5DHQA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
total genus 64
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhqA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhqA01
5DHRA 4DY6A 3VZCA 3V7YA 5DHUA 3T5PA 2QV7A 3V8NA 3V7WA 2Q5FA 5DHQA 1SUWA 2P1RA 1U0TA 5DHTA 2BONA 2I2FA 3V8PA 2I29A 3V8MA 4L02A 3V8RA 5EJHA 5DHPA 2JGRA 4HAOA 2QVLA 5DHSA 3V8QA 5EJGA 4V24A 2I2CA 1Y3IA 1Z0ZA 2AN1A 2I2DA 3VZDA 2I2BA 3PFNA 4WRRA 3V80A 1Z0SA 1YT5A 3V7UA 1Y3HA 5EJIA 4WERA 3AFOA 3VZBA 2I2AA 3S40A 2I1WA 1Z0UA 5EJFA 1U0RA
chains in the Genus database with same CATH superfamily
5KOJA 2EZTA 5FWDA 2EZ8A 3SNHA 2YN2A 1L8AA 1U1IA 2VPYA 1CUEA 3FNEA 4ZQBA 1A5ZA 2HHAA 2DWUA 4K8OA 1BO6A 2XIQA 3EA0A 3MD9A 4MP8A 4PS1A 3SF8A 1JI3A 1HH4A 2OAQ1 1NPTO 2XMDA 1Y5RA 2YV2A 3PUYA 4IH9A 3IRUA 4NOJA 5ALDA 3IBGA 3L0DA 4MIKA 5CDGA 1TAHA 5F7ZA 4JI3B 2ZAIA 1QOQB 3CXRA 2WILA 3GJSA 3KB2A 4DQLA 2JCBA 4CM5A 5JRJA 2CV1A 3ZZ0A 3M81A 5K3EA 3L0YA 4ER7A 4QBTA 2O8EB 1J5XA 3IUJA 3LAWA 3M2TA 1RBYA 2E9SA 4G86A 5WRFA 1W29A 2R8EA 4GEGA 3GR6A 4RJ2A 1AV7A 1D2RA 3VR4D 1DEAA 1V6AA 1R0RE 2B7BA 3H99A 1XQ1A 2QYHA 2JK0A 3BQMB 3CKYA 3PX3A 3SICE 1YRWA 4JEUA 1GYRA 3F73A 4WIAA 2WG1A 3RASA 2EX1A 5HTKA 1E2PA 2HJWA 4OHPA 1IBCA 1NRXA 1O03A 2E4AA 3E7FA 4QXOA 4JL5A 4L4UA 4R98A 2Y1GA 5KQMA 3JYNA 5LBTA 3TDKA 3AJEA 3PD1A 1TRHA 1KEPA 2QR2A 1NIJA 1T5DX 2HZ7A 4IUBS 3KQNA 4L9WA 5F52A 4EHIA 2I2DA 4IUDS 4PCAA 4JOCA 1JPVA 2CSUA 1VE9A 2WYUA 3SQDA 3HNRA 5KYVA 1N2CE 1W2GA 3D2CA 2BGMA 3TQFA 521PA 1QU5A 1AK2A 2QSYA 3NVAA 4BBZA 4D98A 5JAOA 5M29A 4ZZ0A 4IDBA 4ZV7A 3C6BA 1YR6A 2H51A 2Y68A 3IYLW 5A5DA 2FMTA 2E3JA 4XVCA 3ZDBA 3QXSA 1OB2A 3PFKA 1MZKA 2NUTB 3DE4X 3A6GA 1GTMA 1ESMA 4JOSA 2B4RO 4LYEA 1G9TA 1NE2A 2Y77A 3N74A 3CW2A 5EKUA 1IIBA 2A9RA 4M3NA 2YW2A 5I4BA 3L3BA 1U8FO 2O7NA 3E5RA 1Q1NA 2LR0A 5FR1A 3PR3A 3FJOA 4TV8A 8GPBA 2NO0A 4C7MA 5JPCA 1ZESA 5HF8A 1RBMA 1P2SA 4QDOA 4XWTA 2B8WA 2BGIA 4Z4IA 3DV2A 3CEAA 2XWPA 1U0JA 4JT4A 4U2BA 2R84A 4F7DA 1TCCA 2R4TA 4KRFA 1OF1A 4X64B 1II8B 2P77A 2WSMA 3BDVA 3EFBA 1PNTA 2WZCA 4X3CA 2WIBA 4LXUA 4ZT2A 4I8IA 2IXGA 3SYRA 2G7ZA 5A2QA 5JZSA 3TIVA 1FY2A 1X15A 4MO2A 4C2BA 1HE3A 4JI7B 2JI9A 3CNEA 1UBMS 1WSBA 3C16C 1P6QA 3D6HA 1RQRA 4BAGA 1VTKA 2EV9A 3ZZ1A 3T7TA 3WWDA 4E4TA 1M33A 2ZIWB 5EZ6B 5TC4A 1XMVA 4IJMA 4FFNA 4G0NA 4EG1A 3M7IA 4DUZB 1SVLA 1Z47A 2PUTA 1OYYA 3KU4A 1CJSA 4FTWA 1YZTA 5LYJF 4TRRA 2OV3A 1Y4UA 5CFOA 1RAAA 2W2VA 1TU4A 4XD7A 5F76A 3WGIA 1MVNA 1RDFA 1E6LA 2FR0A 3B2EA 4JK3A 1HE8B 2Q3JA 4X95A 3BMNB 4A6PA 4YMLA 1JWLA 3UWOA 4POOA 2VDNB 3ZKWB 2PRJA 1Y6ZA 1YONA 2VI5A 3JZIA 4I6GA 4NDAA 4QRIA 621PA 2XW6A 1GQ2A 1VBNA 5DCLA 3CVVA 3CC8A 2IX3A 3DQZA 1B0ZA 1KSHA 3DBVO 3TZLA 2XXAA 3EUFA 5K99A 3UFXA 2DHQA 1XAIA 2G6TA 3OUUA 1UPUA 3MT9A 2DWQA 4BX9A 1K8QA 4IOLA 3H6HA 1C9EA 2V9ZA 3EGCA 2NTNA 2QKYA 2XNDA 1WMSA 4IEFB 1Q3HA 1TM3E 1KI6B 4XGNA 3W6PA 3WYDA 3ZZTA 2DTXA 5M04A 1NSTA 1AB6A 3FZEA 5DT9A 4GP7A 4BNIA 4RMIA 2BRFA 1JF8A 1K97A 2QTRA 4YQFA 2BZ1A 2DHCA 1M1YB 3SFZA 4HQNA 5IDWA 1QCDA 4IJ5A 1D5WA 4FOPA 2YFHA 2VH1A 1ECJA 3IJEB 3KTFA 3AF3A 3DQPA 4DV0B 4MHTA 4X7BA 2PLAA 3QRWA 2CFOA 4YEDA 5TJ9A 1V35A 1BA3A 1J25A 1L4BA 1M0EA 5CYPA 1II0A 1HK7A 3E53A 3QUAA 2Z6UA 3U80A 1GCUA 1HDIA 1XB2A 2C82A 4K7JA 1E9EA 2QG6A 4YRBA 2YVLA 5TPZD 2PD4A 3QX9A 5JXWA 2F17A 2Q4BA 1ACLA 2H29A 3BKXA 4HBZA 1ZW1A 2NZXA 3RS2A 3WGNA 1WSDA 3I73A 4PBTA 2I3AA 2WW8A 3BOSA 3PDCA 2W6CX 3C0KA 2HWYA 3CE9A 3DDNA 3BB4A 5FO1A 4Q7QA 2R6AA 2IS2A 3DAOA 2AOTA 2ZI6A 4IJQA 3STXA 3O7WA 3LYLA 3DAHA 2X0FA 5IC5A 3KUCA 3M34A 4D9MA 1I7PA 3W5SA 5LP6B 1HM5A 1JR2A 3DYBA 4KPGA 4LOAA 2QVXX 3DEZA 4QJ4A 4JQYA 5I8ZA 1SZJG 4M7PA 5LQKA 2JLUA 3G1TA 4MWTA 4OPMA 4UFPA 2E89A 2Q2WA 1O94D 3NI2A 4DBZA 3N2ZB 3JQFC 2OP1A 1OLSA 4ARVA 2B99A 2QRNA 2RDMA 3BUSA 4NH0A 1JQJC 3AEUB 2IYSA 1JLSA 3DPSA 5DIZA 1AGRA 1EGVB 5U4XA 3RQIA 5KMGB 3HKDB 5IEBA 2C4WA 5CGQB 4EPXA 1NKSA 5KWIA 2ZB4A 3ICPA 4FSHA 3WKAA 3TXYA 1FFCA 1JFFA 3FNIA 3DS8A 1AU9A 1MU0A 3FMVA 5ICGA 3L6EA 3SCZA 5K0GA 5J1TB 1JQAA 2AE1A 3E3OA 1I0IA 1H3NA 5EP4A 3IUBA 3NHJA 4KO8A 1KRHA 4MQ6A 1ISMA 4MX8A 1H2BA 3S7TA 3UO8B 4P3OA 5BN3B 4LZOA 1ZAYA 4LMBA 3TI7A 4IIJB 4L85A 4CXMA 1TKAA 1KTVA 1W5TA 4AYXA 3DYIA 5BSWA 4ZYYA 3HP7A 4K2AA 1YH3A 1FVOA 3M5DA 5K3FA 2KYRA 3C43A 1SIWA 3DHEA 1TC2A 2I4OA 4HH4A 2PGAA 4IXTA 3KZ1E 2ISQA 1Z2NX 4MVJG 2VT2A 4XTRA 4ANFA 2FMKA 4BNKA 3KYCA 2EWWA 4NEGA 2JQJA 3GL9A 3NWEA 3EWNA 2P9EA 5HG0A 2VRCA 1U2PA 4B81A 1DQSA 1P2BA 1ZZGA 3PT9A 3LSTA 1JBKA 4MUJA 5CLHA 3RUAA 3BJZA 4MW0A 1KAQA 1J70A 1HQKA 1P2DA 2H4ZA 3GA5A 3M3PA 3P4XA 3Q5EA 3VPXA 4JEIA 3ZJ4A 4BLTA 1M6VA 4EKEA 4XYGA 1CKEA 2H2HA 4M1KA 4ALIA 5AWFC 1K66A 3QF4B 1J97A 1RRVA 1ZGJA 5I9MA 4BQIA 1GDDA 2CHGA 3OFJA 3AUTA 5ITZA 1UDCA 3OE1A 5JC8A 4E03A 1UOQA 1K3NA 1Z16A 1Q95A 3PXUA 2NV6A 3NAMA 4HN4B 3OA2A 3PA6A 2XBLA 1RQGA 4TVBA 5LB4A 3VU9B 3S8EA 1F3OA 4WKBA 3DEYX 5KQLA 5LU8A 4ZRDA 3Q6NA 1MOSA 1JDJA 1L7OA 2P4QA 4EF6A 3UM9A 3LK6A 3EVAA 5FHRA 4BUCA 1E9AA 4Q1EA 4Q3OA 5IF9A 3TOVA 1TXGA 2A5YB 2ETXA 3CGWA 2YNMD 3AHCA 4LHYA 4R1NA 2BGRA 