5DHQA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
263
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
molecule tags Transferase
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
total genus 64
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhqA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhqA01
2I2BA 4WRRA 2I2CA 2I1WA 3T5PA 2I2AA 3PFNA 2BONA 3V7WA 4DY6A 3VZDA 3V8NA 3VZBA 2I2DA 3V7YA 1Z0UA 5EJIA 3V8QA 3S40A 3V7UA 3V8PA 4HAOA 5DHPA 5DHTA 1Z0ZA 1YT5A 5EJFA 4V24A 5DHRA 1U0TA 2QVLA 2I29A 1SUWA 2QV7A 1Y3HA 1Y3IA 2Q5FA 5EJHA 2P1RA 5DHQA 5DHUA 1Z0SA 1U0RA 4L02A 3V8MA 4WERA 2JGRA 5EJGA 3V80A 3V8RA 2AN1A 3AFOA 5DHSA 2I2FA 3VZCA
chains in the Genus database with same CATH superfamily
6REQA 3MSCA 3RKRA 5J1SB 2VAXA 2Q1UA 3ESYA 5DRYA 5HZHA 4QYSA 2ATXA 3NWBA 2M2IA 1Y3AA 2NUAA 3O8DA 4I14A 3WYBA 4BASA 2EFJA 1Q83A 1JPVA 4EVQA 4YR7A 5CFPA 2FRDA 1IOVA 2PA3A 4B3FX 5KJFA 3EEYA 5A9RA 1MHPA 2CFOA 4AJIA 4JI0B 3PC2A 1Q7TA 4QT0A 3P2YA 3PRKE 1F7UA 4UMFA 2VYQA 1MO5A 1SQSA 1C3OA 3D6TB 2TRSB 1CRWG 1AE1A 2HHAA 3NIFB 3D6NB 3D4BA 4LF6B 1BQEA 3A6GA 4X3CA 3CEJA 2B7BA 1J2FA 3EUWA 4YUVA 3B6KA 3GQVA 2GEUA 4C6TA 4GC9A 2X5JO 4B7ZA 3W04A 2AT1A 2FEZA 4ON9A 4DIEA 3VZQA 4BV9A 4DA4A 3BH6A 4TKUB 3O75A 1TUBB 2Y0PA 4U2GA 3JVDA 3M4JA 3CT6A 1Y33E 4AKGA 1I33A 1ZUNA 9MHTA 2XT0A 4AS1A 3NWPA 3TN7A 1EUQA 1NVAA 3G89A 2OV8A 4NYIQ 5TXGA 3WNZA 3ZCRA 3IT0A 4UHHA 4UKDA 3BXGA 3EW7A 1V41E 2IITA 4X92A 3H1BA 1OC2A 4R8LA 4WDQA 4MX8A 3I6QA 4R1PA 4DDTA 2ZR9A 5DYNA 1MXFA 3MHTA 4OYLA 3W2TA 5KSWB 2ZUEA 1OJLA 1HDCA 2Q3HA 1QB8A 2WUDA 4FNGA 4E1VA 1OFIA 2IF0A 4FFMA 1TPZA 3EA4A 5AKGA 3GLFE 1JH9A 3CC8A 1DGQA 1X0XA 4A27A 1JHAA 2CVHA 1WDKA 2VDRB 2NVWA 2UUPA 3WLMA 3I9LA 4N7RA 4ND7A 1XR3A 3HKDA 2P78A 1C1XA 4IHQA 1NJ2A 4REQA 1SCUA 4TSKA 1JI3A 4ZYZA 1V5FA 3N0TA 3IBCA 1VJRA 1YI1A 4QUBA 2CDBA 2I2XB 3AEKA 1A9ZA 2GZHA 2MOKA 3DBVO 2BJVA 3JQAB 3LCVB 1T8TA 1FDRA 3MS4A 2WP8J 3H5NA 2JNWA 1K8RA 2WWXA 3V1KA 3FWPA 3AI7A 3I0ZA 4CKWA 1M34A 3UQZA 1G88A 2B30A 1Y6ZA 2H4WA 1RQLA 2LRHA 2ZSIA 3IX7A 3NT4A 4YROA 3UKJA 3U7HB 1GNRA 2CSUA 3ZBTA 3ORSA 4F5EA 1X1RA 1XDSA 2A5YB 2GD0A 3VZDA 1A71A 3VA4A 1K4YA 1SY7A 2QMZA 1M6EX 4NPAA 5AW9A 3KDPA 1V26A 4MQBA 1U5BB 1W73A 3FYHA 4S1WA 4UE6A 2DY0A 4ZZIA 1QHXA 3QELA 3OESA 5TGZA 1FRFS 2YXLA 3UMFA 3DITA 1DFGA 1WP4A 2WHPA 4YV0A 3R9WA 3BBLA 3ROQA 4TTJA 1CUDA 2JIZD 5DYWA 5REQA 1P2FA 1GQOA 3A4VA 1E5VA 4KQGA 3WYFA 3NMUF 2I6GA 3BMCB 5E6SB 5FCDA 1YO6A 2W6ID 1BX3A 1G38A 1WX1A 2CNWA 3MQ2A 4U2EA 3NOOA 4IOKA 1BA2A 1H9BA 1BFKA 5AQEA 1IYZA 4X1KA 3WLEA 1YB6A 4MARA 5JY6A 4MCIA 4I5EA 4IYRA 5ERGB 4DTIA 6PFKA 1G9SA 3EMDA 3GRZA 1D7AA 2EG9A 2OFPA 3AC0A 5JVDA 2X1LA 1KJNA 3STXA 2BMFA 4KXXA 2QRPA 1WHTB 4BZQA 4FX2A 3ZU2A 1KU6A 1NLUA 2TMGA 1FTGA 4FIDA 5JVDB 3PU6A 1KQNA 1TKAA 1OYOA 1PBNA 3NJRA 3OG9A 3FXAA 1EK1A 2XQIA 1RCFA 5DSZA 3ROMA 4CMBA 1TQ6A 4RTQA 4AKHA 3UV6A 1DCKA 1LPSA 1PGOA 4NE2A 3DE7X 1JAYA 1ULUA 1V48A 1W46A 1F48A 1L7PA 2ZRMA 3MIZA 3CNNA 2HMVA 3RVOA 2JBAB 1C7FA 2QR5A 3MWDB 1TKBA 3OIYA 4YAOA 1MZKA 4HOYA 2ZTHA 3OM9A 4OGFA 4WESA 1ZM7A 3KB2A 3E1KA 4ZZ3A 4CEHB 1QGUA 5CFOA 1PS0A 3IXQA 5LWHA 5HIAA 3UXEA 3BN3A 4HQKA 3AY6A 2R8RA 4RTRA 1USUA 3ZGNA 3DF7A 1JBEA 4R1UA 5ED0A 4Q19A 4BVEA 1VE3A 1GRVA 4YMUA 3KAQA 1NR7A 2CFSA 3DDSA 5AHXA 1KYVA 1N7JA 4CFYA 2Q7DA 2ZSKA 2BMAA 1G8MA 3DE1X 5DNAA 5KX5A 5CFQA 2P8SA 3SR3A 5A5DA 1GA6A 3OQ6A 5JY1A 2W2XA 3L07A 3MWLA 4ZYTA 2CSXA 3C3KA 3GGSA 1QV7A 4NZ9A 3BM5A 3H2KA 4JBXA 4MRAA 3WOHA 2ZJOA 2PTHA 3TM5A 3MSXA 3ONDA 5AD1A 5IJ9B 3ZHUA 2VJYA 4DCUA 4M4SA 1E9BA 4TKVB 4DXDA 4DR3B 4O5OA 4Q00A 1IB6A 2V4ZA 1L3CA 1GV0A 1TAHA 4G0YA 1NP6A 1ADFA 5D85A 5F5NA 3E48A 4EW6A 2RHRA 2Q3JA 2WWFA 3NBZC 1VJ1A 3EXG2 5KQGA 1BDBA 3CE6A 1MABB 2YXPX 2O5VA 3KPUA 3OZAA 4OAQA 3WTCA 4ER0A 1BX0A 3TTUA 1FX0A 5TMEA 5F2NA 4HS9A 5HKAA 1CQIA 1CR2A 1JR3D 1ORDA 3G8YA 4ZPJA 3V80A 1XZJA 3DLPX 3FPAA 3PGVA 4LZOA 4XQCA 1JFVA 3E8SA 1LI5A 5EZYA 4YQEA 3W5IA 3IHWA 4EDFA 4KPEC 2A59A 3WYEA 4EUFA 1L7XA 2PH5A 4QDZA 4B3SB 1A72A 1YE3A 1ZJWA 2O0HA 3JQFA 2ZULA 2AKAB 4MULA 3D7MA 3ML1A 1YULA 5EJIA 1ODJA 2XTNA 3QLUC 1U0BB 2JLYA 3I2HA 2AI3A 5JQWA 4O4IF 1EDZA 4FEYA 4YR9A 2PGJA 4N39A 2OE2A 2QRJA 1V4BA 2ZZKA 3RYTC 1PSDA 1ODCA 1O95C 2ZYAA 4N1AA 5C2JB 2UUCB 2NZ8A 4H87A 3PG5A 3GLTA 1PE0A 1OLUB 4MR7A 4AJLA 1YFLA 3CVJA 2EKZA 3E7FA 4YALA 1L8XA 1KDZA 4CL0A 2O59A 2FEOA 3G2QA 3UAVA 1PWXA 3HKCB 2Q28A 1TM7E 3Q4GA 4R8MA 3M6IA 3HUFA 1CS0B 4A4DA 1N2BA 4LOLA 5H70A 1LSJA 4AJEA 1E0KA 2HX1A 4IFBA 3H42B 2BKUA 1DAMA 2FHSA 4QPJC 1USKA 1ZVMA 2VH1A 4MNTA 5IBPA 4QG3A 4CIDA 1QANA 3FAKA 3AUTA 4C88A 5L3QA 2REXB 3GWGA 2XUOA 3IO3A 1E1RA 4MGHA 3CUVA 1RMTA 2NYAA 3GMJA 1LRKA 4C01A 1PO7A 1E3JA 5DWDA 5K0TA 5L4LA 1ZL0A 2VFAA 3RRBA 4HH4A 2DBRA 2FK7A 2A0KA 4CEJB 1CG6A 3LKVA 2QXUA 3NAQA 4MW0A 2C8KA 4DKJA 3DDNA 3IP1A 4YAWA 2MWMA 4ALNA 2GMWA 1Y63A 4QFDA 4Y8VA 5HDBB 4P2GA 4Q3AA 4LVNA 3HA5A 1UMKA 4AJNA 1W88B 1XXHA 1ZY2A 3ICVA 2P3LA 4AZ0B 5E1BA 1HNXB 1ST3A 2AOTB 4EVIA 1B8PA 1WPRA 2H51A 3THYA 4O2AF 4QO8A 2ZYUX 1PV4A 1YVEI 1WLYA 1CW2B 4JK3A 4RLFA 