EM8B 1KMIY 5GP1A 5WRFA 3S40A 3IO3A 3AHIA 1UMBB 1R9NA 3IA2A 2G82A 3KZMA 3ZH9B 1T43A 2R2AA 4AF8A 1NFFA 4EYOA 1Q0RA 1MW9X 4OQQA 5AKXA