3TWOA 3GPLA 5GY7A 1ZO8A 1IUPA 5KCZA 4TLCA 4BWFB 4CFZA 1NOJA 2OV8A 4C08A 2V7XA 2D7JA 4MUYA 3JALB 3B48A 3MXTA 3RRBA 2QPTA 4W1QA 1FTNA 3TECE 1PFVA 3V1TC 5E7JA 1M2JA 1VJCA 2QLNA 2WUGA 4G23A 4DR1B 4LW8A 4TUYA 4YRKA 1NXTA 2QMZA 4NCXA 3QEAZ 1C8VB 1E6KA 4AO8A 4A2WA 1F6BA 1KJWA 2C8VA 1NATA 3K2QA 5FULA 1RI4A 3P0FA 3IEKA 2SCUB 4HWGA 4IIDA 3STTA 3KQKA 3BEOA 4FC6A 2O57A 3ZYZA 2R6CA 4O2BB 2DBYA 4OUDA 5JMPA 1ZGCA 2AC2A 3K9HA 1WBJB 1XQWA 1QH1B 1Y1PA 4WUTA 5EIBC 5B36A 1TU0A 1KR5A 2Y0CA 3N86A 1WCV1 5HOEA 1E3QA 1T1GA 3MTAA 1T9BA 3ONDA 4WL0A 3P9PA 4MKHA 2QJTA 3IQEA 2XPCA 4YRPA 1PUXA 1RQ7A 2FQWA 2J6IA 3DL0A 3INTA 4FI3C 5D00A 5IDYA 5AW9A 4Q3CA 5IH7A 1SCNE 4MVWA 1B43A 3LNTA 3AGQA 5IJXA 2QRGA 1B26A 3JQBA 3QBTA 4KN8A 5EJHA 4AS2A 4BNHA 1PVDA 1UXIA 5BUCA 5LIRA 4C0XA 2WKSA 2ZJ4A 3W8DA 4CUZA 3S68A 5TF4A 2A9KA 4UUMA 4TKVA 1WXWA 3TSOA 2JD0A 2ZB7A 2H5LA 2SNIE 2BFCB 3AILA 4X20A 4YUYA 3N8NA 1B14A 2FP3A 2RGEA 3ZOZA 3LL7A 4IDGA 1EFHA 3A26A 3ABIA 5DI3A 5LBUA 5LMZA 4K88A 2I76A 3PJDA 1USUA 3H2KA 3OZRA 3UUWA 2XQFA 1P9WA 4L8LA 2PMCA 1NWCA 2P0YA 2AI2A 3HVJA 3O84A 3FMPB 3G1UA 2H9YA 1J4PA 2WNSA 4RJKA 1AMNA 2H1LA 5GVRA 4QO8A 3OLYA 5FOQA 1N7JA 4JLWA 4PLZA 1B8NA 5EFOA 4ZAFA 3ZHYA 3SSNA 2PX8A 4GYJA 1V6SA 3V1NA 3ONEA 5K0SA 1T36A 2UKDA 2AN3A 3AXTA 3FI0A 5CW1A 4TM7A 3AFGA 1WMBA 3TDMA 2G0TA 3F8SA 3FOCA 1I32A 1SHTX 2WB4A 3D2BA 3EGOA 5TJHA 4DQUA 4CKXA 1P4AA 2C9OA 1K3QA 1EEXB 1N2HA 4KJZA 4EHKA 3HFSA 4QUAA 3T4EA 2GA9A 4CM6A 5TMPA 2GSDA 2IYLD 1Z3CA 4LJKA 4ZO6A 1TQ8A 4F5DA 3G23A 2QQGA 4KUEA 3VO9A 3QSYA 2WPDD 1E9VA 4B34A 2VQEB 1XXHA 3N2GB 1NVWQ 3NIWA 2G1KA 5FNVF 1MC5A 1X8LA 1HLFA 3LRXA 2Y3IA 4V0ME 1VMKA 2CLFB 2R1ZA 3KEQA 4WACA 1NMQA 1WRBA 5DLEA 5AXBA 3NTUA 4HLCA 1IJKA 1O1YA 2BKLA 3I2HA 2FPLA 1V8DA 4MQMA 4GW3A 1EK6A 3K8QA 1TVEA 1W5AA 1POXA 3B3QA 4NBLA 3WMXA 5LJLA 3L7LA 4P81A 4BQFA 1S1MA 1ZC3A 3MRTA 4IO1A 3V9AA 4R84A 1S8OA 5GOZA 1FTGA 3ROZA 2OLJA 5L8VA 3LNCA 1P1HA 4ZA2A 3WP1B 3ZIDA 4YJHA 4FGZA 3ZVNA 1SHJA 3FHLA 4KBFA 1ZIOA 4RPKA 2V3CC 4HV4A 4A8JB 1UBCA 2XUAA 1KU0A 1HMPA 1SWVA 5CPBA 1OH7A 2WHRA 1RJ9B 3I83A 3TAHA 3GVXA 2VJKA 5IN5A 3AHJA 3I8SA 1PUIA 2A30A 2XTJA 1TK3A 4FB4A 3K71B 3INNA 3ZXUB 1EM6A 1HBJA 3I34X 4P4NA 5FUXA 5AJWA 1N2IA 3AW8A 1N0HA 3PX2A 2AFIB 4E5PA 2GD6A 2R48A 5ISMA 4OHFA 3KKKA 2YMMA 1KK0A 3QUSA 4JJFA 4W1RA 1IQUA 1T91A 4BP3A 3OQMA 4CM9D 2FPIB 1BA2A 5BORA 2Q1TA 2OY0A 1LLUA 2FSSA 5DWVA 5CFPA 4BB0A 4O63O 4OHCA 2HCRA 1L5FA 3E9MA 4KFTA 3DZ8A 3R6GA 1KQ3A 4JB2A 1RMYA 2Z2YA 5FIUA 3ZOKA 2QTHA 5K5EA 1D6MA 1YOBA 3QI2A 4NV0A 3R7SA 4A0HA 3L04A 2V7EA 2HA7A 1RM3A 3TOCA 1JQLB 2FFAA 2UV8A 2XLCA 2A3RA 2YV4A 4LMAA 2QMUA 4B4WA 2KLBA 1JXOA 2V6BA 5DLQC 1JIKA 2PNFA 4MVJP 5BW8A 1BHSA 1NUSA 2B5VA 3IRVA 4FFDA 3UPDA 1U11A 2I4LA 4MH0R 4DCPA 5IANA 4HD8A 2WDZA 2VYND 1RJFA 2OAGA 2WWWA 1H4TA 4IJVA 1WCIB 2Y1FA 4JELA 4WINA 3KSDO 4EOGA 3QKSA 1ABFA 1L7AA 5BN1A 5HMMA 1RWVA 4K0RA 1S2DA 5CXQA 4U2CA 2W5UA 5EJIA 1KKUA 3BXHA 3SJCA 4MRNA 1SULA 3RYCB 3C6KA 5EE5B 3S5JA 2H9AA 3IQGX 1DC5A 1GA4A 1GSAA 1FTYA 3MUOA 4DLSA 1V11A 3LUAA 3ZQ6A 1PJ8A 3S6JA 5BSHA 2OORA 2Y8EA 3BWMA 1VXRA 3S2EA 3F7OA 3TLMA 4XUEA 3GMSA 2A33A 2GM9A 4ER3A 2A5GA 1G2IA 1A2BA 1NVFA 2H48A 3KPYA 3BYZA 1QG0A 4JP5A 4NZYA 5IKEA 4L8VA 2OFFA 4WT7A 5K6AA 3MELA 1FS6A 3MRXA 4ETIA 3KZKA 4CR7A 3CE6A 2P78A 4WRRA 2NWQA 1PWZA 4E7PA 2P90A 1DWQA 4UDOA 3OM9A 2ZEJA 1A97A 2BT4A 2WJ4A 3UIEA 3L7MA 4GU5A 5E1OA 3WJAA 4J29A 4FNAA 1UM8A 4KI0A 1WF3A 1JAZA 4TQAA 4CV3A 4KC0A 3TLZA 2ZQYA 3FMIA 1XALA 1FUEA 1YZFA 2FZWA 3T61A 1XEWX 3GGOA 2Q7DA 4DL9A 2FLWA 2XB8A 4OATA 3U7GA 1M8JA 4ZEOA 3ZE7A 3TLXA 3KQMA 5AICA 3MLEA 3USCS 3LZ6A 3MNFA 1QSGA 4BAUA 4F85A 1VRCA 1ZVKA 1J7KA 3QEMA 4GZ3A 2R79A 4XRGA 1LBTA 1YVEI 2HU2A 3VR3D 5EJGA 4PBRA 1MV8A 3BHIA 4CUJA 4EELA 2XYQA 2CFIA 1XEXB 3LCCA 1SOUA 2OFWA 3ORQA 2VTBA 1IN8A 5L40A 1HI9A 1ZK0A 5CDTA 2X0KA 4DRXB 4HDMA 4JI1B 3ZHQA 3RYHB 4B7ZA 4BJ1A 4IG4A 1FX1A 1WDMA 3MAJA 2NP7A 1J00A 1SC4A 1TYEB 2XRYA 3VVMA 1UZLA 4ZK2A 5F2KA 5B6IA 4IQFA 3NHYA 4ALLA 1JXMA 2G5PA 1C7JA 5DYYA 2A1UB 1J4AA 3D3WB 1UBGA 2PTGA 3ZBQA 3KS9A 4NYJR 4HH0A 2ZW9A 4DWVA 1HDOA 4LYFA 3R2JA 1VLMA 2O0KA 2NYUA 1PBTA 3DOOA 1X9IA 3VKUA 2FLKA 1RWWA 1LSSA 4J49A 4K9KA 2JFZA 2CNDA 3D0QA 3IOBA 1XLTC 4O2AA 4E3ZA 4WZZA 5GV7A 4DNFA 4NCJA 1GT91 1KJQA 2BC9A 3MG9A 4NI5A 3IV9A 1WCXA 1FXWA 4H16A 2J4FA 1ZI8A 4AJ4A 1E1CB 4DIOA 5C5IA 3BM5A 5GJVC 2FG6C 2QUHA 2UVPB 5FKJA 3GJ6A 3HVHA 3GT3A 3B78A 2ZKLA 3MDBA 4IYRA 1M8KA 4IWXA 3UYKA 3LLUA 2ODNA 3KHSA 2NV2B 3H86A 5E9JA 5CB6A 5JS7A 4OQQA 5B3KA 2XOKD 4QDZA 3E1GA 4IH4A 1ID1A 1K5GA 2F43A 2PWAA 1N0IA 2GHRA 2N46A 3G82C 3G68A 1J9GA 4HAOA 2HF2A 4EA6A 1N8TA 5FTJA 4XQ9A 2JHAA 3F7MA 1WZEA 2GXUA 3DT6A 2DRIA 2G9ZA 3IBTA 5DK4A 4NP6A 4RH3A 3RVDA 4B71A 5H4GA 1XTRA 4EG7A 1TM4E 3BAFA 2VDWA 2XKKA 1GP2A 4LRWA 1Z13A 4C43A 5IM4F 4KNYA 2RBKA 2YYSA 3GLHA 3GQBB 3H11B 2JLQA 4OI2A 4RV5A 1ZVVA 1AZTA 2P5TB 4ER5A 4B17A 4ZJPA 1A4IA 1ADYA 4BQEA 5DN6D 1SVUA 1YJAA 1JU9A 4HGOA 4RJLA 1LSJA 1YZQA 2W4MA 1GNLA 4M1EA 2GZRA 3CCBA 1P6UA 1FP1D 1TJNA 2OHGA 3GEDA 2W6PA 4LOHA 