5K3CA 4JCCA 4YGYA 5DKFA 3TXXA 1E1CB 1FS4A 3FDXA 3IT2A 4OXRA 2EJTA 4NCIA 2ZKLA 2ZWIA 3MWYW 2G9RA 1D2NA 1PDVA 2RD2A 3CVXA 2JQJA 1LLFA 5K3BA 2VQFB 5IS2A 1GM5A 1U65A 1VSQA 4K9LA 4TS1A 4GPBA 4DLZA 1XPRA 3RUHA 1V7CA 5JNSA 5FRDA 1KBOA 1T35A 4UHKA 1YQQA 1NVXQ 3AFGA 3D43A 3TBFA 2QI9C 3D0OA 4PZZA 2A86A 3EWAA 3KOZA 2N75A 3LQ1A 2G6TA 3H6KA 1LNQA 4I4NA 5HF8A 3MMPA 3QFTA 2PUHA 4KR9A 3DDZX 5CURA 1RAIA 1VJDA 2NU9A 3NC0C 2XMQA 5DGHA 3TLGA 3MERA 3ZW9A 3LHSA 3IUBA 4XOUA 3X2FA 2CBZA 1AKYA 4J0GA 4ZMRA 1FFDA 1RKVA 1GQRA 2A58A 2VP6A 4NDAA 3LH5A 2WU4A 3OLVA 1DS6A 2JAOA 4PF1A 2YFHA 4CR7A 1KGDA 5HYVA 5K8JB 4X90A 1SPBS 3MUEA 1GQQA 1ZD4A 3V4PB 1AO0A 2Q0HA 3GG9A 1QF7A 1SCBA 3DL7A 3F6SA 1IY9A 1K7SN 5EUCA 2H4XA 2OD2A 3BE5A 4JT8A 2WTNA 1SU6A 3KYIB 5AIAA 1M10A 2QPTA 3Q10A 4DA9A 2BP7B 3DMPA 5AW7A 4LOAA 2YJNA 2WZCA 5EYPA 1SC4A 2VR1A 2CL6X 1GLNA 3OPNA 4X1KB 4I1SA 4WNAB 4OLAA 4N7JA 2B6NA 2E4WA 5B55A 1NTRA 5K8UA 4KU0D 3H1PA 2CLKB 5FBRB 5FWXA 4A0RA 2HEGA 4AMUA 4MDEA 8LDHA 2OZLB 1Y7TA 2QD5A 3T41A 4Z7NB 4KGDA 4O0MA 5BWBA 2ZJ4A 1JQEA 4CBVA 3IKVA 1QAOA 3TCNA 3MMXA 2AG6A 2FXIA 1EVZA 2PKWA 3FH0A 3JYNA 3H9CA 2DFKB 2V7QA 1JNYA 1CZLA 3NANA 4KGXA 5FLEX 3MMZA 3MF4A 5EIHA 1W49A 1J4OA 1E9VA 2EGHA 2HW8A 4E11A 1XMIA 3ETEA 5I7WA 3OD1A 2W58A 1GZVA 1FDOA 1JX6A 2HWUA 3L43A 1OBCA 4H7JA 1WXHA 4YRAA 1XZEA 4EG5A 2FEWB 2GYYA 1ZCJA 4QU9A 1HH4A 3BSYA 3DQZA 3DSRA 4K6HA 1Y4AE 5T3UA 3V3KA 3R44A 421PA 4CF5A 4ZJPA 4QXQA 4QC2A 4R2WA 1TLTA 3MCAA 2XCTB 4BUZA 3JQEA 3A1CA 1TKCA 3AJ8A 2F17A 3ADCA 3N2NA 4BB0A 4FFDA 2E21A 4RD3A 2ECQA 3QLVA 4AF6A 1QDLB 1RRPA 4ZT6A 3IT1A 4CM8B 2C31A 1J00A 1Z0AA 1XMPA 3ZK9A 1XMXA 5ALUA 4PXYA 2IU0A 1D0SA 1GKKA 4TXLA 2AI1A 3G7UA 1FW8A 1JIXA 3KO8A 1WPGA 1SEPA 2Q5QA 4G67A 4Q1DA 2O8NA 2XA9A 5IYZA 3I32A 2Z98A 1PUXA 3JZIA 1JXMA 4E70A 4UM9B 1JR4A 5H3HA 3UCEA 1ZMXA 2XMDA 1HQDA 4D8TA 1YBFA 1DMSA 4GNRA 4LA4A 3SE7A 5KSYA 4HYEA 3EF0A 2ZUTA 1FP2A 5EJFA 3M4XA 3WBBA 1NUPA 4FD2A 5E9JA 3WICA 3WV5A 1K6IA 3KWMA 5K7SA 1A9QA 4NU6A 2ZRDA 2BHRA 3SZLA 1S7GA 1G3GA 3BAZA 4ISBA 1P0MA 3OIGA 1ZK1A 4LYFA 1A9YA 1MGOA 4QLBA 1FXSA 4DLNA 1MOPA 1TZMA 4EI2A 2CUKA 2OBMA 3BZBA 3TPZA 1NUTA 2FPKA 1J2YA 4MGIR 3OX3A 3S2FA 3MIIA 5KBYA 3LJKA 2PL1A 3H99A 3QFHA 4XWYA 3U2QA 3BF7A 5MGBA 1AN0A 3DLTA 4D0SA 5EZYF 3NB0A 2DFTA 3O93A 2BRUC 2R6GA 1T3HA 2CHGA 4R9SA 4NBNA 3GGDA 4G0UA 3AQ4A 3O94A 1WNFA 4GBED 3KZNA 1ZD5A 2FMFA 4C5AA 1TVMA 3BFKA 4WEQA 1L4GA 1NBMD 1PZMA 1QTRA 2MINA 1XL0A 3L92A 4PO3X 3MBOA 3LZCA 4PQGA 4L0DA 4MW6A 5E1DA 3GUHA 3PGMA 4E0BA 4JEHA 5BW5A 5KINB 1O89A 2YXBA 4GPZA 3KXDA 3A58B 4PO9A 1J49A 5KYWA 3O3OB 3DBOB 3W5DA 4KIJA 4Y2TA 4Q4LA 1D09A 2WVAA 2PKQP 1IUKA 3IHTA 1IY1A 2V8BA 3WWPA 1FMFA 3V97A 4Z4IA 4JIMA 1DAIA 1LD3A 3GFGA 1KL7A 3RFCA 1XVLA 5A4KA 2K2QB 4XB2A 5H16A 3NC1C 4R83A 2VH5R 4KHZA 1GA4A 1MVLA 5JD3A 1SOAA 4RPKA 4YLGA 1KZ1A 4LNUB 1YS1X 1K4KA 5JBIA 1RJEA 3BWEA 3IUNA 2TMKA 4ZZ1A 2B3DA 1V8PA 2F8LA 2VSQA 4LYYA 3DMRA 3D2LA 1MXHA 2P9HA 4LYJA 3A2MA 4FM9A 2Y77A 4GQIA 1NV8A 2XLBA 4QBGB 4N48A 2LXNA 2EBWA 2PGOA 1W0JA 1CFZA 5BYBA 1KH2A 3OCVA 4MVJE 1QH0A 4NPCA 4DRXA 3BZUA 3DT9A 4FFVA 3T95A 4MUMA 3V1UA 1O54A 2ZSAA 3IE0A 1W85B 4QD3A 2BEUB 1Y7PA 2C5FA 3NP9A 5HKBA 4ESVA 1T0BA 2C5EA 3OLWA 5AUNB 3K0FA 5LMNB 3RJTA 3IIMA 1MF7A 2C9CA 4UDYX 4JBNA 2EF1A 2XWQA 1N6KA 1MO3A 1WUHS 5AFSA 1EHCA 1UJ2A 3PPYA 3KWLA 1PL7A 4MWTA 1QZXA 3TNJA 1DBSA 2FPLA 2O50A 4MVJM 2W2KA 1US8A 3NH9A 1OT5A 3ZWWA 2C3YA 1JMKC 2I71A 1KC1A 4HFRA 4RHFA 5L3QB 4OJNA 3QVXA 1H6BA 1Z2OX 3R5JA 5ARDA 4F3YA 5BR1A 3GPCA 1RABA 1R0RE 3KXPA 2VNIA 4GX1A 4HGZA 3UATA 4O2RA 4OMDA 4C20A 4NBSA 3PXCX 2QDKA 4C2BA 2AFHA 2E5FA 4X1YA 1HA3A 4LMRA 3OECA 4QBTA 2ALJA 1H6CA 3WA6A 3ZCPA 4EW2A 3AV0B 2JIPA 4KO1S 2C5BA 1Q1GA 1SUAA 2VJBA 4NFHA 1RI5A 1Q0LA 2FUEA 3AY3A 5FNZA 2ST1A 1VP3A 5K0CA 1QRSA 3W78A 4DLKA 2RHJA 3VPDA 4LF8B 5HF9A 4WH0A 1C9MA 1UEIA 4Z9BA 4EUNA 4KSCA 2AYYA 3BSWA 1S2NA 1G6OA 3O4IA 4Y2HA 1KQOA 2V9PA 3L41A 5IAGA 4Q66C 2PK3A 1OPRA 3RVMA 3B36A 1Y6GA 2W0MA 3W5BA 4AMYA 4LG1A 1JDJA 2K5UA 3TFQA 3S2SA 3WLSA 1AXEA 4A0SA 2ZYDA 3G88A 4RA6B 1M3SA 1MH1A 1RC1A 4TMTA 5KKNB 5LB4A 3NAZA 5LZ5A 3TLJA 3UGTA 4UHBA 2DTDA 1EVJA 1NN0A 1R8XA 3H5RA 3RS4A 4XJSA 3V8QA 2ZDQA 2HY7A 2FUG1 2R7KA 3DXZA 1AMNA 2X3FA 2G7ZA 8ABPA 1KK2A 5FWAA 2J0UA 1MRSA 1SXJA 3WLTA 4YCLA 2EVWX 2BEKA 2D59A 1OW3B 3EIQA 1LKZA 1FU4A 1ZI9A 3FCSB 3TLYA 2RGCA 1PVVA 2CVFA 5ISMA 2UUBB 3WGGA 2VP9A 4GMDA 4YMHA 2ZJ5A 4LK3A 4C7OB 4KXWA 5TQ2B 3S8EA 1OI4A 2W43A 1LV7A 5ITZB 1ZN9A 1KBZA 3KELA 3OUZA 5JIBA 1QHIA 5D5HA 3HNPA 4B47A 5AW2A 1XZPA 2BHSA 2FZVA 2IUSA 4M0DA 3L6DA 4K6CA 2CWWA 1GFSA 3QXCA 1Y1TA 4O4JF 5AOBA 4I55F 4OI1A 2DHCA 5CA1A 1VMIA 2PLNA 3HKBA 1G7SA 1IY2A 4RKQA 3ABRB 3K1JA 3MRSA 3OZFA 3VO8A 5JCOC 2AFIA 5L51A 3K4PA 4EYKA 1GA1A 4GVXA 1EGAA 3FHJA 1Z2CA 3E2PA 3G17A 3W5UA 1XLUA 4FB5A 4V39A 4P3YA 1OXUA 3Q2IA 4K87A 2Y1GA 5AO9A 4AZSA 1YCGA 1FSZA 2MMGA 4OP3A 4ZOEA 5KIAA 1WD7A 4NDNE 2BE7A 3O9ZA 4GGPA 4KBFA 4IBOA 3GLRA 1QX4A 2ACEA 2GM3A 3GG2A 2OMEA 1RWWA 7GPBA 1AQYA 1PNOA 4FGKA 1F8YA 3KB8A 3Q3IA 1Q50A 1YQTA 4NZNA 5JYEA 1DRWA 