5D2CA 4ZMSA 3IODA 5ESDA 4CU2A 1K9SA 1NVDA 1Q7TA 4G36A 4MK4A 1J1UA 1J24A 4PG8A 4N3AA 1QOZA 1NYQA 3DMTA 2BHRA 5CITA 2FUEA 4KPUB 5E3HA 1EFVA 2ERYA 2QAIA 2JEYA 1BD4A 1UMCA 3A9CA 3N5KA 4JJ6A 3VR6H 4UM8B 3ZCTA 4XZ3A 1RKUA 4GI5A 3MWYW 3JRXA 4Q7MB 4XIGS 2CCGA 1HORA 2LP4Y 1UM9B 2YDXA 4B7XA 4Q6WA 1ZD8A 4BWVA 5K4GA 2O05A 1QNLA 2VDVE 1Q7GA 5AK4A 2OOKA 4RGVA 3ZYCA 3ZDCA 1XC7A 2OE2A 4BLOA 1TQ2A 3L1HA 3EK2A 1A27A 3MB8A 3RC7A 2FEMA 2WUVA 5JH7B 1KAOA 2BFEA 2Z5LA 2BKXA 5H3HA 1GRCA 1UBNA 1Z5NA 4IIGA 1EXWA 4URFA 5H3CA 4C0HA 1BCSB 2VNIA 3NGLA 2P2GA 4DPMA 3AFNA 2GRJA 2WMOB 4ZOLA 4CCSA 2BZSA 4TX1A 1J39A 1V5GA 3QKWA 4BC1A 5K0TA 1E77A 4OOFA 1ZOIA 4O4IF 2J09A 3FYUB 5SYAA 4H7EA 4DHWA 3S0JA 3V1LA 2VRBA 4TZ0A 3EXFA 3NHWA 3WLRA 4C0SA 2IYPA 1MW8X 4JS0A 2KKLA 1Y9EA 5I9IA 3T34A 2ZRFA 3U7RA 4ZCLA 3HA3A 5C8ZA 3DH0A 4FDAA 2QN3A 4YB8A 1G8YA 4OJTA 4YJ3B 4FJ0A 1J06A 4ND7A 4RO0A 4TKMA 4RM3A 1QF6A 4KPYA 1YQTA 1BKSB 3PUJA 4M4SA 4AJ1A 2AIRA 2IKQA 4MS1B 3WK9A 5AHOA 5H80A 5G4KB 3QFFA 1GY8A 1ZN9A 4YONB 4IQGA 5IBCA 1UPXA 3A9RA 3AK4A 3N0VA 4B4KA 1HEIA 1P74A 3TK1A 4AXBA 4EEZA 5HQTA 3IJRA 4DWOA 3ANXA 3Q7PA 3QU9A 2VXCA 2AJTA 1XAHA 2WUFA 1B6RA 3TW6A 3DD5A 1Q0RA 1Z06A 3MFYA 4RCYA 4NCIA 2CUKA 2LDBA 3ZY4A 4DMFA 4DWWA 2R11A 1U2QA 2BEKA 4PQYA 3RSCA 1OFUX 3C6YA 5IRCD 4U8HA 2O8EA 2GFQA 2Y9MB 4AAYA 1KQFA 3ROXA 1ZK1A 2NNLD 4YCAA 1GUDA 3E7XA 5J9FA 3DKKA 1XEFA 2PMBA 2R1VB 5AKHA 3MOGA 4EG8A 5G0UA 3VR1A 3NBKA 3I9NA 5LMCA 3NVMB 1YBAA 1EBUA 1G8SA 1M8FA 1F2UB 3GPBA 5AXDA 4F92B 4DUGD 7ABPA 4XOUA 1X7YB 1UT8A 3AINA 1QTQA 4Y1RB 2B82A 4HVCA 3D6MA 1UC4B 1K27A 1W4ZA 2B3TA 3SEAA 5FWXA 4LWPA 1WZIA 2OESA 3PQ4A 3G3EA 1U28C 4RDIA 3B1KA 1TUBB 1EDOA 3WRVA 3I01A 4BZPA 2ORIA 1NJ1A 2F3UA 2O54A 3AG5A 5CPFA 3T9CA 1GGEA 1DT3A 1Q44A 5ED0A 3F6CA 5CLGA 4ZCPA 3M4NA 4XVQA 2PYDA 2J0QA 1SXIA 5IABA 2R6HA 4JROA 1ZBQA 3BE4A 2GLTA 3KVRA 2NUTA 3TINA 1T3SA 3OD1A 4TLAA 4QBGB 1LS1A 4NVRA 2HRRA 5BWMA 3ZQJA 4W5QA 5ALJA 5JVDA 1SVOA 4TZ6A 4Q9IA 3UH1A 2WPNA 2FWAA 2QVCA 2NTJA 3IOCA 4GPTA 1IRIA 3P2OA 1XCLA 1XKLA 4I1OA 1IHPA 3NZEA 4MWGA 1AA9A 1U31A 2VK4A 3RAEC 4QYSA 1O57A 4LXYA 4EKNB 5EZYF 1ZSVA 4J2HA 1GPDG 1II8A 3L9WA 2DBVO 1IZZA 4HAYA 4P08A 1C1XB 3LC2O 5EJ7A 5EJ9A 2Q0SA 5CFLA 5JMWA 4JLKA 4OL0A 3Q6IA 4LCEA 3LKZA 4EFMA 1AQUA 4EI8A 1ZMTA 1W96A 4NBWA 4QUEA 3FM8A 2VJOA 5BV8A 2J5RA 3SKYA 4F3YA 3QZUA 5G53C 1Q5PA 5SY6A 5E7MA 3S70A 1FMLA 2CEKA 3SX4A 3WLHA 3ICQB 3FYDA 1YBMA 3L0IB 4QG7A 4A27A 2WYVA 3JYQA 3FFAA 3I4CA 3KV1A 4Z5XA 1F1JA 1UBUS 2XUKA 3BWVA 1V26A 1JBEA 4UCFA 1RKQA 4IXMA 4JLDA 3BMNA 4M0MA 3LP6A 4CM4B 1TEHA 1LS6A 2FHPA 3C5CA 3LPAA 4U2GA 3ZKWA 1KRWA 2ZIVB 3N8DA 4OB6A 4OQFA 1T2UA 3EEOA 1YD7A 2J0UB 3L46A 2QN9A 1SCDA 3WBFA 4I1IA 1BD3A 1E5VA 1KS9A 4X71A 2GN6A 4RZIA 3QOFA 5TARA 1E2DA 2Z3ZA 3R7LA 3HABA 4AG3A 3B2QA 1H93A 1LQ2A 2HSZA 4KIJA 4RTPA 1YJCA 1FDRA 3DVQX 3SR3A 1EE1A 4ND8B 3Q87B 2PS0A 2PV7A 4D79A 1Y33E 2WR8A 2Z4RA 1RRGA 3QLJA 3HMKA 3FPCA 1DPGA 2DCUA 2I6XA 4G5OA 4EL5A 5EAIA 3LL4A 2W58A 4EKDA 1JH8A 1K3TA 3IBCA 1KI6A 2I55A 4MA5A 1GOTA 2ZUVA 2Q49A 2WYOA 2YOHA 3UHJA 3QV2A 4J91A 1E1LA 4HGNA 1M1YA 1GHTA 3K09A 4H0NA 4R2LA 1IEWA 2QYOA 5D8DA 4BJ5A 5FTLA 2HLNA 3AC0A 3UMCA 2IY9A 2R00C 1QR6A 4FGLA 1OFTA 1AY0A 5F1OA 2N47A 2IYZA 3URMA 3UMFA 2IHTA 2CKDA 3IOMA 2YIVX 2VOJA 3TVTA 3ZWCA 1O5IA 3FMFA 3N7UA 3GJ4A 4MUNA 4BO0A 3ISTA 2E4YA 5BNZA 4HYYA 3HG7A 3EAFA 2A67A 2JJ2D 2WT9A 2ARKA 4I99A 5SYNA 2BM9A 3SBOA 2Z8YA 4LTMA 1YULA 1DC6A 2YZ2A 1KOFA 1PLLA 2WU0A 3BRSA 3LUHA 3RFFA 1EDZA 2R65A 5J2UF 3VKFA 1U0SY 4Q4CA 2OFPA 3CO0S 3KOXA 3GJTA 2K7ZA 2IZ7A 3GARA 4DLBA 3BRWA 3CEPB 3LVFO 3FCXA 5JAPA 4RD4A 3OBIA 2UAGA 3NASA 4TT3D 1EDEA 1K2NA 4R1OA 1MABB 1G9SA 3JASB 5HUJA 2P6UA 1BRTA 5EQDA 4ZVOA 2P27A 3DZJA 1Z29A 4FNOA 1Y98A 3VDNB 1DLJA 3R3HA 3H6GA 2YWXA 4JZYA 5LC1A 1DRWA 4L0CA 3OHPA 1W44A 5A3SA 1QKKA 4AQDA 1QIKA 3AEUA 3STWA 3ELUA 3O2QB 2IUUA 2WFAA 1NDUA 2JBHA 1M8PA 1P3JA 1T5BA 2GBPA 3ASVA 4JWTA 2FZ5A 4M1QA 4MVJI 1QGAA 4R41A 4WBXC 3HKDA 4BKPA 5KMGA 1E1RD 4C87A 5DFAA 2GYWA 1B23P 3GMDA 1G20B 3I9JA 1E7MA 4D57A 1RQNA 1RC8A 4EG6A 4ENWA 1GPMA 3NDJA 1SWWA 3BJEA 2QRJA 3J7TA 3E7WA 4KXWA 1P44A 3ONNA 2WU3A 1R27A 1YU9A 2VWQA 1N36B 5LQSA 5FB3A 3STVA 3F5SA 5AVTA 1WXEA 1KO5A 2ES4A 2DPXA 5A7HA 1CQXA 1G98A 1N6OA 2HSDA 1Q17A 5TSDA 3TEMA 3T1TA 2IUFA 1E99A 2XE6A 3DULA 4BVBA 1N75A 4KGZA 4KX5A 4A3SA 4IIJA 1AM4D 1R5BA 1TLTA 1RM4A 2FDXA 3C2QA 3DXXA 3PHGA 4F96A 2C3OA 1CUFA 3DUWA 3O8QB 4CI0B 3KQTA 2AFRA 2M32A 1PF7E 5G4LA 1CJVC 1NW4A 2RH4A 3AO0B 4R54A 3RB8A 4BVFA 3WDKA 3MMSA 4PPFA 1R6AA 2E5WA 3OU6A 4FHDA 1IN5A 2DFKB 2Q3DA 4MMZB 2ZKIA 2V0GA 2AEEA 4GOKA 4FLEA 4UM9B 2ZZMA 3M5PA 3W6OA 3ORSA 3WB0A 4OH1A 5LQMA 3ID6C 1IULA 4WBNF 3J81A 1RLOA 3LCRA 2OSVA 5FI3A 3GJ5A 3OKPA 1FMFA 2IH5A 4RH0A 3PQDA 1U0RA 3DFIA 4RY0A 5EHNA 5KAMA 4JYCA 3OLZA 4MNTA 3AHDA 1Z22A 2IKSA 5DLPA 4E5YA 2BN4A 1G19A 2C8JA 4Z2AA 5C8YB 3I9KA 3O21A 3EF1A 4MLDA 2IV2X 4DCMA 5DW0A 1TYDE 2I4IA 3OZFA 3MTGA 5EIEA 4EENA 2CNKA 3A10A 5CFQA 3VU9A 5EXTA 2FOLA 3V1MA 2EJCA 2D6FA 4JUIA 3BD7A 3TQCA 3C3MA 3E61A 