1LGYA 4AXXA 3LGSA 4BLPA 4G23A 1RYFA 2UZIR 3U49A 2Q9CA 1PQUA 2EL7A 4GQBA 3ZDQA 5J59A 4GZ3A 4NHOA 1CZHA 3CH6A 4C08A 3M1YA 2MIIA 3EE6A 4EBBA 3AL2A 3I0NA 4FZ3A 3EVCA 3L0BA 3UV0A 4MMYB 4F4CA 3LXUX 5JAMA 3GLHB 1ZI8A 2ZAOA 4PYQA 4HH3C 1M1NA 2QR2A 1QYXA 3P9NA 1T6ZA 1WWKA 4DWJA 4B5KA 4YRSA 4H9GA 4IIUA 5T5QA 1DLIA 1NBME 3KVYA 4U5QA 2CT8A 1UR5A 2VJAA 2QNRA 1B15A 1GNQA 4MUIA 3LA6A 4IR7A 1TU0A 4EFLA 2PWPA 4MUGA 5TC4A 3WDLA 1DOHA 4XI9A 2D1YA 3KALA 1DRKA 3QKSB 5KSOA 4QICA 1HUQA 4ZVKA 1Q1QA 3C3BA 3W6NA 4R3UC 1QDUA 1T0JB 5HNKA 3DOUA 3E7WA 4OQFA 1KDYA 3NPMA 1U8EA 3ZGYA 1P3Y1 1NP3A 4YAUA 4J2OA 2BGTA 2I34A 3UPUA 5IN5A 1HLFA 4H16A 4LYEA 4C4SA 2JHGA 4CQJA 2YMLA 1L5HB 4OQLA 3FTDA 4E5NA 4KVZA 1XQ1A 1S4QA 2DPLA 3QBJA 4LVUA 3UJ8A 3UO8B 2BRFA 2BC9A 4C4OA 4DLYA 5JH7A 2QRQA 1NLMA 2VDJA 2EEPA 3DEHA 4JH0A 1LWNA 1ZEMA 2OM6A 3M82A 3CLUD 3MVEA 5H4GA 5B6PA 3Q8XB 2G07A 2HHCA 1CVRA 2B94A 4NJEB 2HTFA 4CTKA 2OZKA 2C77A 1ORRA 4OM8A 1JG6A 1X13A 3CLRD 2XAAA 3M4YA 4RKRA 5EZYB 2PR2A 2QVXX 2GS9A 5KYVA 3NDBB 3C3CA 1BKSB 1IK6A 2C04A 4Q1CA 4UNPA 1A1VA 3E3LA 4HQOA 4Q9KA 2HR1A 1DAOA 2FSGA 2ZPAA 1FX0B 2RH8A 4FFBB 4GMFA 3QGMA 4HWOA 1E3DA 1T2EA 3BHNA 4KLZA 5DCYA 3VPGA 1CYEA 1VHDA 1JLHA 5AVZA 3IPRA 5JCZA 5FFMA 2FW8A 2X76A 3CZ4A 3LDUA 5TY0A 6LDHA 1H1LA 5C32A 1PDWA 4Z6KA 3HKDB 3AOEA 5HM8A 1HWYA 1SU8A 1ISGA 1FU8A 2BF4A 1QKJA 3ORFA 1BS1A 2DQZA 4P31A 1FB5A 3WBFA 2JJYA 3CTMA 2CW5A 2IBMA 4FFBA 4BWVA 5HGJA 4A16A 2XWPA 1RHJA 3QE3A 4QUDA 4N12A 2VJQA 3NBMA 4ZMBA 1ZW1A 5AJYA 1SVMA 1T9BA 1ZGHA 4FYVA 4TYMA 4O1HA 3N2YA 1EQUA 2CGEA 1RKUA 2CJWB 2LDXA 3AFMA 3F5MA 1N9GB 3ND6A 1DG3A 3P5BA 5JLJA 2B9EA 3Q7TA 3WGYA 4I4CA 1UWLA 4RLSA 4TTQA 1NXWA 4CUJA 6ABPA 1A8HA 3KL4A 2R48A 3G1WA 2IS2A 2V5UA 2V6JA 1M33A 2XD4A 3HMKA 5ED4A 1JHUA 3CX6A 4J43A 3IMEA 1K7EB 3LE8A 3WL3A 4BGVA 4EECA 3CRNA 1SCIA 3HKCA 3VOSA 1G3QA 2X8LA 4C3VA 2R8XA 4EJFA 4KXFB 3KTAA 3MTIA 3HO1A 2D2FA 4Y98A 4Q03A 3OOWA 3F96A 1KIAA 4BEJA 4A36A 3B9PA 1B8OA 3GCXA 3N76A 3O26A 3QU5A 3MBIA 4Y9DA 3LECA 2H2GA 1MGPA 2QLFA 4FONA 3UXMA 1FEZA 4CU5A 4EHIA 2WF5A 3BXFA 4GWLA 4XGRA 3AFNA 5EGNA 3ZZ1A 4INOA 4YREA 2MYPA 1U7HA 5DE3A 2ZSHA 5EERA 5FNVF 3JQ6A 5EHZA 1U8AA 4P36A 2ZSBA 1I3LA 3FYUA 1EAYA 1Y5MA 3NVDA 4C21A 4F97A 4YRKA 1HXHA 3EMBA 4I1PA 1Q16A 1U2QA 3MT7A 1EE9A 3OE7A 2QS9A 4RBNA 1WCXA 2F64A 4RZIA 4BL5A 4XCQA 3QEAZ 4MS4B 4R0VA 5ALOA 3O84A 2LTAA 2OSBA 1STOA 1EJ0A 1Z6AA 1X8JA 3E9RA 4S35A 4XB1A 2YZ7A 4XYGA 5DSXA 4CKEB 3TZLA 1TYEB 1VLMA 2J67A 3NW9A 5JWHA 1II9A 4JJ8A 2OP1A 1RW4A 2AJCA 3SAJA 1KORA 3CNLA 5IJAA 1AK9A 3LK6A 1T4CB 2NU8A 1FFSA 2H9YA 2CLMB 1LPOA 2C59A 4RGYA 1NQVA 3U17A 3F90A 3GI1A 1B0ZA 4JJ4A 4ZVLA 1UDRA 2DQKA 4L5CA 1Z4QA 5EUQB 1JGTA 3FVTA 5K5EA 4PM4A 2NUTB 1N5MA 3JAKA 3OICA 3AUYA 1UXGA 4AY4A 4ENWA 3S81A 4OLJA 3ZNOA 3CFYA 3UUWA 2GJ8A 4U3JB 3GEMA 2CMKA 2XR1A 1L5HA 5IABA 3LCCA 4X8OA 4LJ7A 3C4JA 2WYIA 1FLDA 4AO8A 3GH1A 4ID3A 3KT0A 3ONFA 1VCIA 2Y3IA 3P9XA 2O8FA 1C4KA 4HPXB 1FJXA 1KSFX 1Y8CA 2WF8A 5HJEA 4JC4A 5CUQA 2W2MA 2AFVA 1C9DB 2RAPA 2WC1A 5CLJA 2I76A 3HLYA 2PCLA 4HLUC 4A6PA 4R84A 3RLIA 3D7NA 2RJ3A 4LYAA 3T06B 2FQYA 1SM4A 3P0JA 1L5NA 3U3KA 2VZLA 3F7NA 2IUFA 1HM5A 1WW3A 2P77A 3AR3A 4AI6A 4WVFA 2QG4A 3BFJA 4ZO8A 4KQXA 2RH5A 4QGBA 4EITA 2ORVA 3AX6A 2XMBA 2PA0A 1NWCA 3AYXB 2PUJA 3AEKB 1OF1A 3IELA 2HU2A 3R23A 1EFRA 4H35A 4P2BA 5J4VA 3ZWYA 1Z6PA 4EHNA 2AHRA 1HGXA 1WKCA 1Z15A 3B7GA 3QV1A 3D4PA 3AERB 1VLJA 4MW1A 3CF4G 4M98A 1RLUA 1YOVB 1ZEJA 3PP8A 4GE3A 4AWAA 4AUMA 4PPQA 5JS6A 3OT1A 2CLHB 3Q6MA 4PNPA 2ZI9A 3W79A 3E27A 4I5IA 4AD8A 1WETA 2NZYA 1T6BY 1KMIY 1ZIYA 3HHPA 4CQLB 1THGA 1M1YB 2W6QA 2Y4NA 3N0VA 4X5OA 3RT9A 3LWNA 3M89A 3RUPA 3KQVA 2IYEA 1LH0A 2J4CA 4TZ0A 1ZAKA 2N0SA 5EQFA 5EI5A 4MSUA 3KJQA 4DJTA 4DRZA 1LW6E 4R5MA 4BNFA 4LF5B 2D06A 3LBYA 3HKEA 5F77A 3OTWA 4E5DA 3IVMA 1KMQA 4AULA 4JQCA 4QU5A 4YGXB 4S2UA 3VYTB 3FOAA 5LQDA 2L2QA 1PRYA 1YGPA 5DGIA 2IYTA 2WAAA 3U4QB 4A91A 2PUFA 1KWKA 2HRRA 4KP7A 1RRKA 3G7SA 1JQAA 1Y8AA 2W2NA 5AHKA 3II6X 4Y1RA 4IVNA 3WA7A 4NXNB 1SD2A 5REQB 4D5GA 2NX2A 1V6SA 4UEQA 4ZV4A 3MHPA 1Z63A 4Q1EA 3VUEA 3H65A 4G1UC 3HRHA 3SPXA 2YWFA 5JXHA 1P29A 2X42A 3AUSA 5E7JA 3L93A 2X5NA 4NP6A 3MG9A 3W8EA 3OF3A 5FWDA 1VYHA 1PJRA 1I2AA 3OEEA 4XUCA 5H8WA 2AFHB 4X1YB 1H6DA 1SKYE 3WMRA 4NG5A 3PGXA 1IUOA 4KU4A 4DJAA 5I4IA 3H0EA 3OLXA 5LXTA 1ZM2A 3AEQA 3HM2A 1E7MA 1H8HD 3B70A 1BXGB 3RRYA 2CFTA 4GIBA 4F91B 3W3AH 1FVFA 2OKCA 4C4RA 1Y8QA 2G71A 4S05A 4P82A 3UWPA 2B2XA 3SNHA 4ZEVA 2INGX 1TQ8A 4Q3OA 3CH4B 2ETVA 3DNFA 1TECE 3WY9A 3UPTA 1F2UB 3NKLA 5C4MA 4RZHA 4HGNA 1NVUQ 4O4IB 3VGJA 3L4EA 3AXTA 3NHKA 2WSSA 3L0CA 3UK0A 4EMTA 3KXKA 5EP2A 1ZZEA 3CU5A 4D41A 1QPBA 4RZXA 3MT0A 4HBGA 5BR8B 2P3QA 4TYYA 2OHJA 621PA 3QE2A 3Q7IA 2FZKA 2CVPA 1J9ZA 3PLRA 2BUBA 3I28A 1VOTA 4NTZA 1B3RA 3PHIA 5EJ8A 3IVAA 1CFJA 4B3MB 5KNDH 3C45A 2QZJA 3WSTA 1ATIA 3H13A 1E2EA 5EWJB 3OD5A 4GZLA 2VYND 1YDHA 5L7TA 3C15C 4S0ZA 4X1OA 2XKJE 5HK8A 4EUEA 1DC8A 4OQPA 1WUKS 4F2HA 2QVBA 4FE7A 4G0PA 4JR1A 5FXMA 4LGMA 2GYVA 3IIJA 1U2ZA 3HZRA 2YY7A 2NZXA 4HXYA 5JECA 3NIBA 3OTGA 1I01A 1TO6A 3KFXA 1ORHA 4GD3Q 1GNPA 1Z6YA 4MP3A 1F8UA 4E33A 3IQGX 5HRCA 2P7HA 2NQTA 2NO6A 1FUYB 3A1DA 3ZD9A 1HZZC 4M1QA 1GKYA 5KHAA 2ZZMA 1D1TA 2NPIA 2OCLA 1EVQA 2GSDA 1CJTC 2ODBA 4WXEA 4XSGA 1ZW6A 5HTKA 1WNTA 1QDEA 3UOAB 3BDAA 3NHFA 3ZGVA 3THWA 3U19A 3U44A 1OB5A 1PJZA 3OJXA 5DIFA 3FZGA 2I33A 3TLMA 1CD5A 2O6LA 1HKHA 2A2ZA 5AH0A 1V95A 2DB3A 4URWR 3GBVA 5LQRA 3O1HB 1YJ5A 4MZXA 1JPNA 1FFXB 1XRMA 4N0QA 3B6MA 1QOQB 3HE3A 2OCDA 3IILA 2VZEA 2JZCA 5JZOA 1E2KA 2DLNA 1O96B 4LY3A 3GPDG 3N7UA 1LCIA 3O21A 4V3BA 1I9GA 2FKAA 2JIMA 3ZHCA 4BLSA 1Y4UA 3VYUB 1VCOA 3F3KA 3R5XA 1T3LA 2PUVA 4MRRA 1CZUA 1H05A 1Z2DA 3QMMA 2QYHA 4HAIA 3RNOA 2EG5A 3DXXA 4IUBS 3WZLA 1T1SA 2V0CA 2Q4BA 1XZHA 1RMYA 3FX2A 4K8RB 2BTQB 2QTVB 2EL9A 2RGNA 2WA1A 3F2VA 3ZXSA 4I4LA 2ZUFA 1IN1A 2VJKA 1B6TA 2RAFA 3EXFB 1KH1A 3WYAA 4ECAA 4OG2A 3KPJA 4EFKA 1NVFA 4XGIA 5EHXA 2OOKA 5IN4A 5KTMA 5FTNA 1KEUA 3BGSA 3QU9A 1DKUA 1UXJA 1R66A 2VPZA 4WBXC 2J0SA 1HZZA 2MYNA 2WM9B 3FDFA 3HVUA 4X3PA 5H68A 3AEYA 1BD3A 2AC4A 5AI6A 3HVIA 3DYVA 5KS2A 3RC8A 3GLSA 1P81A 4WAUA 1CIPA 1GG9A 2Q2VA 2EKPA 3B1FA 4J29A 2PZJA 5ALXA 1YZ3A 3UW1A 3WGTA 1JJ7A 4P81A 3VVLA 3OT5A 1INLA 3N7AA 4BLVA 5JSQA 2DTEA 2XOEA 2YOGA 4DG9A 4QGFA 1AMUA 4KR3A 2O2HA 5GONF 5C8ZA 3FNBA 1N3LA 1R2QA 3D4IA 1QFZA 4ZYXA 1UIMA 3PXGA 1YJ5C 3GEIA 3H04A 3VHXB 3JYPA 4IHAA 2O0JA 3WAKA 1JLMA 3LW8A 3MCUA 1T0PA 4IHKA 2X6QA 4OHZA 5DNUA 4CZ2A 2V6GA 3CH7A 4XWKA 3C5HA 1NSFA 1N1EA 4JGGA 2I22A 4YP1A 5FI0B 2PUCA 1UOQA 4GRDA 4KH0A 2Z08A 3DEJA 3AKCA 3IDOA 2OORC 1FNCA 2JFOA 2CHVA 2F4VB 4Y0VA 3ELDA 1W59A 1CY0A 4L6AA 1K98A 4ZQCB 3TNDA 3LRTA 3QENA 4NFSA 4YAKA 5I45A 5JSUA 1A04A 3GXOA 4PLZA 5JELA 1N57A 1M0TA 5JPDA 3NVMB 4O2LA 3U4IA 2Z83A 1BCSB 1IVSA 5DOZA 2HCJB 2J85A 2PNJA 3ZS9A 3C5VA 1XNJA 2O2CA 4UFOA 4RA6A 1AMOA 2XNJA 3I76A 2O06A 4ZGGA 1OZ0A 1NXSA 3PKIA 1CUAA 5FUYA 1CZOA 4CF4A 3QVGB 4RSGA 1C1DB 1W7AA 4EY3A 2G70A 3C87A 2I3BA 5FPKA 3HGQA 3CLSD 3P9PA 1LS6A 4PTZA 1RAGA 4E5UA 5CA0F 1MEJA 3FZNA 1U2DA 2Q0QA 2WA2A 3B5JA 4A2QA 2PX3A 3R6LA 3AHDA 1EPUA 2QVCA 3JAWA 3AHJA 3L04A 3MPUA 5C5CA 2VDPB 4N9WA 2E0IA 4HAZA 3UKDA 3VH3A 2E7ZA 2OO3A 4ESHA 2HD4A 1ACLA 4IOLA 2EBHX 1Z13A 2GFQA 3EB9A 4R9VA 1Q14A 1ZWLA 3LUDA 4JOQA 4P3XA 3RG8A 3SVLA 4KQ9A 2Z8YA 3DPUA 2G83A 1R64A 1C4WA 2XRMA 4DV0B 2XTZA 3O38A 4NH4A 3I6YA 4JAVC 1SHUX 5D86A 1TA0A 3WGUA 4BVHA 5SZHB 3CVWA 1PKEA 2HYDA 3QKTA 2PEZA 3OA0A 4JASB 4US1R 1OX4A 1ZQ1A 1GAQA 3Q3JB 5BWCA 2PZGA 3IDSA 1CJSA 2HMSA 2WHYA 2AZMA 3K5PA 3MTQA 1H2ZA 4OMFG 3HFRA 1JJIA 2RJNA 2VBGA 4LKOA 5F4ZA 1OX6A 4ML3A 2H1HA 5CB4A 3AVTA 4XFKA 3BUSA 1P77A 4H59A 1W4ZA 4KJZA 3RIYA 1TRHA 5FAXA 3EXHB 1CXZA 4IH9A 3IGFA 4GL2A 1C5KA 4PSVA 1OLXB 3GRFA 3SZ3A 3UAZA 3TD2A 4BUJA 3RREA 1RAAA 4OQZA 2VNHA 2XVAA 4RGQA 1GVNB 2GM5A 3BMNA 1P2DA 1J25A 1AHNA 1U90A 2WJPA 4IG4A 3EUFA 4L6CA 5G2OA 3FUCA 4C4XA 3GT3A 3C1OA 3WR5A 5DDIP 3AXSA 3F5DA 4JQYA 1QGDA 5JERA 2RHBA 3UFBA 1LDEA 5F35A 3ILXA 1N2CA 2ZIWB 1CUJA 4HDKB 4R1MA 4BBPA 4JJEA 1YAHA 6GPBA 1M8FA 2C8JA 4XIJA 5DCWA 4GYWA 2UXBB 4JI7B 1G9XA 1T5OA 1NPYA 5HA5A 4PRYA 2DPMA 3QVVA 1VBFA 1SZPA 4A92A 1MB0A 4FYYA 4CIBA 4JVNA 5BSWA 5CITA 4WWHA 3RB8A 2FWNA 4QU0A 4DQXA 5AM5A 5HFJA 2R85A 3BHMA 2AXPA 4I08A 3RASA 1CLUA 3E7PA 1OH6A 1JE1A 3I1YA 4NFLA 4NBKA 4XUEA 4DNFA 3HBAA 1ZAYA 2QAGA 1ZD8A 1K0UA 1ZN8A 2A9KA 2V4MA 3IQIX 4PGFA 4HP8A 2G40A 4DXAA 5AM2A 1YA6A 4L4XA 5K3AA 2QNBA 3TECE 5JQGB 2EH0A 1L7QA 1PFGA 1LBSA 4MDHA 1Q6YA 2HK7A 1LPNA 4A0FA 2JCGA 1UC4B 4P3PA 1VB3A 4E3WA 5BN4B 3QX9A 1XF1A 2GPSA 3N7TA 2XT9B 2PSDA 2Q6OA 3IUJA 3LDGA 2H5IA 3BEOA 5T64A 4U7DA 3ER9A 4JA2A 2AHOA 2JI7A 4PO1A 2JK0A 1HLDA 2NYRA 3Q15C 3BC1A 3FWNA 2ZPTX 4MUXA 3PF8A 4DUPA 1NZJA 2W2QA 4UUNA 2YIVX 4RJJA 2Q1WA 5AI0A 4L4YA 3KQOA 1Z35A 2R8EA 3MA0A 3DAFA 3RTGA 2O8BB 4J6FA 1JIUA 4OKIA 3Q87B 3VU9A 2B4QA 3HSKA 3OP4A 2ZRIA 1NN3A 1Q3KA 2WIFA 4M1KA 2AJTA 3WGJA 2FF5A 3ZU4A 2V97A 3A4NA 4IIJB 4WSOA 1QIGA 1HG1A 2E4ZA 3KQKA 1TIBA 1TM3E 4PHTA 4TWAA 3O3MB 4HAXA 1NI4B 2C5SA 2II6A 3DB1A 3L40A 3T61A 3EZ9A 3G0CA 2R8YA 3WGLA 1NHGA 5LOVF 5K3FB 4EMUA 4B32A 4QVGA 1U7OA 1NUHA 1HDIA 1XC7A 2G1AA 3S5UA 3SN6A 4A6DA 1MABA 1T0HB 3F9RA 4DPKA 2XRZA 2FF4A 3AR6A 1OIXA 4D4MA 4C2AA 1LTKA 1AGNA 2MTBA 1B6RA 2PEYA 3PNPA 3TQOA 3QTLA 4I1VA 4UNQA 3DTYA 2XYGA 1R8YA 4N9QA 4YJ2F 1MHTA 1IOLA 1NWHA 5DHAA 4CHTA 4XWWA 1Q92A 4BO0A 4XRGA 1J2UA 3KPVA 4EVSA 3FDZB 1D4AA 5SZJA 1UOOA 1R4NA 3WLFA 1M2OB 1CQZA 4D4GA 4I19A 1T1RA 1SU7A 2XRFA 1MQ9A 2QUIA 4B74A 3AY0A 5ICGA 3KX2A 4RETA 1L6IA 2WHPB 3OJ0A 4R3NA 3TKAA 3KTAB 5ALNA 2R9VA 2PRJA 4B09A 5KYUA 3O7WA 4RVOA 2JW5A 4OK6A 4YACA 4UOZA 3PWTA 4U2DA 3IUEA 1NM5C 4BO3A 3MGBA 4H7HA 3U5ZB 1B42A 2VTVA 4WXMA 4MUBA 3M6UA 4PE5B 2YL2A 3R20A 1BGXT 4HGYA 5HCUA 1W2WB 1B3BA 1DKMA 2TS1A 2WSMA 3N53A 4ZRNA 4UTRA 4JI3B 3QEKA 4KPFC 1UKEA 3CM0A 3QEJA 1Q0HA 3A4LA 3BULA 3ILVA 4P58A 5KNDD 2ZWVA 1DQSA 1N0WA 4V2IA 4NC9A 3QFFA 1JYFA 3PFCA 4JLSA 4B1FA 3HYNA 1B0PA 3JQCA 2XKKA 4TTVA 2NP7A 3FNEA 3LFHA 4FBGA 3KJZA 3NM4A 3FLMA 3FD8A 4RELA 4ZN6A 5JNWA 2YV5A 4MCAA 1P7CA 3SX2A 1P80A 2RFLA 3CPEA 5DM1A 4A8PA 4Y1GA 4D2IA 5FUXA 