1XWWA 4WFKA 2JH9A 3CVYA 5C3MA 3KSRA 2G4CA 1JT2A 3IKVA 1HNZB 1O6BA 3RV4A 4FD2A 3PVCA 2ZAOA 3VDXA 2JAPA 3FNBA 3L6BA 3GFFA 1H66A 4ABTA 3IE2A 4QELA 3BERA 1TMGE 4XASA 1FSZA 1R64A 2ZB2A 4BNFA 4ZT6A 4EEKA 5LXTB 2DFLA 1RAFA 1DQYA 3EVBA 3G0BA 4M1ZA 3U62A 5BRAA 4HDAA 1I30A 1XZEA 3EF0A 1SQFA 3KZMA 4NXNB 1ZM7A 3PPWA 5F2OA 2VHVA 3C48A 3JALA 2ZDQA 4R6WA 2A8YA 3CCCA 1FVXA 1QOPB 2B0CA 4BEWA 2YYYA 4EI7A 4REQB 1S2IA 1W30A 2OAEA 3MUEA 4H77A 2DQZA 1GG5A 3DHNA 4OVKA 4W9RA 5T8KA 3WZMA 1RQXA 1GADO 4G8CA 2P6OA 1JA1A 3R3WA 5AK0A 2SCUA 2H4FA 3HJGA 1BS1A 5J40A 2FPWA 1IY9A 1OXVA 4O2BA 4BEBA 2Y1KA 1KDYA 4MWCA 1TPYA 1QH1A 3NBUA 1UFRA 3DP7A 3BSWA 3I58A 3H9JA 3QITA 2RG7A 4I6EA 2X4GA 1K0FA 3EQ9A 5HM6A 4EQZA 4LTNA 4UW9A 1UBKS 1Y6JA 2CE2X 2IW3A 3A4LA 2QVBA 3DWGA 1W36D 4RZ3A 3UT6A 1VE7A 3I6MA 4BBPA 4D45A 1A95A 3COWA 3GEHA 1MHTA 2JF0A 3OQBA 4TXNA 2LCQA 3SC2B 4N54A 3CPSA 5U4QA 4E11A 1SXJB 1TVCA 2WI8A 1X1TA 3PTLA 4C1NA 1KI3A 3UY4A 3KLOA 5EHXA 3OEEA 1FYXA 5E0KB 2EKBA 1DU4A 3CF6R 1KR2A 4ASUA 3OF5A 2BFCA 2QM7A 2LKCA 1XTZA 4CG1A 2CYAA 3E27A 3RF7A 2R66A 3P9NA 3RGGA 3T0IA 4JB8A 4PZZA 4OO3A 5CVDA 3TNFA 4B3GA 1PVOA 3ILVA 3UG7A 1K3FA 1OLUB 5IH3A 4WN3A 2R2AA 1QS0B 3E4CA 1XEAA 2NYVA 4RXTA 4NG5A 2P6PA 1ATIA 2XTMA 3UA4A 1FRVA 3EBPA 3FKSA 4GGPA 4K3UA 3WYBA 1UH5A 2XDWA 3VI3B 4BE9A 5KREA 5EHQA 3R5JA 3HYRA 5ICCA 2YYAA 1Y0BA 4YREA 5KYXA 4RK7A 4DADA 5CVTA 2I03A 1XU4A 3HRKA 1QCZA 2HU5A 2HMYB 3U39A 3OZXA 4J1TC 2GYVA 3WWPA 2PJZA 5IULC 1ICIA 1Z08A 1G18A 3G2PA 5E4FA 5EQJB 4D26A 1U80A 2A0TA 1O08A 4FGWA 4HR7A 4JYPA 5HJ2A 3RTDA 3K20A 3FRJA 4Z9BA 5FBLB 1P1IA 3EVZA 4UARA 4CODB 4US2R 4MB0A 1DJLA 4YACA 2H1VA 2MSDB 4BJ3A 2Y1XA 4E88A 1PWEA 3U81A 4PZDA 1EGHA 1PT8A 3X1ZA 1N3IA 1Z6PA 1IK6A 1G1AA 1E9CA 1FYDA 1Y42X 2BFBB 2C88A 1IMJA 3CNOA 3L4BA 3N2GA 3QLTA 2WKWA 5DF1A 4XWKA 5IWCA 4WKCA 3I8XA 4MQEB 2JIOA 1CJKC 1XMXA 2BKEA 3NHBA 4G5YA 1A82A 4RE6A 1JR3A 3D1VA 1T9HA 3QPDA 5GZ3A 4DSZA 4B09A 2WSBA 3GROA 4ZQGA 1S8FA 2F9FA 4MRMB 3IIMA 3SKXA 2PX4A 4YJDA 3PNKA 5G41A 1T3HA 5AHWA 2QG9A 4EUFA 4Q3NA 3V6LA 1RYEA 2HFJA 4XUDA 4RTSA 2WTUA 3W06A 4J6FA 2VHYA 1EXMA 4R4JA 4S1VA 1PUJA 4PIMA 4HJRA 4JSTA 3NP9A 1XKTA 1NNLA 4A8JA 3ILYA 1XZQA 4GIBA 2WU4A 3HXMA 4IICA 1MH9A 1RJ9A 3DZCA 4OJQA 4TTIA 4QGHA 3T4UA 2RE8A 1A2QA 1YDFA 2YV1A 3A32A 1JEAA 3IPCA 2BFAA 2BM1A 5LZ2A 3MCAA 4DOMA 1ZH4A 2X1HA 5HKOA 1NMXA 3DZHA 3AJDA 5LQUA 2ZJ6A 2YYZA 5CDFA 2NZ2A 4LGMA 5IX8A 2AFIA 3X43A 3ONFA 2FYTA 2ZSBA 4W9NA 2JVIA 1TE2A 3EZGA 1L7QA 3D4OA 4J76A 5BNIA 5K05A 2YY5A 1O6GA 5JSHA 1C3VA 1WUHS 2FPIA 4EPTA 2XUPA 1IUOA 2G28A 2ZQ5A 2FGKA 3A7DA 4EP1A 1MX1A 4II3A 2WJ6A 3MGAA 4JIGA 4OKSA 1MQ8B 3HTXA 5ICSA 2QRQA 1E2JA 1GKLA 2UUPA 1A50B 2ZWMA 3R40A 2IPXA 1R9NA 2WMDA 4OHMA 4I3HA 1KY4A 1ZOOA 3I6WA 2BGLA 2XQKA 4EW6A 1Y8CA 3NEAA 4UQPA 3FF4A 5AI5A 5T64A 2EQ5A 3A37A 1QTNA 2GN2A 3BL6A 1U5AA 2C3PA 2H9IA 2X4LA 4I1YA 4XIYA 4BTVA 4DG8A 3E1KA 4UAJA 1QZ3A 1RM0A 3ZQ4A 1ZBDA 1RACA 1WCIA 3BMXA 2C5GA 1H65A 1DV1A 3DEJA 3ELBA 4MLPA 1G16A 1HXHA 4NEQA 4P9NA 1DFHA 4F04A 3A6ZA 4XA8A 4OHXA 5BPHA 2FW0A 5DM70 3S2SA 4MA0A 1H23A 3RYCA 3M83A 2OG1A 3VXKA 2J5BA 2JGAA 3OQVA 1T5HX 3TOXA 5CHEA 3COVA 2GQ0A 1UL1X 4JODA 1S9DA 4CTKA 2ZROA 3E9CA 3VTAA 1ZGZA 1Y1QA 3ZI0A 1Z74A 1YGPA 4Q7LA 5I7SA 3M1IA 4GRIA 2YCBA 3VC2A 4WJKB 4PX3A 1RR6A 4E51A 5D3KA 2QUKA 2C9BA 3HCOA 4TN5A 2BMDA 1L5ZA 1SH7A 4JJ8A 3HCBA 2BTEA 2IYUA 3CZMA 3OO1A 2C9MA 3F3MA 1QYVA 1QGOA 1ZJ6A 2PX2A 5F78A 4AY6A 2FSPA 2UYGA 2W3OA 4GZ6A 2GPBA 3TXAA 4LBZA 1ND6A 4BCBA 4L3OA 3GDFA 3H87A 3HXOA 4GM1A 1WXIA 1QTRA 3GCZA 2O06A 4G0WA 2WLSA 3ETCA 1KXZA 5BR1A 2RB4A 3R5FA 4NFYA 3VC7A 1W73A 3PGVA 1E8MA 4CMEA 4CNQA 3UNMA 3IXLA 2C42A 4YR7A 4C5BA 5JYEA 2CNBA 5DX8A 2JFGA 3H0CA 3AVPA 5DYIA 4L02A 3SEZA 3T1QA 1V95A 3NU1A 2JLSA 4FSDA 2D0PB 5HTOA 3ZHUA 3GF4A 3HHEA 4V0LA 3AWDA 2OB2A 2PQ6A 1C7IA 3ZDEA 5KJ1A 2QQFA 1ORRA 1EX9A 3ENKA 1R6DA 2WT8A 3LBAA 3AR8A 1XEXA 3H7AA 4DQVA 4LVUA 1L5QA 3FE2A 4DRXA 2UZ0A 1UMDA 3C41J 1HYQA 4INOA 1CJUC 3EUEA 4M46A 4LFBB 4UPEA 3CQ9A 5ALVA 1TM1E 2NSDA 1T5LA 3LDGA 2FWMX 2OQVA 3OQ6A 1ANKA 2A1UA 3D3WA 4X63A 2PKQP 1Z6AA 3WP0A 4ARAA 3ZY2A 3MB5A 3OD5A 5CGZA 2XCQA 3K1JA 1Y5NA 3UV6A 1O4WA 1DKNA 1XTQA 2XGOA 4Z9XA 2C1XA 5ARBA 2ID8A 3SG0A 1M10A 3QE4A 3TYXA 3IMFA 3CR8A 2KBFA 3ZUGA 3EH1A 4DHEA 1T9CA 1GZ5A 1XFDA 2E85A 3GA7A 4OUKX 1Q16A 2OQRA 1LDEA 5DNDA 4FD3A 4MSUA 3NBZC 3VUFA 1PSDA 1UJ4A 1EWTA 3CTPA 4D9KA 1NQ5A 2I87A 3AF2A 4IINA 1TDJA 1E1CA 2OECA 5FRDA 3RVQA 3AVXA 2JGNA 5K3DA 1LSOA 2UVPA 3G9QA 3H5LA 3M49A 3PX7A 4GX5A 1IONA 3JZDA 4WN9B 4NV3A 5I7AA 2J67A 3F6PA 5DCUA 5J1SB 1R0BA 1Q7CA 1GGNA 5CFRA 2X8BA 1CRZA 2IE0A 3FDZB 3H5NA 4F7WA 3KKNA 1G5TA 4CL0A 5TLSA 4BOYA 2B34A 2CLCX 3KJFA 3STUA 1BYUA 2CZCA 2FEAA 3HZZA 2C2OA 3GEPA 2VYVD 4DJJA 1RHMA 1PR0A 1E2EA 3QYAA 2C07A 1EQAA 3JQEA 1HQDA 2I1QA 4DJDC 5JJCA 4RK0A 3U40A 4BFXA 4JU9A 2X40A 2DWPA 3FBTA 3WDMA 4A10A 1CETA 1I36A 3OC0A 4OXYA 5ALUA 3WQSB 3GQBA 3H11A 4D4JA 4Z1OA 5JJIA 3LQ1A 4PQEA 1DJNA 1LPBB 1M7HA 3FRHA 3HBMA 4KGDA 4UBKA 5GPBA 3IT3A 3P2EA 2VJLA 4RPCA 2P0EA 2KX7A 3KO8A 1B8PA 3RC8A 1WP4A 3EFHA 3ZGZA 2GNPA 5T4EA 3KJXA 4UUOA 4OQDA 2NZWA 3FSEA 3EMKA 4ZCSA 3ITKA 5IUKC 5K51A 3FYHA 1S1CA 3JQ9A 3V8RA 1FLDA 3H3FA 5FP0A 5AIBA 5KTKA 3I76A 3AOEC 4MYDA 2VCHA 3C4QA 4KPUA 4EATA 2ZQZA 3FA2A 4LY3A 2XDYA 3LH5A 4JP3A 1Z35A 5EL0A 4D4HA 5CUQA 2AUTA 3NS7A 5J47A 3K4QA 2D7DA 4JR1A 1UM9A 4PNZA 4EQ6B 1CXZA 2BWJA 5JEDA 1DJPA 4L9RA 1OIWA 2AV6A 4G26A 5TMEA 2W9XA 1GZ6A 4QJBA 2AD5A 2JZNA 3JZMA 3MPUA 4PCVA 5HDQA 1L7MA 2HHCA 1P0QA 1NPYA 3QMWA 4LN1A 2YRXA 3FBWA 5JH7A 4H7KA 1GGKA 2WSYB 3ANTA 5F23A 4ARBA 2A1IA 2HX1A 4NOMA 3TZ6A 5KNLA 4WNAB 1WVIA 3H2YA 1BCSA 1ZDMA 4HX9A 1XD8A 5L3SB 2EDCA 3SZMA 1E9FA 4J0EA 2B1GA 2ZJAA 2DBZA 2RHCA 4P31A 4RF5A 3E82A 1C14A 2HMSA 2ONCA 3GRPA 2QUJA 3GRZA 4FHFA 4O5AA 4U2KA 4ZVSA 3VR0A 3FYUA 3I3SR 1N25A 3MRSA 4UASA 1G5HA 4ILKA 4LJ9A 1P91A 4D80A 1DBPA 1TT7A 2Q50A 1VPTA 1G5PA 1NI5A 2O0MA 3AF5A 4S12A 5HWSA 2F1JA 2ZS9A 3TMYA 3OTGA 2NACA 1KK3A 1AZWA 3CA8A 1O94A 4OJYA 2ZZKA 4YJ3A 3PK0A 1KYXA 4Q9LA 1PI3A 1HR0B 3ZDYB 1DBSA 1MJ5A 1H6BA 1IG3A 1WD7A 2VP0A 1QJ4A 2XKJE 3D02A 4UXIA 3WIUA 4BFZA 4B40A 4MS1A 5G4KA 1RKXA 5JWRA 1L4EA 4JP8A 3GUHA 2P2CA 1TAGA 3N70A 5KIAA 4OM7A 1MOZA 4Z4HA 4M0FA 5KU7A 1K86A 4S1OA 2H59A 2ZRNA 4HSGA 1YR2A 3FOBA 3ITNA 4O4LF 1NQTA 1TGYA 3GNQA 3KVVA 1XKQA 4YJKA 1KOLA 5GONF 2ZU0C 1QBKC 3CKKA 3ESRA 3KEMA 2CXRA 3RVPA 2NG1A 2ZE6A 3VPCA 3UQZA 5BUZA 1LK7A 2Z57A 2H4WA 2VIIA 3QTBA 1E1QA 2CHUA 3CRVA 5K8LA 1IJBA 1U3CA 4DV5B 3MJCA 4IO0A 4ZXFA 4BP9A 4JT2A 1LZLA 2R1VA 2BEWB 4YVFA 2PIDA 3DW1X 3SXPA 3U7JA 3BZBA 1E2HA 1AGYA 4EGXA 1F2UA 2OQIA 1Y48E 3ZQKA 5ADUS 1P2FA 2CDBA 4GUDA 4YP1A 1GPWB 3H9CA 5B6PA 5BSEA 4KXYA 1X7YA 4DCGA 4L5YA 2WWTA 4CMKA 2G82A 4K6GA 5FV4A 4B47A 1T8WA 4TPKA 4UFNA 3DVLA 4Y1RA 3VZDA 4E2XA 4RHFA 3RRNA 4Z53A 2M9MA 2Z43A 3OF3A 4K6FA 4UJ5A 3MJ4A 5LA6B 1KZHA 5L95A 3PRKE 4DR2B 3NC0C 2EEPA 3VPYA 1U1CA 2IYVA 4IFTA 4OD0A 3UK7A 4TXMA 5THQA 4E46A 3MMZA 1TUBA 4JVLA 3DFMA 4QPZA 4EYOA 1P7WA 1OH8A 3S5UA 3LX8A 3CRRA 2ID4A 2N42A 1ZJWA 3GEEA 3L18A 3EGVA 4YJ2F 1M6YA 3NM4A 5A1JA 2TMKA 3TD2A 4D4KA 1OCEA 2ZVJA 2OO3A 5KNCA 4DV4B 3WL8A 1QPZA 1WBBA 1KDTA 4QRDA 1JVSA 1RCUA 3BMQB 4TXLA 4QD3A 1MZVA 1BMDA 1NUUA 1WX1A 3HB4X 4Z7QB 3ZJTA 4JVSB 1VIVA 1LPAB 2ZTHA 2EKDA 4A2PA 5BV0A 1QQAA 2EG9A 3EQ8A 1E2KA 3SFTA 3X2SA 1KP9A 4RJTA 1USWA 1H2AS 1V8ZA 5TVGA 4DRYA 1Y34E 3OTWA 5DSTA 3ILSA 3RFXA 2JA2A 2L19A 2YNMA 1C1XA 3FCUB 1XCJA 3IQWA 4JYMA 3OIFA 4OX9B 4PRZA 3V4PB 1JHAA 1MFPA 3CM0A 2V9PA 3OM1A 3NBAA 3T99A 1IHXA 5JSQA 1IUNA 1VBKA 2PAAA 3IR7A 1J20A 4L75A 5SZIA 4NIMA 1OX6A 4FGUA 4CHGA 2WUEA 1X7DA 3PTZA 3SFVA 2VUUA 4ADSG 2DB3A 1RHJA 3W4JA 2EGGA 3ABQB 2FMUA 1EX1A 3BTUA 1XZGA 2FJUA 3ND6A 2B2CA 2P5YA 4GP6A 2FQXA 2VF5X 4HZUA 4IUYA 3A04A 1JSLA 1N3YA 5JOQA 3U26A 4CM4A 4Q37A 3QEKA 3K0CA 4P2BA 5F2EA 1KYIA 2PO5A 1J4OA 2QTWB 2XRMA 3I6UA 1UWKA 1EK5A 3WK8A 2J0UA 4R8MA 1OT5A 1MJHA 4NC9A 1QYXA 2Q6VA 5FA6A 8OHMA 3HYNA 4QYWA 5AW4A 1DP4A 4Q9NA 1G7RA 1ONNA 3I62A 3NV7A 3IAUA 3SNKA 4EH1A 3M1YA 4CLOB 4AG5A 4ND8A 4M1YA 1IWOA 1W36B 3A1NA 3GFGA 1GFZA 4O4HB 4R3WA 3D4IA 1OHHD 3D6NB 3NOOA 4X1IB 1XN1A 1VKOA 4C2TA 1KAGA 5HXAA 4MQBA 5MN5A 3SZUA 5IKMA 1Z7BA 2HNAA 1XE3A 5CTAA 1R0LA 2P4EA 2JIZD 3OJOA 4YJGB 3H4VA 3ORRA 4INPA 3NAGA 1UC9A 1PJAA 4N8EA 4C06A 5A06A 5DHFA 1EU1A 4Y2QA 4BPRA 4AMBA 3C45A 3KETA 1ENZA 1KO7A 1FVHA 3PD0A 2BJHA 3M8KA 4X94A 4QTZA 5DW3A 3PYXA 1TM5E 4FW9A 3SGLA 3I05A 2VPXA 4Z7OB 1IHOA 2NYAA 2G9QA 2Q3LA 3LCUA 4N0QA 1Y80A 4JJKA 3FPLA 1OVMA 4LRTB 5H9WA 4LUCA 3ZBPA 4D2IA 3LGSA 1TF7A 5EUCA 4JOBA 4QEDA 4BVEA 1BE8A 2B5WA 2YX1A 4U02A 3BZUA 5L7TA 1YL7A 4XSVA 1JNXX 1NUQA 1YR8A 4DR3B 4Z3KA 2XT9B 4UVDA 4DLLA 1QWSA 4FK8A 3VR6D 2C2YA 3D0OA 3W8NA 2YVUA 2Y0PA 4B73A 4OU4A 4FFSA 1IEQA 1LU9A 1XYGA 3PA8A 4ERXA 1GZ3A 3E1SA 4OBWA 5JJ5A 1P5JA 1Q1QA 2B20A 1MABA 4BMYA 1WTCA 3JASA 3G5UA 1Q1ZA 2QP4A 1J2EA 3V8BA 2AOVA 2RI0A 1KJ8A 3OQPA 1SKBA 3T5PA 1GNRA 3AP3A 4U63A 1PL8A 5F77A 5A4DA 4WGFA 5CD9A 1VG0B 1DB3A 4GXTA 4BP1A 2IYOA 5DH9A 3M4XA 1KFKB 1O97D 4IDFA 3WNBA 3NALA 3ZHTA 2QSUA 3JPWA 4PHTA 1H9AA 4RD6A 4YUVA 4AJKA 3ZHBA 1BDJA 3HB1A 4B9AA 3H1EA 1G20A 3H7IA 4QCJA 1DINA 3A1CA 3UPTA 4QYIB 3IP6A 4LXIA 3OLQA 3BXFA 1Q92A 4MDFA 1SUIA 1Y3HA 4BASA 1TZBA 2CLSA 1IY2A 4KK4A 5A7GA 2WABA 1LFAA 3COZA 3LCVB 4HN9A 3QPCA 4JDPA 5L3QB 1NMZA 2VPQA 4ZO7A 3KPJA 1NU6A 3ANSA 2J5KA 4D02A 1VGRA 3FHJA 3K0BA 4C07A 3AVWA 5TY0A 4GEKA 2F9LA 5E9QA 4DLYA 3S27A 2GEUA 2LKDA 1XRMA 1BQ4A 2XODA 2O3JA 3O8QA 1E1MA 3IHLA 3T06B 1XQXA 1VBFA 3OTQA 4HATA 4ZQFA 3BRQA 3RS3A 2X42A 4HNRA 4F86A 1EUCB 5JZ9A 3G59A 4OF4A 2WWIA 2V7QA 1JHQA 2Y2UA 3OIGA 4RV4A 5JR3A 3EUWA 1UBEA 1WAMA 2AQHA 2AK3A 3R9IA 3REQB 3WRYC 3X3HA 2XBUA 4CM9A 2SKEA 3U7IA 1UJXA 2IBTA 5FLKA 4YAWA 2I6FA 2WY2D 1RPTA 1V9LA 2HMUA 2ZTUA 3AUAA 1T25A 5CR9A 4YAGA 3RADC 1XTIA 2WJ3A 3ZY3A 1HPLA 1RQLA 2Q5FA 2I34A 2XZDA 3D31A 3DAGA 5HFJA 2VJMB 1DTEA 2O0HA 4KMSA 3BCUA 3U4AA 1II9A 3PD7A 4YBZA 3IILA 5CM2Z 5C8YA 5LYJB 1N2SA 1IHDA 1DZ3A 3JV7A 1ODFA 2DVMA 4BVKA 2J3DA 4F8JA 1P0FA 1IM2A 1K4YA 3MJTA 3A4MA 2WHQA 2FEWB 3PNBA 4KQWA 4UOZA 2D8AA 1W93A 