2ZR7A 3ONVA 1CY2A 3EZ6A 3FYSA 1JW9B 4Q9DA 1NQWA 5HF6A 1RXEA 3FMVA 4KL8S 1Y3IA 1FYFA 2JEOA 2YS7A 4B34A 1W0JD 1BC5A 2A33A 3GP3A 1G8SA 4LVOA 3NM5A 2GN0A 3L6CA 4DCCA 3EC7A 4KPGA 3M1IA 2YWEA 2IGBA 2Z4RA 2HMAA 3UAGA 3HY6A 3QXHA 3UJ6A 2ODQA 2BGWA 5DULA 4C4ZA 1U5AA 3LPCA 1V37A 2QVGA 4W1RA 5DN6A 3QA9A 2PL9A 3AESA 2P0AA 1PFQA 2AFFA 2GDZA 4BVBA 4IDPA 3ZDXB 4D5EA 5DWVA 4HDAA 5A3JA 2H8KA 3A3OA 1YUNA 2NZWA 3ZE8A 1NUUA 2V7BA 3GDWA 1RWVA 4HWRA 4N0DA 5AJZA 4YT2A 3Q7SA 3O4GA 5E8JA 2RHMA 5P21A 4PC2A 3J81k 1B6GA 1H2RS 4K9KA 1P9RA 4R16A 5GJWC 1NT4A 4DDKA 4JYCA 4BJ6A 4Z9YA 3TD6A 3ZDDA 3BGVA 1A8UA 2ECPA 3Q1KA 3KKOA 4ZYWA 1XALA 3LT4A 4P5EA 5KWJA 1NNSA 1GZSA 3PT5A 3VRHA 5TPWA 4GEGA 5EGSA 3WLAA 3K53A 2AG5A 1DZIA 4OHOA 4TS9A 2BMVA 1TW2A 3JRWA 1EG7A 3Q0IA 4HAUA 3ENVA 3IOBA 2FDXA 3QW2A 3PGA1 1H1LB 3KD3A 2PCJA 1H66A 2NVUB 5MFPA 3ZH9B 1JDTA 3UMVA 2C5AA 1IFXA 2E4UA 2XIQA 3PUYA 4JU8A 1HKUA 3JQGA 4EGSA 4R2MA 3OT1B 4MPDA 3AB8A 4NAUA 1F6DA 4DQUA 3TUJC 2FQQA 3EUAA 3HCFA 3ZQ6A 4BX8A 1XTSA 1C0KA 4DCGA 1LWOA 4DDHA 1Z34A 2HWWA 5SZKB 3F6BX 4RZ3A 3WTBA 1TKRA 4ALLA 4RTJA 1Z74A 4DCTA 3AZQA 2OHXA 4JBGA 2QMHA 3T15A 3IS3A 4J3NA 2FPOA 3N0RA 4ZICA 1H2WA 2BT4A 2XHEA 2J46A 1KDVA 4MWOA 3T7KA 3LDHA 2WD7A 3SZRA 4YRFA 5TQ0A 4BE9A 1T2FA 2BH2A 1XAJA 2FFJA 5JXIA 2AJ8A 2NUPA 3ICPA 2ATEA 4P32A 3ZWQA 4BVLA 5B64A 5KYUB 4MWEA 3HU2A 3GLFB 2VYVD 1DBQA 5L95A 1XU4A 1QIMA 3UV7A 2XITA 2Q2WA 1X7ZA 1DAFA 1C9YA 1RRFA 1T26A 2CNLA 3VKHA 2AUNA 2C00A 3OPYB 1T9CA 4Q7LA 3I6ZA 4PSAA 3JARA 1FF9A 2O19A 3S68A 3WGMA 5FOWA 2HPAA 3IUPA 3QKSA 1P73A 3T5GA 2QA5A 3NCTA 4BV3A 4XVUA 2R7MA 1GTL1 1WA5A 4NENB 2WIDA 2BHNA 1ODFA 2JFWA 3F97A 2EOAA 5IC5A 4ATNA 3KKEA 3WBKA 4W5QA 4D9IA 4OQQA 3A9RA 1OBFO 1T9GR 4ER7A 5KYKA 3UGJA 3AEZA 4QM6A 2UVDA 3FCUB 4N5MA 4PG4A 3ZE2B 3GLGA 2BFOA 1M0EA 1WXGA 2R47A 3MWDA 3IA2A 1QVVA 4K9MA 1MX1A 4CQNA 2NXJA 2VPXA 4GM4A 2PUWA 4DA0A 4PYJA 2JLUA 3T3NA 1N36B 4KZKA 4OQ4A 3D5TA 5K4AA 1ZCFA 3ZW7A 1TJ4A 1TU3A 3HJHA 3L01A 2C7QA 4DC1A 2VDLB 4OFXA 1NQOA 3M9WA 4YCAA 3A9UA 1V7ZA 4S0XA 3WRYA 821PA 4PTYA 1AA9A 2J6BA 1IK4A 5PNTA 4HWKA 4CKZA 2Y0BA 3W8FA 1OX5A 1TD1A 1U4SA 2FW0A 1KY3A 4NIMA 3NU1A 3KSZO 4C07A 1WZEA 2DPXA 3GLQA 4CR8A 1KY5A 5HS4A 4K40A 5AP9A 1N7IA 4IDFA 4FPXA 1QGYA 3DOEA 5CVCA 3RQSA 1Z4NA 3OFKA 4Q3DA 3L2OB 2QTHA 4UVIA 1O58A 1JECA 1M0WA 2BEVB 3DZGA 2YC2C 1GTVA 5FUBA 1JHZA 5AJUA 4MGZR 1RQNA 5CA1F 3A1VA 1VL6A 2AEEA 1N5IA 3SEZA 4UAVA 4CNQA 3R3YA 3L7AA 1QRDA 3ETHA 3GBSA 5HUHA 3BK1A 3PDIB 1C7JA 3O9VA 5ALHA 4H1WA 2EQ5A 1JH8A 1ISFA 3LK7A 3LWBA 1II8A 3PGJA 4ZJUA 3UYLA 4MUHA 1DV1A 1EEHA 1QHEA 1SULA 2P9QA 2L82A 1Y9AA 3FDIA 3LBHA 3CW8X 3QELB 4FR0A 5ESDA 2I1VB 1SXQA 2WRZA 1RDFA 4W9NA 4W82A 5MHTA 1E2UA 1KI2A 4AS2A 1Z26A 2J5XA 1SA0B 1D2HA 3GA7A 5TT0A 1W36D 4UHCA 3ETCA 2CJPA 3GZ4A 3MD0A 3AP2A 2Y67A 4FGSA 5JV5A 3ZIUA 4LJSA 1ECPA 2D5CA 2QMQA 4TL6A 3IJPA 3G2KA 5D3MA 5SY6A 5KTKA 2X8JA 4P0QB 1LBTA 4Q4HB 1FYDA 2Z1MA 2COUA 3UPDA 4B35A 4HJRA 1I7PA 1RZRD 1L2TA 1BCRB 1J9GA 2XSZA 4DQVA 3E8MA 1DKPA 4UQPA 3IE2A 4CG3A 5KB3A 2AN1A 1Q3TA 3MC1A 5CX4A 5EZ5A 2BY4A 5FOUA 3C3EA 1BWPA 3BKXA 4HLUA 4MRMA 1E2GA 4PU0A 1U7XA 3KWJA 1BYIA 1YOBA 5H81A 2BEUA 4C7MA 4O08A 4M7PA 3QKWA 1Y6FA 1TUEA 3IKJA 3ABOB 3M49A 3GJRA 5LIRA 3KT3A 2H0QA 1MKYA 1X7DA 5F7JA 1PGJA 5T4BA 1L5MA 4QYTA 1SIUA 5BRAA 1QIJA 1G8GA 3SHWA 5CFNA 1X19A 4Y1EA 4JKIA 1ADGA 2IEGA 4PYNA 1GZ7A 3I2GA 4LF9B 3OZCA 5A8IA 1ECCA 3ZU3A 1CJBA 2H11A 1M8KA 2NV2B 1D1PA 4EY8A 1XKQA 1TF2A 1W36C 3ZU6A 3U31A 2D1TA 4CNBA 1FY2A 4HUQA 1H2BA 1XE3A 3PQCA 3ZG6A 3OTOB 3D3KA 1NPTO 3LDAA 1AUXA 4GMXA 3WE7A 4DB4A 3QX8A 2IYLD 1NW4A 1N77A 1ZZGA 1ISPA 4PAQA 1NJ8A 2J5KA 3OZXA 4E88A 2X8AA 5HGXA 1CDEA 5JH7F 5LOVA 5JZ9A 2QN3A 3WKBA 4BNNA 4M7RA 2XT9A 4J1TC 3RTEA 3K09C 5DHTA 3G2PA 1CZRA 2VXYA 4HLQB 3JWEA 3GEDA 4RDHA 2HIGA 4DABA 5KVCA 4UAJA 4P5PA 3UK2A 3A32A 2IH2A 3TZ6A 3L1JA 3G9TA 3GRVA 1WY5A 1IHPA 1ARZA 2K6GA 3FHLA 3HYRA 1RYZA 3LOPA 4FCVA 4KE9A 2DULA 1QYDA 4C87A 2IEIA 5G3YA 1ZOIA 1COWA 2Y71A 2B1JA 9LDBA 5CXXA 2WFZA 1DEAA 4Q1FA 3NATA 4Z9AA 5CIYA 2VT2A 1FVXA 1HE1C 5EIFA 2ZJFA 4JZKA 4C4PA 2QPOA 1RP1A 2C7VA 3D2AA 2BJWA 4PPGA 3R3WA 4OHYA 4P83A 1VGVA 4I81A 1O97D 1KRHA 1M6YA 1Z39A 4HZUA 4JJKA 1HPLA 4XARA 3SYKA 1T4DA 1HE4A 1Y8RA 2Q2QA 3NTQA 5CLGA 5IAEA 2DSTA 1ZHOA 3L82B 4BP3A 4NU8X 5K0LA 4QYWA 2HJGA 3ZHBA 1KSHA 2LWIA 3G2MA 3GRPA 1CJVC 5JVDF 2HXGA 3MJFA 3K9HA 4JOBA 3ZCTA 3GN2A 3A25A 4WZZA 4YIHA 1ZJ6A 4RY9A 4R9PA 4DN6A 5A2QA 2OGSA 1QE0A 1XTZA 1YVRA 4HVTA 4I55A 1ZYUA 3C8DA 2IDZA 3HPRA 1AN9A 4IIFA 4L74A 4GMKA 3KZVA 4HEQA 3GFVA 2J3JA 3I9KA 1KZ9A 2M6SA 5EZ6B 1UDCA 2O7RA 3COZA 4ND6A 2P2YA 1WMDA 3FRJA 4OUKX 1E18A 1ZD3A 2AFIB 5JEOA 2GF0A 4G5GA 2FSSA 4GX5A 4LDNA 4WW0A 5DBHX 3I23A 3VNSA 3W1VA 1FJHA 5ALFA 3V4RA 3DXYA 3QE4A 3RRXA 2O2EA 4OUDA 3TOXA 3TPCA 4DMFA 2JIQA 2WJWA 4YUZA 3IMCA 2VTDA 2XBUA 2RBGA 3HWX1 1XTKA 1RTTA 4GECA 2Q8QA 5THQA 3UOWA 4UU8A 3INGA 3LUBA 3NIGB 3PGKA 3CH5A 2CE2X 4KJXA 4L3WA 1HG0A 3DAGA 4G4JA 4HGRA 4D6PA 1CQPA 4IHJF 1NMSA 1X80A 3TIFA 3IDZA 4FFSA 1HEUA 4ZRDA 1CBUA 1GUDA 2X3UA 4L75A 2VUTA 3WXMA 