1PHRA 5IAKA 5FBVB 4A6XA 2VXYA 5EWLA 3HB9A 1T2AA 4YV7A 5KNDH 3A05A 3C4JA 1ZN2A 4RGYA 5B3JA 1GIAA 1D4FA 3K35A 3N07A 5IZCC 3GFOA 3B70A 2PO7A 3HDJA 1LK0A 1ONBA 3H5TA 4TMTA 1QCYA 4CR6A 2ZITA 3OT1B 2PR7A 4LZWA 4UTZA 1A9PA 1CR2A 5A4FS 4FONA 4TVOA 3FNHA 4DKJA 3NTQA 3QPWA 5LXTA 4UNPA 1JHOA 4QUBA 4TL6A 3WMFA 2BGNA 3B13B 3QX3A 4DA9A 1W581 4EKYA 3F67A 1ISIA 5AM2A 1U65A 3S1AB 2WEKA 2WVAA 4JLPA 1OY1A 2RJNA 4REQA 3VZQA 4BWGA 4B9EA 4JI0B 2DSTA 1X8KA 1I1NA 2DPGA 3P9YA 5IT5A 2B6NA 3KAKA 1U8YA 1Z5VA 3H9BA 4KQFA 4U7WA 4BYGA 3KVNA 3LI2A 2HDNB 1PGPA 2AKYA 3KHTA 1JFLA 2DQSA 2VZEA 4U0KA 3K70C 1UFQA 1Z7YA 3ZKAA 9LDTA 3IEUA 2WF7A 1A76A 4KH1A 3R5XA 4ALKA 4HGZA 4DJEC 4RHXA 3BGWA 1EFPB 4NU6A 4KN9S 4DBLC 2F8TA 4JCCA 5ADHA 2I4TA 2P9QA 3A3NA 3IAEA 3VC3A 3VTFA 5AKGA 4XQEA 3L7BA 1JIXA 4LRSB 4QU8A 4MB6A 4QLAA 3W8FA 3H2HA 4CE6A 4CM3A 4ZOQI 3U5ZB 1J5PA 3FZYA 1E59A 2GNAA 2Q3HA 1BWPA 1IBRA 2X3YA 1D3AA 2Z9BA 2GCOB 3PIRA 3SC2A 4HOYA 4HT3B 4ML3A 1FQJA 1SXJA 5AKLA 5K0LA 1SQ0A 5I5GA 3U3RA 1E58A 2WSSD 3N0TA 4G8DA 3OEHD 1ZLXA 5DTMA 5ILQA 2OPHA 1OBVA 2Q1UA 2K4MA 2RGCA 1P3Y1 2X2PA 3B1YA 2CSXA 4EFNA 2LIPA 1RMQA 4MW2A 1M34B 2WFLB 3NIFB 4G1MB 1X2EA 2XBMA 1E8NA 3B6JA 5T4HA 1G0OA 5DBGA 1T35A 1LC0A 4LXQA 2ZSHA 1HNXB 4H0CA 3DMRA 2FP4B 3C98A 3RTCA 3CEJA 4QTYA 1ECGA 2A5JA 3I9MA 1MGOA 3CISA 4HRXA 1M2FA 3K92A 4H6XA 5LBIA 1XRJA 1OLUA 1ENYA 3A4YA 4JBHA 5HJ5A 5TEWA 1U0FA 1QS0A 3I64A 4RFLA 3WXMA 4RVFA 4TS9A 2XUGA 2QK4A 4YP6A 1ACMA 5ERXA 2CB9A 3QEOA 1CY8A 3G2OA 5ENVA 2HLDD 1KMNA 4J16A 1K8ZB 4Y0VA 4FYIA 2H5JA 4PYIA 1LXCA 2Q6KA 4B6GA 1UPFA 1THGA 4WX2B 3NYQA 4IOJA 4GPBA 2F3RA 4HEQA 4GSKA 1UBSB 1JT9A 3DEIA 4JR0A 1N1DA 1PL6A 2BI4A 2PT5A 3QOWA 4I5GA 2YWCA 2WJWA 3BFPA 3AZQA 4KXLA 1SY7A 1G38A 3KSUA 2B4QA 2P0AA 2Z3WA 2P41A 1TKBA 3KAQA 2XOKA 3R3SA 1QWTA 1C3EA 1YL5A 3CXUA 5K4AA 4YMUA 5AVOA 2SKCA 1ZIXA 3QEBZ 2ADMA 1HDGO 2BFBA 1K08A 1XA3A 3P1JA 3SXUB 1QVWA 5JYBA 2FW6A 1A1VA 1SRQA 3HJFA 5E2BA 4MQEA 3IUPA 4OJMX 3KT0A 3OZCA 4EGAA 2V4ZA 1PFGA 3COSA 1JXAA 1M9NA 3O0TA 5A5EA 4EDFA 4MRMA 1DJMA 1WZNA 2O7SA 3CHYA 3JVEA 1FTWA 3N59A 4U2FA 3S7ZA 4OHYA 1X92A 1RLMA 1TO6A 2DC1A 1K2WA 5AFSA 4MS3B 3TTTA 4ZODA 4UMVA 3GBVA 1HY3A 1A88A 2QE7D 3ETEA 5C8XA 4LF6B 3VR2A 2WSLA 3GU3A 4EVQA 4W82A 1HKUA 2OZKA 2VKQA 3W4IA 3WAKA 1EGMB 3MAAC 1BJKA 3PUVA 1QUEA 3K96A 3NUGA 3GJQA 3RUEA 1UJ6A 1G21B 3AKEA 2O1WA 2RHGB 4E2FA 1NFRA 2H7CA 3PWKA 1TADA 2HF8A 1AS3A 2J48A 3MILA 5EZ5A 1VKHA 1CQIB 4OIMA 1JG2A 1WPXA 3DCJA 3DOUA 3UGQA 2GJAA 3H5OA 4J94A 4Q93A 5E7QA 3M6FA 5EMMA 1NSYA 4P7FA 3DT9A 3IP9A 3PEWA 3T95A 5J3JA 2BLLA 4HGQA 3X0DA 2EFEB 4BNJA 2BGWA 2NW6A 5JEKA 1SURA 1H22A 2I62A 3W5DA 1Z6ZA 1DXOA 1LRJA 2HH9A 2X41A 1XT6A 1VPDA 5AVJA 1S8AA 2OBBA 3ILHA 1DIRA 4JT9A 4QT0A 1VHTA 1M6HA 1JDTA 4F9FA 5AVXA 5BVIA 3BMOB 2EATA 5G0VA 1XLUA 1XZLA 3L4EA 1CS4C 1X19A 1OILA 1Q0QA 4G41A 4G67A 4MVJA 4PIPA 4YV2A 2XZOA 3ZK8A 3M6MD 3EZ2A 1P29A 1TTQB 3ACBA 2ZSFA 3HQ4O 1ZHOA 1WQ1R 3LT5A 2HM7A 3F49S 2FEZA 5AVWA 4JDUA 1ABBA 4KITB 3LDAA 3K0SA 5LWHA 2IBMA 3A27A 3C3YA 4GBMA 3V4FA 1QU2A 2WIKA 1TYCA 4ZAWA 1YB5A 3BXPA 3PFCA 4RSHA 2XX3A 3CN7A 2A58A 2GGSA 5K09A 4M76B 4EO9A 1SVMA 4K40A 2G77B 5EESA 1PR9A 4ER6A 5CA0F 2HSJA 4QGFA 1W6RA 4DZZA 4KPFC 4CTJA 2WTNA 1M0TA 1TUIA 1Z4KA 2XYGA 4K2HA 4XWGA 2MMGA 2R8BA 4BUJA 4WCFB 1UDWA 5C4GB 1PJ2A 2B4KA 2FG5A 4W7HA 3V3TA 1FTQA 1P45A 2J9YB 5BNFA 2BKAA 5EINA 2QRMA 4Y7CA 4YRGA 5BWOA 4QYTA 4IAOA 5EOVA 3WMWA 2EF0A 2W0SA 3AV0B 1NN0A 3ZK9A 1EX7A 3NDPA 4KH0A 5I6DA 2VPWA 1R12A 4CEJB 5LUBA 1NP3A 4BO3A 4YCNA 1N6KA 1JJVA 1IB6A 2PH3A 4KAJA 4DUGA 3GMTA 4PSKA 3C3BA 2JLVA 3MJFA 1L1EA 3EZNA 2NGRA 2ZCVA 3OFKA 5IBQA 1DO0A 2HCFA 3NHKA 1V2GA 5KVAA 2M6KA 2FRDA 3G0OA 2IDJA 5IJAA 4BV9A 4JB0A 2VZLA 4IDOA 2B8NA 4DANA 2NADA 1EWRA 4Y6OA 1BGWA 1LGYA 2AHOA 2QI9C 1KFEB 3IA2A 3PE3A 5H81A 1Y8ZA 4LF4B 4D4IA 4JMLA 4NZ9A 5C1DA 1F06A 3A9UA 2OD2A 2GHQA 2QNIA 3V4OA 3HU3A 2DF8A 1OFGA 4MV0A 3A0UA 2OYCA 4ZQCB 3SZGA 3TNJA 1TCUA 4RGBA 1UPAA 3QKRB 3E9QA 2IT1A 1UJ2A 4J90A 4N40A 1TT5A 1F6DA 4RL4A 5FNVB 4KWCA 4YXFA 1ITZA 4KL8S 1EJ6A 1OAAA 2D0DA 1Q15A 2O8VA 1JQ5A 2NV0A 3JZAA 4ZANA 1JKMA 1VHDA 2FN7A 3TW8B 2AQKA 4U1RA 4A8HA 3K0KA 4BMVA 1ORTA 2HO5A 5FADA 4HVLA 3DC2A 3NWPA 1HZJA 4MRPA 5I4IA 3N8IA 3HU2A 1TZKA 4Q15A 3O8RA 1IXZA 1DAEA 4RLHA 3DM5A 4FUQA 1T8RA 5FUBA 2DULA 3FI9A 3TKLA 3A8TA 1NA5A 2PMDA 3CBQA 2G3YA 3WQRA 1J1ZA 2VEOA 2QN7A 1NBME 4WN9A 3UKJA 1R8JA 3JYHA 4HMPA 1RJDA 2IZ0A 2YXNA 1UKCA 4ZVQA 3TX2A 2XVYA 1CEEA 1WDKA 1NLFA 4LWQA 3LLSA 4WXHA 1TIKA 3IPXA 3O75A 2DETA 3FDZA 2I9KA 5AW1A 1WULS 4TKUB 1QFSA 3ET4A 4DJAA 1E79D 1CYEA 3MUNA 3PNYA 1U7UA 3P9SA 3ELYA 1QHHB 4CDRA 3I23A 5JFTA 4ZI5A 2G9RA 1ZWLA 2R5FA 1PTJA 5ALTA 3EIWA 5EXPA 3RE1A 1JQKA 1L5WA 1LRLA 1BN7A 3OQOA 3Q7EA 2O3RA 1UHTA 3L6DA 3SC6A 3MTIA 2O4CA 4HDKB 4ZGWA 3D3EA 3ESYA 1R0CA 4G2NA 1GARA 3ROEA 5BUQA 5JV5A 1TZ2A 2HJVA 1KI2A 3TFWA 5KQPA 3HYTA 5H3LA 4RELA 1C7ZA 4BPBA 4KXMA 4PXYA 5YASA 4FZJA 1Y82A 2J6HA 2IVZA 3Q7SA 3MWKA 4ZHQF 2GFIA 1EIZA 1VJDA 1BFKA 1JVNA 2EKLA 3FUWA 3A70A 4JVMA 3I72A 5K1ZA 2E6UX 5CCDA 4AECA 4OI1A 1QRUA 2O9JA 4EI2A 4MI9A 5A1TA 3ZXYA 1T1JA 3ETNA 2J9FB 4D0LB 2V97A 4Q34A 1OWOA 1NURA 4RTLA 1OFVA 4CQMD 3J7AC 2BI7A 1J2TA 1GPYA 1QZZA 3EQ2A 4PAWA 4BQOA 2IEIA 3PR2B 4I3FA 4ESOA 1G8MA 3VHRA 3P2YA 1M0WA 3PDJA 4YQYA 4EQ6A 4JKIA 3MEQA 4JOQA 2IXEA 4XAQA 1JIJA 3K3PA 5I9SA 5KX5F 1BW9B 1BMFA 1JKJB 2Z8YM 1R66A 2MTBA 3TE6A 3UZUA 4QKQA 4E6PA 4JUBA 3UAXA 4PN3A 1AH2A 3CPHA 1T1SA 3DO5A 2BTOA 3R3UA 2GPSA 1F8YA 4WNAA 5EMHA 2XD9A 4JLAA 4N9QA 4E5KA 1B6GA 4RQTA 5A4IS 4JP2A 3P2MA 3D3NA 5NLLA 3Q0TA 5L3SA 1P18A 1IC6A 1S7GA 1R4MB 3OQHA 3LW7A 4ZJUA 3DUFB 4C7XA 3TLJA 2GASA 1E6UA 3KFXA 5CIQA 5H02A 2G1PA 4K9NA 1ZH0A 2FGJA 3KJEA 4LC1A 2QAJA 3JW8A 4EMBA 1LC3A 4TT3A 2IPMA 1YRHA 1R0SA 1C4KA 3V48A 1Z0UA 5JECA 1NIPA 3DEKA 4HQLA 4JY7A 3AWIA 4K87A 4LEIA 5JELA 3S2IA 4AS3A 1V7ZA 2ECOA 2UZ1A 1QO7A 1RLIA 3N75A 4LK2A 2W71A 4X24A 3EZ9A 2A0YA 4D8UA 1CQJB 4OH7A 3DEAA 3N0WA 1HQCA 4U9UA 3LWBA 4JT8A 4DEYA 1C4OA 2D06A 2QTFA 3Q10A 3VU1A 1OX5A 4DF3A 2WT4A 2HADA 4FYJA 4U9HS 2Z5VA 3TLAA 5IHXA 5KS2A 1QDLB 4R3UC 5DGIA 1E1RA 4D3FA 1T6NA 4JI8B 1GFIA 2EW1A 3LS2A 2I1LA 3JWEA 2I33A 3W4KA 4HSEA 2JJQA 2H0AA 4QUIA 3SPXA 2MYTA 3Q1LA 3VSEA 4OEHA 1JALA 1VB5A 1JU4A 3OO0A 1GTRA 2NT4A 5CB4A 5EIBD 1HRDA 1KL7A 1JTEA 4OY3A 5EJ2A 4EY6A 1Z18A 3AUSA 2WAMA 2A5FA 4HAZA 2HDWA 3DMFA 5HOQA 2VJNA 1GG2A 4FMCF 4I1VA 3RYIA 5IKXA 4MPTA 4Q4AA 4AS1A 1WLYA 5FV7A 2Q5EA 4GMGA 5KOHB 4B76A 1O4VA 3B1XA 5ALKA 3RUFA 2BEWA 4L72A 2Q1SA 2OMEA 2B4AA 4P38A 2WOJA 1DC7A 3F0TA 1NN3A 1IAQA 2P5UA 2YZMA 3LZDA 5EE3A 1HT0A 2OGWA 4B5KA 4C4PA 2VH5R 3TZKA 1NVUQ 4I81A 1P1JA 2WWXA 1NJGA 2RHJA 3KJIA 4IR7A 2B83A 4X93A 1G7CA 1HYHA 2J31A 1Y9JA 3P0EA 2GSWA 5LA6A 1VB3A 3ZTTA 4TTPA 2VFAA 4P82A 5H16A 3L0ZA 1NUPA 2HT1A 3YASA 5CXXA 2L2QA 3A6DA 1R8YA 2V7TA 3MCTA 4UCWA 1N6PA 4YPFA 2NZJA 2RIPA 4E2YA 4ZVLA 5TB5A 1D04A 1A4UA 4I8XA 3FROA 4NBKA 1LK5A 3E81A 1CP2A 2FSFA 5B2EA 4I36A 2BH9A 1IL0A 3UW3A 3LP8A 2X5JO 1RRPA 2HA6A 3BMQA 1PR1A 1Z37A 3C8ZA 4RD0A 1ZITA 4PAMA 2J0EA 3FHOA 4JNCA 4WZAB 1CF2O 2ECPA 3IBSA 1E18A 3DLBA 3N2LA 2IYTA 2X76A 3LVQE 5BSVA 3T3NA 4DBVO 2IOQA 3JSAA 5A2GA 4Q05A 5FAXA 1YDWA 3OOWA 5B7GA 3N3BC 4BX8A 3HO1A 2IZ5A 3T9BA 4LGYA 2XUJA 2YVKA 2VPIA 4FDVA 1WMDA 3ZWOA 1JLLB 1UBTS 2C4TA 3GGSA 3GT4A 3FOFC 3THSA 1I10A 3BGSA 3LOUA 1A5SB 1OBFO 4O33A 3I1FA 2ZIEA 4Q39A 3K0HA 3R8XA 1H5QA 4L3WA 5HZGA 4Y9SA 1MN6A 2EFHB 2NMVA 1RSZA 3GLSA 3WISA 1N2BA 1M2OB 4M0LA 2IRWA 3SJUA 3HGTA 4B4VA 1SD2A 5EA2A 2ZT8A 3NCTA 1L2TA 2QNRA 4LCJA 3FKQA 1F8UA 2R7MA 3GEMA 2P3LA 3KOWA 3MA0A 3P8ZA 4N82A 4W6ZA 5CW2A 4KO4S 3S2FA 421PA 3JZFA 3OT4A 1ISGA 4FR5A 1J0XO 4ZCIA 1WUTA 4HPXB 1J0AA 5P8WA 4WOKA 2PZEA 4IZIA 2AVNA 3GP5A 1YCHA 2AOXA 1TK9A 4NFLA 4CLOA 4ZDJA 5JNSA 4EGFA 4Q5IA 5ECGC 3SQOA 3QELB 1O6CA 3JVVA 3QKTA 4XIIA 1YAHA 2E21A 4O4HA 1J1IA 4X1IA 2Z9CA 4EHFA 2QP9X 3CNBA 4O4IB 1ZD2P 3IE0A 4RDCA 2K2WA 4CTNA 2PGJA 2YUTA 3IPRA 4UQOA 4ACAA 2Q9CA 4LQCA 2XMZA 4F9GA 4HC4A 5EIOA 4ZYZA 4NWIA 1W4CA 4FW8A 4NG4A 4YJGA 1YKGA 4V0KA 2PL3A 3OUZA 3PGXA 4B2IA 1QF9A 2QEQA 5JAHA 1V0JA 3F3KA 2VL7A 2ZK7A 2CFCA 4JKOA 3EQ7A 4W5RA 3ERCA 4N5IX 4XQCA 4P1ZA 4F4HA 4MWBA 5ARCA 4DMLA 1NW5A 3G7SA 2R6JA 5FJIA 1WXXA 3V8MA 3ELDA 3MJRA 2I67A 4P35A 4EHLA 2QW8A 5G40A 2X0DA 4FFWA 4KQJA 5JI2E 1C8KA 3AI7A 4KAXA 2IHVA 2YH2A 1KVRA 4JJEA 3K1TA 4MPDA 4B83A 5E8RA 1HDEA 2XT9A 5A02A 1A2OA 4S04A 1MO3A 4J3JA 3HUEA 2V5VA 2R9VA 4HQRA 3ANNA 1S7CA 3T54A 1L6IA 4J9VA 3A7EA 1E2NA 4ZMRA 4GGMX 4H59A 1X7ZB 3GA0A 1ODTC 1Z0IA 3AZPA 3TIXB 821PA 4MDHA 2RHLA 3FIJA 5JT1A 1AJEA 2XAAA 2VR1A 2O59A 1AURA 2P67A 4RFSA 5L51A 3MJHA 1IFXA 3Q3HA 3GZ4A 2IPNA 4D41A 4XFKA 1X1EA 2IDZA 2BELA 2TRSB 1E94E 3Q4GA 4XSHA 4FS8A 3UJPA 1U2GC 1SKYB 1OXBB 4XCQA 3JQBC 5BN5B 5TT0A 4BRWA 1U7PA 3U4DA 4CJXA 2C5LA 2UUCB 3PFFA 3SWWA 1YI0A 3DMPA 3O3CA 2AMFA 4LX8A 2WWFA 2YWRA 5KYXB 1MHPA 1YKSA 4QYIA 2C2XA 4Z9AA 2Q3CA 1K7FB 2YHAA 5FL7A 2R5WA 3TM5A 2BFMA 4C0JA 5L3QA 4EDHA 1PK9A 3PRJA 2WBLC 5B1IA 3QUCA 1BSVA 4DDHA 2PVPA 1H8HD 4YO7A 3HDHA 5JFGA 4Y1EA 4DCOA 2B92A 1T8SA 3GBSA 3JR7A 1FCJA 4GNKA 1BEZA 5FO0A 3R7BA 2OHHA 3QLVA 4AK9A 1RZ3A 1TYBE 1QC5B 2F4NA 4AJ2A 1EUCA 4EECA 2WJJA 2X7XA 1XNHA 2XAUA 3OFVA 4ILEA 4V1CI 4QSMA 5I9NA 4U5XA 3OZTA 4CVNA 1YBFA 5EZYB 4LCBA 3EG5A 1OUMA 2PSSA 1JPNA 2ZGVA 1KSGA 1O8BA 4HUQB 3REQA 1R0KA 3PFIA 5KKCA 5I7RA 1N2CB 1L7VC 1EVQA 3NOQA 1PP4A 1VE1A 4Q6BA 1U2RA 5JAMA 1PFQA 2ZIAA 4Q9AA 1ISFA 5EXXA 4FX2A 1IWPB 1OPRA 2AFFA 4O1HA 4V2IA 6AT1A 2DKFA 3MAGA 2VRWA 5JZVA 1V8OA 5A8IA 2RHWA 1OZAA 2Y0DA 1P2UA 3DLIA 3IMCA 1Z0KA 2VJMA 3NIBA 2WWVD 4GLLA 4A6DA 1CNMA 2HI0A 2W90A 2IQIA 5EIFA 2VAXA 2GWRA 5LYJA 2WVJA 4QWMA 2WAAA 4B6EA 4M1WA 3JWPA 1UOEA 1USGA 3T7JA 1NHWA 1NNUA 3MTDA 4LYJA 1MA3A 3RVBA 3ZHVA 4YHBA 4V0QA 5ICEA 2K7FA 2B8TA 3I2YX 5I9LA 1GLNA 3FW1A 4JIWD 1M2HA 2IW1A 2GF2A 1NULA 3BIFA 4F9EA 1D4AA 3OT1A 1M7BA 3AHFA 2PKRA 5C3UA 4TLDA 1KJYA 4IG9A 2VJQA 3KKPA 1V4VA 2CLEB 2ZTVA 3FDJA 1NW8A 4KZKA 3UC5A 1Y1KE 3EZ6A 1MV5A 4BJHB 4M36A 1G6KA 5EMNA 3S1AA 5KTSA 3LDFA 4OI0A 3GN2A 4OQNA 1PG2A 1IHUA 3UMRA 4X00A 4C7JA 1TIBA 2WTAA 3GRAA 