4MWBA 4UAGA 2DJIA 1EXDA 2QTVA 4MAMA 3W3ZB 1HNZB 1D1QA 2I7VA 5FH9A 2D5AA 5G4KB 3OZBA 5FUMA 2CDRA 3QEMA 1U7FA 1SKBA 1WDWB 3TI9A 2YFQA 1U0GA 4BKQA 3U3JA 1L3BA 1F2TB 2QYOA 1P44A 3C7CB 3GJ0A 4Q0MA 4BLOA 5JBQA 3ITDA 4AX8A 2W7TA 1F4VA 2ASEA 4ID9A 2YJZA 2ES4A 1WABA 4L22A 5TARA 5CVJA 1JLKA 1CSEE 1S8FA 3GNTA 1ECJA 1AV7A 4FHEA 4X1IB 1O2DA 2LV8A 3T8YA 4YJFB 4HDCA 2IHUA 1XPJA 4TQGA 1EAMA 1JJVA 5DNEA 1YS6A 4BMOB 2GFHA 2M1XA 4X8MA 3ADKA 1H0SA 3WNQA 3CLTD 4V0RA 3RS8A 3WWDA 1KYQA 3I8XA 2L42A 3IVXA 1THZA 2YMPA 3G9UA 3LI2A 3R3HA 4FILA 3VBEA 5LJIA 4ARIA 3EY4A 1LC0A 4KXVA 4HCJA 2FMTA 3S3TA 4TN5A 3IMFA 5G53C 2DUJA 3K2IA 3LL7A 3OZGA 4Y2XA 1B00A 1PJCA 1PJSA 1ZBDA 2PL5A 2R6AA 2WPNA 3LRPA 4K6GA 4KRXA 4NMWA 5GM2A 3V6MA 3KQTA 1Q7BA 5E7QA 1QU2A 1KSGA 1Y1RA 1RMQA 4RH1A 2DFPA 2HXYA 4Q82A 3BJZA 3EHEA 5CK5A 5JSYA 1ND5A 2PAFA 2PZ8A 3HDJA 1GT6A 2HSGA 4X95A 1VI6A 3HWRA 4OQNA 3FOFC 3O7MA 3QNUA 2DM6A 2QP9X 5E1OA 3RRJA 2Q0SA 5K8IA 1HT1E 3V8NA 1VE5A 2Z6VA 1ACJA 3EFBA 5AVXA 5CMLA 1Y3DE 3HUEA 4MUJA 2F55A 3NASA 1DBVO 1E1CA 4JL8A 2RDMA 3GJ5A 3FW1A 5WRFA 2O5CA 1P5ZB 1Z88A 5JW6A 4J0HA 2UYHA 3GIDA 3L0SA 4YJ3F 4Z0HO 4EAQA 2QRNA 1HDGO 2CLEB 1G59A 4WNYA 1V1MA 4PG8A 5HXAA 4MYTA 4R5HA 3SQDA 1ZD9A 4AN4A 1XVUA 1DJLA 3JQ9C 4FB4A 4A2WA 1C0IA 3OE7D 4IM7A 1OC4A 2H16A 2P9CA 1K92A 3J80A 2G5GX 4O4HB 4XJTA 3OTIA 1D7OA 1EFRD 3ZPXA 4KV7A 4P80A 1ZC4A 2Q27A 3M3PA 1JXAA 4IRMA 3S28A 1SEVA 3DDUA 4DIOA 2O1EA 2L69A 4FVTA 1CVIA 1JVSA 1M2KA 1OYWA 2K4MA 2Q4DA 3DOJA 5DCLA 5IJWA 1M75A 2VJNA 3AR2A 3MFQA 3SS9X 1NF2A 4INZA 1DQPA 2Z0MA 3C3XA 4FQ8A 4PZEA 1JJFA 4RFLA 5EWMB 4YWHA 4BXOB 2A8YA 3LYLA 5FL7D 3C8ZA 1N92A 2ZYWX 3T7CA 4EMSA 2PBRA 1A8PA 3NDPA 4C0KA 1RVV1 4DUYB 3S7ZA 3PL5A 2EF0A 1CRQA 3Q2KA 4OXNA 4GXNA 3UB4A 4CGYA 2C8VA 4CM5A 2WYVA 4KFCA 3RTCA 5EP4A 1I3CA 2Q9AA 3R5SA 3VH4A 3JD0A 3T7JA 2BKVA 2CDCA 2CJXA 3DFIA 1PNRA 1CS0A 4JHLA 5KSZA 3RWMB 1P1FA 3G2NA 3PA8A 1BE1A 4K9QA 1UP4A 2BHLA 2JH8A 2DBZA 5FBLB 4B83A 3ITNA 1KVUA 2H1LA 4BFXA 4BVJA 1JHDA 3AVOA 3CSUA 4GEKA 1I7LA 1GPH1 1SHKA 1ZIOA 4II3A 4DY4A 4RPHA 1O6BA 1WRBA 2POQX 4IS2A 4WBNF 5L3SA 3PQFA 1I51A 4BP8A 1K0FA 2CKDA 2P5UA 3HYLA 4KQ2A 2X9LA 2XCQA 4CMIB 2FF7A 3BE4A 3E8XA 5BOSB 1WMFA 5E7MA 2OPHA 2O8CB 3E5RA 2GASA 1KZYC 4B6QA 1E6EA 1WLSA 2V1UA 4B4KA 1OV4A 4MGKR 2IYVA 2A5DA 4M0MA 4PX9A 4Q6BA 4IYJA 2I9PA 2O3RA 3H11A 1LLDA 4KXUA 4RO0A 3I3SR 4HDSB 1UKCA 1K5GA 3ZWBA 3DHVA 3DL4A 3W3AA 2CNOA 2XXJA 4ZP1A 4D9HA 2C3MA 4PHCA 4R2JA 4FJ1A 3ZJTA 2V7EA 4IRXA 3TOVA 4ZEMA 4B6GA 4KFRA 2NU8B 3D3EA 1ABBA 4TYWA 1REQB 1DX6A 5AWFC 1VIDA 1H4TA 4PYLA 3WQRA 2G1LA 4UZSA 1D03A 1KPIA 2ZM6B 2OECA 1BH6A 2GKGA 3E4DA 2XE7A 4KFUA 2QX9A 4KIFA 5DISB 1QV9A 3DCJA 5A71A 3DTVA 2DHQA 1ISMA 1JLRA 2H4JA 2IYAA 2ZRFA 2EIXA 1QHNA 4NNPA 4RMGA 1KYZA 4BIMA 4P9NA 5KWVA 1U6IA 5DPMA 3H8WA 2ZXFA 4MA5A 4MXDA 1TIPA 4F6RB 2W6JA 4EEXA 2P4SA 3DT8A 2G63A 3CKYA 2VDWB 2XVXA 4ALJA 3JVIA 1SD1A 4U02A 2O5EA 1X70A 2PAAA 1E1QD 2FGKA 3T3DA 1EVYA 1QIKA 3CZPA 1Z22A 2BYTA 2Z56A 2F8SA 7REQB 3HDYA 2OVFA 2X8BA 3S4YA 3DEYX 3AR5A 1U2PA 2EBUA 1BE0A 5FUVA 3I30X 2V59A 2QORA 2ZI6A 1MW8X 3TXYA 2FP4B 2FOXA 3ZCQA 3GVPA 2PQ0A 3BOSA 1AURA 3MGGA 1Z2NX 2D1FA 2E82A 2WJIA 4GS5A 4XR4A 3SYMA 5DNCA 1WZIA 1OGYA 3AR4A 4BMDA 4UOQA 5C4GB 2QHXA 3GFSA 2FPPB 5DM0A 4KI7A 1RLMA 1C7ZA 3EZGA 3FOCA 2BKAA 3DEZA 1C0LA 5IJZA 1YL5A 1ZMTA 1K2NA 1PQYA 1MFPA 4FZVA 4XCVA 5FBZA 2L19A 3W6PA 3GPBA 2X9NA 1XN1A 1U8TA 1TQ4A 4YBZA 2AZDA 3E4CA 4MI9A 3ICEA 1BHQ1 1K3QA 3FROA 3RFFA 5JXJA 2C78A 4A15A 1QK3A 3LLCA 4NECA 4HNQA 1DT5A 1NIJA 4DCMA 5C7OO 4XJXA 4Z53A 3T5TA 1JQBA 3D8BA 3NNNA 2XDQB 3TM4A 2Q5HA 4X7BA 1U2SA 3NHLA 3DZFA 3WDMA 4LBYA 4ARZB 4KSYA 1SCNE 4N3GA 4K86A 1U7PA 2RHGB 2A67A 4PZDA 1E7QA 1N5OX 4JOSA 5F64A 1ZESA 5F2EA 3ZOKA 2QRKA 1LJUA 1SRRA 3N59A 3QVKA 4JSRA 4Y67A 1QO9A 3VKGA 1TZJA 1XB2A 2O2IA 4MLZA 2RGDA 3FWKA 2CLCX 2XXSA 1BCRA 3LWZA 3X0DA 1OROA 5FIUA 1LI4A 1A98A 2BBOA 3RYCA 1PW5A 3VOTA 3A4YA 2FW9A 3PS9A 4KBGA 2YN4A 4J0QA 1V6CA 2HBYA 4RJ2A 2AEMA 3G1UA 4ZHSA 1E3QA 4RF5A 5JZMA 5D2CA 3HY3A 4MS1A 4QU8A 3RYHA 5IDXA 3BMCA 4XZ3A 4ZAFA 1Y9DA 4URVR 3AI2A 2HHLA 2D7JA 4LE1A 4QVKA 4ZCQA 1U0TA 1UPTA 1Q1AA 3W9YA 3E2MA 1T5BA 4YAJA 1RBQA 3L8HA 3M2TA 2IYRA 1GCOA 4EGCB 3RSGA 4AYTA 3SU8A 3FFWA 1X7WA 4PR3A 5LXTF 1E7SA 1NOJA 3JALB 4XVQA 3FI9A 2XB9A 3S1AB 5LP6B 2WTAA 2WILA 4FKMA 2A57A 4CEHA 1KIMA 2X1MA 4UREA 1BGVA 4DVJA 4WRRA 2J5QA 2XGSA 3A9TA 4NBVA 3OWXA 4OOFA 2QJWA 3U3OA 3UT0A 3G9ZA 3KR9A 1QIIA 1R0ZA 3OETA 4E21A 1FC0A 3RVSA 2HO4A 1TL7C 3OI7A 4B2IA 4KITB 5CH8A 3TMAA 5E1MA 3F47A 2ZT6A 3PX2A 1KE1A 1FBTA 3VOAA 3W05A 4DHWA 2WQ7A 2NUTA 2ZJBA 3OA2A 1F3OA 1PNQA 1VRWA 3ACBA 1ZH4A 4OHMA 3DD1A 4UUAA 3TZBA 3DWGA 4UM9D 4NNOA 3PR3A 4D96A 1GL3A 4C6HA 4ZYLA 2V6FA 5IVHA 3KUUA 3SMVA 2EV9A 1NTOA 4AG6A 4MUFA 5CYOA 2G1JA 1XO1A 4NU0A 3ZH2A 1CCWA 2P9EA 3OFVA 1TOAA 2Z5GA 5JRDS 3OJEA 4GPIB 2H85A 2RGYA 1IJEA 3H5OA 3CA8A 3UGKA 1X1QA 2ZSDA 2VYCA 1NNI1 3WMGA 5KOYA 5HX7A 1XDZA 2ZBUA 2V6MA 3RIHA 2B69A 2XNSA 2ZQ5A 4RPCA 4KEAA 1IQUA 1QR2A 4L95C 1N4DA 5KOHB 1DADA 3ZDAA 2BM1A 1E7YA 1SH7A 4OH7A 2RH4A 4UBMA 2A9RA 1K86A 1Q0QA 1XD8A 4HDNB 2IHYA 1P0QA 3V4SA 3BRCA 1ULTA 5TEVA 1BG6A 4KE7A 1Q5PA 2AMLA 2PGXA 2XVZA 4FDLA 3UC9A 1PGPA 1QWTA 2GA9A 5D3MB 5A03A 4MA0A 1J0BA 1WDMA 2PSSA 1E3EA 4YRJA 1A95A 3RVPA 5ETJA 3CT4A 2WM3A 4KVFA 4Z7JA 3EOAI 1KO4A 2P2SA 3RRMA 4LXHA 3AR7A 5BO5A 4G8CA 3TTVA 4BJHB 3VZBA 1GUAA 2Y1DA 1DAPA 1E6CA 2V7VA 3BJRA 3EH2A 3PNOA 4D9KA 1ND6A 5CYGA 1VKJA 1NUSA 3K20A 5HIMA 1RHKA 3G0DA 3SZOA 1LK5A 2V7PA 1FNMA 2OBFA 3ROXA 1SFRA 2MYUA 3CX3A 3VH2A 2FWJA 1SOUA 4KO3S 3VTAA 3AOGA 5GVSA 1MK2A 2GZSA 3H6HA 3LDFA 4UBIA 1E3TA 3DLCA 4L50A 3PSAA 4ZVMA 3CSSA 3HXKA 4F8JA 3BCSA 3AO0B 4UHJA 2ERYA 2EU8A 5DBFA 3ENWA 4C0LA 3WADA 1E6KA 4D0LB 2TMDA 2JASA 3NHAA 2Z3WA 1VYTA 3CS3A 3WK9A 2YS6A 2C4VA 1H5UA 1NQXA 3U13A 2F8MA 1O97C 4JELA 3N8NA 1GGMA 2YY6A 2FPXA 1C8VB 1LBEA 2MSNA 3FHTA 3DGEC 3PV0A 1AHIA 4X66B 1ODKA 3JATA 1WEHA 4BRUA 2IH4A 3DMGA 4E32A 3KVOA 3W4KA 2W37A 1I5RA 2BBWA 1M6VA 1S1MA 1U94A 3BMOA 3Q9LA 1RZ3A 2WKWA 4I3HA 4HVLA 4MWSA 5I9LA 2RI6A 2OZEA 3OZIA 1VYVA 4POOA 2X4DA 3W2EA 4PXSA 2J9FB 2P1RA 2Z58A 2FPUA 2P8JA 2B4KA 2BAGA 3K73O 5DHQA 4PBTA 4DREA 1PNTA 1U1DA 1XVVA 2B3TA 2JGFA 3B3JA 3L79A 3VZRA 2B0CA 1AZTA 1ZUNB 4HNAA 4P3OA 4YP6A 4DXHA 4F3TA 1T8PA 3PR1A 2X0FA 5D5QA 4JSTA 1N9KA 3C74A 1EFHA 4RDIA 1KO1A 5HR5A 5CX1B 3ZHQA 4G1VA 1GYQA 2VF5X 3HBFA 4UD2A 2X6RA 4J2TA 4PINA 4W6ZA 4DM7A 3MNFA 4YAFA 3RSHA 2F1RA 3IOCA 1H8HA 4N0PA 1JSZA 2Z5LA 3GFQA 2X15A 4JROA 4LWOA 1IEWA 3FUVA 2O4UX 1JKJB 5JDIA 5CAEB 5JH7B 4MB0A 2C9BA 4TTTS 4EGFA 3N8HA 4L72A 3N8IA 4JJ7A 5GWXA 1Z08A 1AUQA 2GBLA 3HGTA 3B13B 3TWOA 1P1KA 3SYNA 1R4ZA 1H94A 2LKDA 4UBOA 4DLWA 3IAUA 2WJAA 5EVCA 3HHEA 3O31A 5JU6A 2GTHA 2QVYX 3GDOA 3JYLA 2M6RA 3H8JA 2FOLA 4B4OA 1P4HA 3PQ3A 4WE3A 1IMJA 1E61A 2HF2A 4U8HA 1MC5A 3TVTA 3RS9A 5LUBA 3CR3C 2J9RA 2CCGA 2PGIA 1UPCA 1W93A 1YJBA 1FJ2A 1GKIA 3P0HA 1RQ7A 2XUHA 2J3QA 1VP9A 2NV6A 2JLWA 3N2KB 5CP8A 3HUTA 1P1JA 3L3BA 4G0QA 1EHIA 2B1RA 1WB9A 3ETJA 2H06A 1PFWA 3FY4A 2UZAA 1VBNA 5DTEA 1QG2A 2BTOA 2OLKA 3ZLUA 5ILGA 3WX0A 3DEAA 2Y1LA 3HCDA 1CNEA 5J5CA 5BMVA 2BGNA 1MCZA 4EYOA 2AMJA 1L7BA 4NX2A 2GNPA 3LV8A 3V7FA 2WE8A 3SHTA 3H5TA 4O6VA 1LZLA 3MMNA 3VPXA 3HQ4O 4QUEA 2HBZA 3R8XA 2D7CA 4QFBA 4RXTA 1KYTA 4CTMA 1QKKA 3G2HA 1NXVA 5IF3A 5ESRA 3FZEA 1LA2A 3LLVA 1EK0A 4ZODA 3STTA 1XU7A 4EJQA 2R8ZA 3HDQA 5FTWA 3I6IA 1CU1A 4ZAZA 4CLRA 4HHEA 1ZK3A 5FBKA 3CZRA 2G4VA 3NX4A 4L6IA 1UJNA 4B3HA 1S9DA 3SS7X 5BNZA 2JI8A 4E2WA 3BXPA 3GHHA 4Y7CA 1XD2B 5DXAA 4A0HA 4ETNA 2IL1A 3KSAC 3SYRA 1B0UA 3V8BA 3H84A 1E98A 2GWHA 1TZKA 2P41A 1WU7A 2BZ1A 2D54A 3HZHA 5U1PA 1ZUIA 2XWBF 4RMJA 2DOKA 4TMKA 4J7UA 3RS3A 1R50A 4HATA 1XAIA 1Y34E 5TQVA 1PZEA 3H4MA 1O6CA 3SDBA 1NLYA 2BM0A 2QTRA 1W0KA 4X6YA 1Y7LA 2GBFA 4BO2A 3CZQA 4LFBB 1V43A 4AC9A 4EKDA 1R9NA 2H7CA 5I4BA 4B85A 2PT9A 4QXRA 5KTSA 4O4LA 3VR3A 4CEIA 1HX7A 5M04A 4O2BA 2Y27A 3WKEA 2WYUA 4WN9B 4IDNA 2Z2JA 3ZJYA 2XAUA 2AUTA 2YC4C 1R5OA 5LVAA 1M7HA 1RS0A 5JD4A 4DB2A 1GILA 4IMIB 3WP0A 1MEEA 1Y4ZA 1VPTA 4DR7B 1AKQA 1P4RA 1QS0A 1Y9EA 3MAGA 4CKBA 5JHHB 1UF9A 1L7OA 3KOXA 4U7JA 4D8WA 1N2CB 2P9TA 3F67A 3FWHA 1VMAA 2R3SA 4D3YA 3LUPA 1QK4A 4ZEOA 1YBAA 2HI0A 3P32A 4F93B 3U7QB 3K32A 4LEIA 3TO5A 2OOSA 7AT1A 2PLFA 1NXPA 1TQHA 4EHBA 1DC6A 4TV8B 4ZU3A 3WDKA 1I2DA 1KYYA 1T3TA 5AUOB 1ZGBA 3C6XA 3GL9A 1P9WA 1YDMA 2HCRA 2IUTA 3AF0A 3Q3CA 4G0MA 1RQPA 2FY8A 4M6WA 4IDEA 2FQ1A 2RJOA 3MAJA 1JIJA 3F6RA 3CRMA 3P9KA 3W6UA 4DG8A 2Q7XA 5JASA 3O8QA 2DTXA 3PI6A 3EVGA 3VAAA 3L0YA 4FWTA 5F3WB 2WUEA 5C8XA 1KKLA 1SCDA 2HLDA 2OCAA 1PVDA 2ZBVA 5HJ2A 3VHXA 2NUBA 1XDUA 2E5WA 5ADVA 3OLQA 1S89A 4RABA 1F0KA 1ECBA 1E92A 4DJFC 1P60A 2VK4A 2C2GA 3D6HA 5DT2A 4A0QA 3KKLA 4ZU6X 1Z83A 5EA2A 1GQFA 1QHFA 1TTHA 1W47A 1SG6A 4JVLA 3WK6A 4IDHA 2BR3A 1RYBA 3AFIA 1CUHA 1JXQA 1LTQA 1K7FB 2W2OA 3Q12A 1CULC 1E5QA 2E3JA 2HSWA 3BHJA 3BWXA 4UEKA 4D8YA 2FVXA 4H7IA 4IVRA 1ZGZA 3DEKA 2R751 1R6VA 1JDBB 3QWAA 2R6ZA 4FN5A 3WGNA 1I4OA 1H4SA 4J4BA 3ESXA 2MSWA 3P9CA 1FXWF 3D3WA 3K0HA 4WASA 3CLHA 5HK9A 2Y1XA 4WDRA 1CEEA 2RGEA 5DTJA 4F6LA 2FSVC 4HT3B 1IBSA 3N0XA 3EFOA 3JTMA 2Q49A 5FO1A 4ZYUA 4AYXA 4NCAA 1E60A 1DQZA 3TBHA 1I4DD 4HUTA 1B73A 2I2CA 5FWYA 1R0CA 4EUKA 4ZOQI 4GHWA 3SX0A 2FN8A 2VBFA 3KFVA 2W6PA 4W9MC 3LT5A 4C9BA 3O92A 2XWJI 4OBXA 5F7XA 1FQOA 2PJDA 1P9LA 2HOQA 2QTNA 4JBHA 3LSYA 4Z1OA 3OOEA 1XVIA 2Z30A 3KQSA 4IQ0A 2ECKA 2Q99A 4P35A 1PJ8A 5AVRA 3CO0S 4E5KA 2ID4A 2E89A 1WSBA 3RAPR 3SJAA 5I7RA 2FJPA 1SK8A 3BZWA 3MELA 4BUCA 4EFMA 1QHHA 3FMPB 4KIUA 3BTUA 2HV9A 1G20B 1A76A 3CTPA 3F6PA 3KKMA 4IV0A 3VVBA 3WYCA 2Q46A 1W34A 4UE3S 3COYA 1GL7A 4UU1A 4ALIA 4CMCA 5JSFA 4PHFA 4KPUA 3ZWKA 1T3GA 5BVHA 1TJPB 4KRYA 4RTLA 3PXAA 5FTMA 4XYEA 4ASUA 1ZU5A 5KJCA 4WXHA 1SURA 1JTFA 4OB7A 4MW2A 1ZA2A 4KACA 1NMXA 3ENNA 5BW8A 1W30A 4HYYA 1WTAA 2D74A 4M0UA 4V38A 3ESCA 4Z1MD 3NONA 4X97A 1FUIA 4F9GA 2G5CA 1UWKA 4S1TA 4W5TA 2QGZA 2WVGA 4BWYA 3QUCA 4NFYA 2OXTA 5IC4A 5KMGB 1ZNXA 2EZUA 4MUYA 3REGA 4BZPA 1AGYA 4M1YA 4Q47A 1U8XX 4BLQA 2WWGA 4RD1A 5HJ7A 4FFNA 3HXOA 1L8OA 2OZVA 5MFZA 3JRXA 3EZLA 3AIKA 2O7QA 5KJ6A 3UVEA 1EEXB 3ZY2A 