1A4RA 2HIAA 4A1OA 4FYXA 4Z4EA 1Y4AE 3BSYA 4BFSA 2GKOA 5HUQA 1WXHA 2IK8A 3RSOA 1XZNA 5KQSA 3BIWA 1NKVA 1XLVA 4QE3A 1CY0A 3TW0A 3QNWA 4L6CA 3PNQA 1XNQB 4GI1A 3BB3A 2ZXFA 1KMMA 3FLBA 3G2QA 3RG8A 1PR3A 1JSZA 2C2KA 3E03A 4HWKA 4KXUA 3UANA 3LV8A 2ZBQA 1EFPA 4ZDIA 3OCJA 3AF0A 3QPBA 4EUKA 4LZZA 1F51E 3WDLA 1J0EA 3GVCA 1OU4A 3O1HB 2AI1A 1GG8A 1NXOA 1Q0PA 5CXUA 1G3UA 2MMCA 1O9BA 4MINA 4IWYA 4UHCA 5BR8B 5JRDS 2ZT5A 4GO1A 1GDHA 3K5WA 4BLRA 5J2UB 1Q21A 2BDUA 2GCOA 2IU0A 1EMDA 3HKCB 1SD5A 1ECPA 4J1NA 1ZR2A 1E6CA 4PCLA 3WZLA 2BLNA 1ZSNA 2BHNA 2JBAB 2OHJA 4G5GA 3F5FA 1A9OA 1AVTA 1M34A 1P1RA 2WFLA 3EN0A 3G8AA 1K98A 1WDLA 2Z98A 4J75A 3KR1A 1SZCA 4V0NA 4Y0NA 1G8HA 2IEBA 4LDPA 4GLFA 3V4ZA 3BHJA 4PICA 4MICA 2OORC 2A7XA 3B3JA 2IL1A 4NFHA 2FP4A 3JVDA 1Z15A 3WHKA 1NG9A 2HQBA 1SBNE 5IASA 2MSKA 4QBKA 2HQ1A 2RI6A 2YTZA 1VG1A 1AD2A 1SCBA 1HTBA 3BXXA 3L0SA 5K6AC 2X23A 1IM8A 3UOGA 5GP1A 3N28A 4IHQA 5HMLA 4DQ0A 4RPIA 2VJBA 3RW9A 4ZYLA 2A2ZA 3V80A 2IEAA 1UXOA 1NVAA 4FOOA 4AY3A 4J43A 5J23A 3NT2A 1I2AA 3WMGA 1UZNA 3F90A 3C1OA 5I5EA 1SR8A 4I0WB 4ESHA 3AF4A 4A16A 3B1FA 3I28A 1EGQA 1N6IA 4QHYA 1QJCA 4MKIA 5HIAA 3DJFA 1RRKA 2HHHB 3VA4A 2I78A 4F56A 2PUDA 3GLIE 2JBWA 3VOBA 8ADHA 2HF9A 3FH0A 1GN8A 4G1VA 4LY6A 4P3PA 5AXAA 5GM1A 4P6VF 1ENPA 3NQ41 3OT5A 4Y2GA 2CLDX 1AKNA 4HB4A 3KZCA 3SXUA 3L49A 1XNRB 2A35A 3RG2A 2QN2A 3E0XA 2PT9A 1SQ5A 3DOHA 4TOIA 4FBMA 4BGEA 1B4DA 1DXYA 3PXDA 4NE7A 1RJGA 2HA3A 4FYPA 1DEKA 2BCEA 3SF0A 3T5AA 3B6MA 5EVJA 1V41E 3G0DA 4PG5A 3FD8A 4B3HA 4H4EA 5FOXA 4PZPA 2O5VA 2YW9A 4LDZA 2RJOA 4ENSA 4X54A 4BFTA 2IQ5A 4F71A 2P3OA 3FJ1A 1FFXB 2XY4A 1L4MA 3HA5A 1U3TA 3CZQA 1NOIA 4CW7A 2HLHA 4ZXPA 2O19A 3HBJA 4XUGB 5JCXA 4MS3A 4O59O 3V55A 4KSYA 1FFGA 4A7PA 3IT0A 4W5TA 2MSLA 4J0JA 2EGHA 2XLBA 2JLWA 3CF0A 4QQFA 2R0QC 2XE7A 2GEKA 4Y3UA 1EINA 4WLUA 3AYXB 1G21A 5E3IA 1OGJA 3CUTA 5DNVA 3DWIA 4QHTA 3OHSX 2QENA 3S4YA 4C4TA 3UBMA 4UXHA 2W6MA 3CLRC 1CQIA 3L93A 3VHQA 2HK6A 3CGGA 2FWRA 3HU5A 2VQSA 2VCYA 3V7YA 4R6XA 5DGCA 2EWVA 5L4SA 1E4YA 4JBYA 1CFZA 2IIQA 2OCLA 3QY9A 4PRYA 4WADA 2COKA 2CL5A 1T2EA 2I29A 3V9PA 5L53A 1EM8B 4C88A 1Z45A 4XI9A 2V7BA 3SS8A 5TX7A 3H5RA 4YRZA 2AB0A 3CS3A 3CZ5A 2BZGA 4RLQA 1WDTA 1PKEA 3HI4A 4XCVA 2OKGA 5KDDA 3B20A 3EXG2 1KBQA 2M6SA 1O95A 3GLHE 2WP0A 1UODA 2QZ4A 3AEYA 4I46A 3WGMA 4EFKA 3TJMA 2MSWA 3TJZA 1Y1RA 3R44A 3G6WA 4IIYA 3BMOA 2EX0A 2YMQA 3S81A 3K8YA 1BNCA 4KO3S 3TF5A 4RA9B 3B9PA 3GRVA 1EAYA 2GTHA 3KLBA 1RQ2A 3U3KA 2FZ4A 4G5HA 3RFUA 4E22A 1H2HA 1XVAA 1VP3A 4MIEA 4PNHA 3V8NA 1VL5A 2IYWA 2GT1A 1GL6A 1KI4A 1LPOA 3TR0A 4DLWA 1MIOB 2BBTA 1XU7A 2F1OA 4LVNA 3NV9A 4R1TA 4X9XA 3DXYA 4EGJA 1F38A 2R5NA 2RGNC 3SHOA 3TTUA 2ZPAA 4NFSA 4BNTA 2QW1A 2ID7A 2X7JA 3DKRA 4RF3A 5EGNA 1XCGB 1DIBA 4MJ7A 4W7SA 3SEFA 3SIRA 3T1OA 1VRVA 1AQ6A 1VSTA 2Y1LA 4Q9JA 4NHOA 5AJTA 5IEJA 1N5DA 3N76A 3EDYA 1CEQA 2J7PD 2JDIA 1TJ5A 4QXMA 2GN0A 4WCFA 1J2UA 1PJBA 4PZ9A 4RFVA 3LY5A 3IVMA 1OA0A 2IEYA 2K5UA 5REQB 3KL2A 6PFKA 4ZC1A 4CMJA 2BZ0A 1MD9A 2G6BA 3KKQA 1DO8A 4O2RA 5I7WA 4PFKA 2F1IA 3MBKA 3P52A 2PCLA 2WINI 4FWBA 4JLSA 1DAGA 3HN6A 1G41A 3HUDA 5B3LA 4ZZ3A 3DLAA 4BGVA 3WNVA 5AW7A 3KKOA 1I4DD 1SXGA 4A0GA 3FIUA 3K53A 2LGJA 1L3IA 4M8KA 4QOGA 5C35A 2ZATA 1I1OA 1XL1A 4H4CA 3WMEA 4PYQA 2RFLA 3EIUA 1XRNA 1GQQA 3KJZA 4RHCA 4UBJA 4ENVA 5K3OA 3TIIA 2J0SA 4IDNA 3D8HA 3EQZA 3A77A 2QBYA 3GELA 2HCTA 1M2VB 4D44A 3HRHA 3UMSA 3CH7A 3FYSA 3GV0A 2OZLB 1J9EA 3DCYA 2QAGB 4NCHA 5BNWA 4MPRA 4CBVA 2ZSKA 4DUYB 2VATA 3KQHA 2QUIA 2EFDB 4X6XA 2HYDA 3QKRA 4LRUA 2V3WA 1DO2A 3BE5A 4E5UA 2C7RA 5LLSA 4M83A 2J0VA 1MEEA 4GI2A 1YUNA 3AETB 3B3GA 1MB3A 3VHXB 3ICEA 3QQ5A 5BO5A 1PNOA 3TW8A 2GAOA 1MP0A 1Z4QA 1A9QA 3P7MA 3PJGA 3PEFA 2H1HA 5CG1A 4YASA 2C03A 1IXYA 4YP9A 2EZ9A 3HO8A 4X6YA 1G59A 5E1DA 1YHNA 4MAFA 2C2BA 3ZIAD 4GKJB 3OJXA 5HX7A 2IUSA 2OCGA 2JFPA 3GB9A 2P3QA 3HYLA 4N4AA 2QJWA 5HEKA 3I1JA 4MZXA 2BGGA 1NWHA 3MF4A 4FFLA 3A14A 3DNFA 1YFKA 5DOVA 3UJ7A 4BDSA 4IPTA 4TKUA 5JDIC 5ALHA 5F5XA 4K9PA 5JO0A 2FR8A 4EW2A 1JILA 1FZQA 3ELSA 1QHGA 3LX6A 5DNEA 3HFRA 1QHHA 2GZ1A 5LQCA 1M1XB 4R8SA 3H1TA 4CQLA 5I8WA 5B1YA 4CT5A 1N5OX 1C3XA 1Q19A 5E6SB 4ZICA 1V9CA 1MXHA 3AI3A 4KVAA 1IDN1 2PLRA 5E6RB 1WM1A 2GXSA 1EVEA 1X8XA 2C2WA 2ZRCA 3D64A 4HDKA 3IMGA 3A3OA 2PEZA 4IS2A 4X3OA 2GBGA 1A72A 4GOMD 4Z3DA 1XVIA 1QP8A 4IJUA 4DKXA 4B3TB 4J7UA 1W1UA 2RHMA 3IELA 3AKDA 5DJ5A 5IZ4A 4IW3B 1E4OA 2VRNA 2Q2NA 3GDHA 1Y6GA 1E3MA 3R5SA 4JGGA 1T0JB 4ALJA 4FFPA 3RAFC 3T41A 3ACDA 4MUKA 4CV1A 4MARA 4CMBA 3C15C 1XRSB 2J9FA 2FE1A 3W1VA 1WSAA 3A1TA 2C9ZA 3CF2A 4JMPA 3HRIA 2OB1A 5D3QA 4ZVNA 4ZVRA 4B1FA 5BN4B 1K2VN 1QR2A 1VSBA 3OCCA 4QXQA 2JIZA 2L17A 2XOEA 3LKVA 3O8OB 4R1UA 2GK4A 2A78A 3WB9A 1LPPA 2AK2A 5IBRA 2I6TA 3GD5A 3UXEA 1B16A 3WL4A 3AUYA 1ORIA 4RADA 3EIEA 4ISCA 1Z2OX 4Q3DA 3LQYA 3L7JA 1BW9A 3LFTA 3S8MA 1JKJA 5JBQA 1M67A 4Z99A 4EVRA 3K9QO 1N1EA 4LZNA 2NU7B 1X38A 3MGBA 1N0VC 5DYGA 2W00A 4L4YA 4CM1A 3D8SA 2OA0A 2Q4TA 1RWQA 2YASA 4RETA 4HXEB 3OESA 2HJ9A 3CPEA 4GE0A 4Y6PA 4DLNA 5I3ZA 3WAGA 4URHA 4YAUA 1Z88A 2XJ4A 3DE6X