2D4AA 4HX2A 5SY4A 2AOTA 5KTPA 2GI4A 3AB7A 3QQPA 1NXXA 3QPAA 2W2VA 3R5HA 1EE1A 3PICA 4KBYA 1W1IA 1WIWA 1Y7IA 1G2IA 4M55A 4TPKA 3HR7A 1NAHA 1P72A 2BCEA 2W98A 1EGHA 1DXHA 1QX3A 1UFOA 3ETLA 3ZVLA 4E07A 1XNGA 3BD9A 1N6IA 1VIMA 2P91A 3NNSA 5CXSA 3T6KA 4EO9A 5JYBA 1UFKA 4QJ5A 4AM8A 2Y0CA 3CGGA 4PZPA 5CNKA 2Q5FA 4P4GA 2NP6A 1L5YA 1F1JA 1M9NA 2GEDA 4ZAXA 5HG0A 1H3FA 2O1XA 4LFCB 1CWUA 3JTEA 2VRWA 1Q0SA 1HYEA 1JHVA 1PW7A 3B5EA 4IRUB 5KVQA 4YXWA 3MCWA 5TIIA 1AGRA 4DJ5X 3HEMA 5U4QA 3IYLW 4G9GA 2NNWB 4JD5A 4MYHA 3DEFA 1EFUA 2NU9B 3I05A 1CUYA 3TLGB 2G1KA 2I2AA 1DKOA 1KEEB 2DBQA 2YJ6A 3VVCA 4EA8A 5K2MA 5B30A 4DSUA 3LBAA 3VC1A 3OPYI 2LDBA 2ODAA 3N05A 2H54A 4HFNA 2IDMA 1DJOA 3C7KA 3AEUA 3DNPA 3U48A 1ZX1A 4TTPA 3A0RB 2GSWA 3U4CA 3ZY6A 3TSAA 2M9MA 1WBBA 1RSZA 1YS4A 2E4XA 4FC6A 4IIVA 4DAOA 4EG0A 3HU3A 2YW2A 4BP1A 2O4CA 2RHWA 2DKFA 2EWWA 5EINA 4US0R 4YMLA 4BAZA 3P2OA 1OFUA 2XBMA 1LF5A 1S3SA 4YO7A 4K6OA 4EY7A 5AIBA 1OCEA 4MQ4A 2VLIA 4S1VA 4WZAE 4EJSA 2DXIA 3TZEA 1E6LA 4TRNA 4ZQBA 1KEPA 3EIOA 4RULA 4QDTA 3X1ZA 2MSDB 2HCFA 4DIKA 4DSOA 1XMJA 1V8BA 3GAAA 5EN4A 4OO3A 1RYYA 2EQBA 3VSBA 2IZ0A 1FFAA 1M5UA 1G8PA 2AN3A 2I3ZA 1H22A 2PH1A 3TZHA 3IEUA 1V8ZA 4TZKA 1AZSC 4E03A 3O6VA 4DLUA 3ZLJA 2E55A 1QO7A 2XECA 4QOIA 4WLEA 5FR2A 3E1SA 3HB5X 2BFAA 4V0QA 1MC1A 5AJXA 2WJ6A 5HPYB 3TSWA 5IKMA 4R01A 3PPWA 3TIVA 4LUCA 4RK0A 1SCQA 4YMSA 2VYFA 1LV8A 3LPDA 1KFBB 4KVGA 1KVTA 1PQ4A 1O6ZA 2VXOA 3AJDA 4J7CA 2PU5A 2JJ2D 3ND8A 1OKKA 1QH1B 3TNYA 3AG6A 4CKYA 3EULA 3BHIA 3H86A 1JYEA 3WNCA 5D7BA 3IEKA 4LJ6A 3NM6B 3QEMB 3RU9A 3MCVA 2AG0A 2NT3A 4NHEA 2A0XA 5BSEA 5I7VA 4PICA 5IASA 3VC2A 3W5SA 1N8NA 3P4UA 1NVVQ 1QLHA 3QA3E 4IF4A 4NZMA 1G98A 1GGJA 4DQDA 4HYQA 3TLBA 2QD1A 4EG7A 1EXVA 1CERA 1I3KA 1PX0A 3T1NA 1XWFA 2B4TO 4PS0A 4PZUA 4TTAA 3O8OB 4B80A 2IDKA 5DSTA 3L8EA 1JDVA 4WOPA 4RM3A 1JLSA 1N7HA 3D3JA 5BXYA 3AZOA 4M38A 1JA1A 1YQDA 3PGLA 2IVFA 3AVPA 2BLLA 2ZIGA 3NZEA 1PR6A 5DZSA 4H7FA 1EK5A 4MVXA 3NXSA 2WG2A 3H5IA 1AS2A 3GEPA 5E4TA 4I1OA 1W4AA 2PN1A 4KQ1A 4OGKA 5CGQB 3CUYA 4FR5A 3RBAA 5LZ4A 5GJBA 1U7DA 3FCAA 1W5FA 4Q3CA 3TYXA 4CIYA 4W5NA 1YB2A 4WCFC 3WO1A 1EA7A 4E5VA 2ZK7A 3JR3A 1H5NA 1XU9A 3EZNA 3OJFA 4WPGA 1EBBA 3T3EA 4D3XA 3SEQA 5EZQA 1XA0A 4DGSA 1JQDA 2GHQA 4TTRA 3FJ1A 3IBYA 2KJQA 4G01B 4AJJA 4AYWA 2RBKA 5LB2A 3U26A 2BEVA 2PR7A 3ROFA 1GRRA 3KXLA 1ISSA 3C14C 4RF3A 3AM5A 5CT5A 3J7TA 4NCHA 4ZA2A 3DMYA 3IEVA 1Q1EA 3GN1A 3QZUA 5EXEA 3O8RA 4CKXA 3UK6A 4BNDA 4Q7KA 1NGSA 1ORIA 4N54A 3MJTA 1M1ZA 2J6HA 3SK0A 4ZGWA 2QN8A 1R9JA 1L3IA 1IM2A 2JHPA 3A1EA 4QTUB 1Y8RB 3V3TA 1LBIA 1QVRA 1UAGA 3L7NA 2ZR8A 1SHZA 3F4BA 1TCBA 3SIWA 1LX6A 4GOXA 2CLLB 4X8HA 3T7TA 3K9QO 4ND4A 4LYDA 5AXDA 4O4LF 3VI3B 1KH3A 5IG2A 3D81A 1DELA 1BXRA 3BWVA 4MJ3A 1GGFA 2OXIA 2OD7A 2P0EA 4AKIA 3PE3A 3N58A 1FMCA 4XX1A 3AERA 3G2JA 2VXCA 2JARA 3AW8A 3A26A 3PYLA 4NULA 1IM8A 4PTLA 1BH2A 4LQCA 1KERA 3D7SA 1X38A 4L28A 4FZRA 4X20B 3REFA 1QH8B 4MAFA 3L49A 3T4UA 5F9HA 4D45A 3L7BA 1NZFA 5F5XA 1UDWA 3GP8A 1SA0A 3R7FA 5DWQA 3ANMA 3GDGA 3LRXA 3E53A 1UKAA 4FW8A 1FFWA 3DBHA 1ISIA 4IINA 3ZVNA 2OBLA 2RARA 4JLVA 5IM5A 5KWIA 4JYBA 5A6SA 1LY1A 3TFWA 2OO7A 1J56A 4Q39A 1GV1A 2FA9A 1PJ3A 1YH3A 2N9UA 2P9BA 3QX7A 4C14A 4UMEA 4Z2YA 5AXBA 4JBYA 1ZR2A 2QQ5A 2QQFA 1PD0A 2V96A 3DR5A 3CMMA 4LYGA 4OREX 1N9GA 4XDZA 2XE8A 3U4HA 4ZJZA 4N03A 1I6MA 1WDLA 1K6EA 1NBMA 2YOHA 4I55B 1BU8A 1VCHA 1YQ9A 3DZDA 4QLAA 4XQ0A 4QDJA 4I6EA 5J40A 1ZL2A 5B1YA 3EBPA 2FZGA 4FR2A 1NUAA 1S2MA 3UJBA 3VYSB 3HKEB 5K0GA 2FWAA 5EE5B 1MPTA 5C4VA 1U3WA 3ROEA 3ZR4B 3L5OA 5AVOA 3OZSA 3PNQA 3LM8A 1IRXA 4JOCA 4GWKA 4K9NA 3GV0A 3ST7A 4F9FA 4US2R 1AB6A 1OASA 1YQXA 4E14A 5EMLA 2VUUA 4FYPA 1ID1A 2PRSA 3ADPA 1TCCA 5BOVA 4AICA 2GF2A 5DW0A 5LDDC 1ENZA 3UTCA 3T5CA 1KRXA 1JAZA 4OHCA 4PCLA 5IKEA 4BNIA 4GKBA 5IAAA 4ZT3A 1K9SA 1JQLB 3KNZA 4O1IA 4YFYA 4AFNA 2VRNA 2NXEA 2RAUA 3N2LA 3SP1A 4V1CI 5JO0A 1YTUA 2GERA 4XKJA 2G6BA 3P0IA 3AKEA 4BKOA 2VO1A 3CISA 2VATA 3PIDA 1EP3B 3HR8A 4U2KA 3QVMA 5EIAA 3LO8A 1BRTA 1K8YB 5IWAB 1J8DA 3MTDA 5FKJA 4JDPA 3V48A 2WUGA 4LX0A 4AXBA 2I99A 5BQ5A 2NZ2A 3C5CA 1W581 1Y8QB 3U3ZA 4K0KB 3N2GB 2IE8A 3GH3A 5AKLA 3UHOA 2I7XA 3NTUA 1MDBA 5JANA 4MV9A 1IZZA 3H1GA 4RHXA 4LX8A 4RF4A 2OYCA 4C5CA 2VAVA 3ECAA 1MAUA 5KDOA 5KYTA 3NQ41 2REQA 1CY4A 4K2AA 3E9QA 3GARA 2A4MA 3OJOA 4BS9A 4U2CA 1COWD 3VJMA 5KC8A 3UBTA 1K7XB 2MR6A 2P2LA 2VCYA 3KV1A 3M3HA 2XA1A 4R1NA 3FKQA 3DOOA 4HNVA 3GT4A 2WOJA 3G5AA 2HCBA 5JSKA 3JQAA 1VLLA 4QEZA 5SY9A 3SJUA 4YYEA 4YRBA 1HZJA 3ELUA 3GDHA 2PKCA 3CE9A 2HV8A 3I8OA 3LQKA 4FYHA 1J4LA 2CBXA 1JFSA 4K1LA 4YCJA 4J4TA 1G1AA 3EK2A 2WMOB 3LBIA 5KQRA 3ZBPA 4I50B 4O4HF 1VJCA 1Z5GA 1YR6A 4X85A 5AI9A 3I4FA 3U81A 1LDMA 3WJ1A 4TYQA 3B1KA 3AMVA 2YNMA 2WM2A 2XD9A 3D4OA 1DTEA 3KV3O 4H6VA 4L4SA 4N0MA 4PWZA 4B6SA 5AVQA 1HLPA 5KCZA 1IAQA 2ZSFA 4R9UC 4BVAA 3ZKWA 4I9UA 4QBHA 3OWOA 1GY8A 2D2EA 3ZYCA 5BSHA 1NQAO 3C8HA 4EA7A 1QJ4A 5DNDA 2VYNA 4FFRA 5J4KA 2VF4X 4UAUA 2IOQA 3NTRA 2ABWA 3C39A 2QZZA 3FUTA 3TW6A 3BXHA 1Z3IX 4FOOA 4OHUA 1NX6A 4RGVA 3DNMA 4RFVA 1X77A 2I1LA 4QBFA 5BSFA