5DHQA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 64
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhqA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhqA01
5EJHA 4WERA 3V8QA 2I2CA 5DHUA 5DHRA 1U0TA 2I2AA 3V8MA 4HAOA 3S40A 2QVLA 2I29A 3V8RA 4V24A 5DHSA 3V80A 2I2BA 3PFNA 1Z0ZA 5EJFA 5EJIA 3V7YA 2AN1A 1SUWA 4DY6A 1YT5A 1U0RA 2P1RA 2JGRA 2I2DA 3V8PA 3VZDA 1Z0UA 3V8NA 5DHTA 3V7UA 2BONA 1Y3IA 5DHQA 1Z0SA 3V7WA 2I2FA 2Q5FA 4L02A 3VZCA 2QV7A 5EJGA 1Y3HA 3AFOA 3VZBA 4WRRA 3T5PA 2I1WA 5DHPA
chains in the Genus database with same CATH superfamily
1UC9A 3M6FA 1Q50A 3W6PA 1GEEA 4N0DA 4C5AA 2AR0A 2OPHA 2VP9A 5DTJA 2VHZA 4U7GA 3FTNA 5J2UF 1KKLA 1WDWB 1M5UA 2HQOA 4DIMA 3A6PC 1ZWKA 1LPNA 2NSYA 1YR9A 1XNQB 2LV8A 16PKA 4AZ3B 4M22A 1AOXA 1CKEA 4IRXA 5L3QB 1FDUA 2ZGVA 3V1LA 2OL4A 1SB8A 3ZCXA 2ZPUA 2LKCA 4DTIA 4JASB 4B6GA 4ERXA 5C8VA 1PFKA 2RKBA 1QP0A 2QRMA 1OKKD 1LLUA 2J0QA 4CV1A 4K9NA 3NWOA 2Z6AA 3MJTA 3AHIA 5CX1B 4LDRA 3VPAA 1UIMA 3VYTB 5TARA 4YAEA 1HF3A 1RM5A 1FZQA 1MC5A 1T0HB 3R5KA 1GEGA 2ZSUA 3WLOA 4C04A 4LPSA 5B36A 5J4YA 1SHKA 1KY3A 1UBNA 2G5CA 5K03A 5IKXA 1GTJ1 4U2GA 4P0PB 4WSOA 5B2FA 5ENDA 5LZ8A 3NOVA 4Q3OA 3HN2A 1FMCA 2X9QA 2F4VB 2J09A 5HZHA 4KR7A 3AHCA 3T7RA 4P1ZA 3ZZMA 2GO7A 2HT1A 1VECA 3KTFA 5CXUA 2PN1A 3LHIA 1NTOA 2GJKA 2FUKA 4RSGA 4MHSA 3TLGA 2IF0A 3JQ7B 4KYVA 5JPDA 2A3NA 2J45A 4DB2A 2JLBA 1Y82A 2FQXA 4HDKA 3BULA 4R01A 2O2ZA 4TYQA 1CUDA 5JS2A 4RZXA 5BVGA 1G21B 1UK9A 4LK3A 1UANA 2XNSA 3RTBA 5A2QA 1SU7A 1KAOA 3ESBA 1AM4D 1WD5A 4XASA 2HMYB 1IB0A 2H06A 4IZOA 4TWAA 1OZ0A 5B1SA 5DCUA 1J24A 1S3SA 2XXJA 3LSYA 3QX9A 5JEDA 1LBTA 1IHDA 2ID8A 2PZJA 4BLTA 2B5OA 1WBJB 1GPUA 2XUFA 4GM0A 1ZUIA 3FVTA 4PGAA 5P8WA 1YRWA 4YR9A 1J4AA 2CY0A 2NVUA 4HJRA 2JFWA 1W96A 1A1VA 2G4CA 3FDIA 3RU7A 1DAPA 1ZA2A 4B3HA 4Z0TA 1ADBA 1U7ZA 2WOJA 2GEUA 4BRSA 1NMSA 4K9SA 3QELB 5DNEA 4F12A 2OAQ1 3MOGA 4RAOA 5I4CA 3U60B 3VJKA 4C78A 2UXDB 3JD4A 2C82A 2NX2A 2HV8A 3IPLA 4EPYA 2NZYA 1M2NA 4J90A 1KZ7B 5CA0A 3BWYA 4B87A 4B8ZA 1DIAA 3P0FA 1FTWA 3IUMA 3SN6A 1UAAA 5L95A 3NETA 1AUPA 1DAGA 1BQ4A 4FDMA 5LQRA 4DR6B 2AE1A 3ZG6A 3TJRA 4YWHA 3HCFA 4BVKA 3BD9A 1SZJG 3T0FA 4KK3A 1K0FA 1QQTA 1RAGA 5ESXA 5EXPA 5HA5A 3B9RA 2ZRJA 2CL7X 1UFOA 3BXZA 1R12A 2P9CA 4R3UC 3EWNA 2PQ2A 3NORA 3D7NA 1YKSA 3ZCSA 3DUWA 2X40A 2XWSA 3KM0A 3K5WA 1XZGA 3IUQA 2DPMA 4YP5A 3RVQA 1HKHA 3H16A 1ARZA 3D3JA 1U28C 4AKGA 3NMUF 5CDYA 2JLYA 2P67A 1W581 4OJQA 4X61A 4R3WA 4DSAA 4BX3A 1YHZA 3NFRA 2XTAA 4PPYA 2R84A 1T25A 1SUSA 5JYBA 5LL6P 4ZO9A 4ENSA 5ARBA 2QPTA 2CUTA 4PZDA 2AHOA 5AHKA 4DCNA 5K0GA 2GHTA 3TAUA 5BOSB 4HOYA 2B1IA 2HPHA 1JSZA 3EGWA 2CWWA 2CXNA 3M2TA 2PSHA 4ALKA 2OZLA 1G20A 3TAXA 5JADA 1TUGA 2A88A 3EZ6A 1IBMB 2J3LA 1B41A 2V9CA 3HJCA 4CM9D 3VMMA 2R86A 4R2WA 1XTPA 2EYUA 2JFGA 2IEIA 3QXJA 4FHCA 1V4VA 4A16A 4GX2A 3FHOA 1BHJA 1OV6A 2J3JA 5I8WA 3OTOB 2BJWA 1V6CA 2C9CA 3S3TA 1U2TA 1QTQA 3WL6A 3E22B 1K8YB 1NUTA 3RHZA 1AF4A 2YJ3A 1QVVA 1E0JA 2OD7A 3AF2A 3JASA 4TTPA 3BDIA 4IGIA 5EIOA 1WE2A 1FJXA 1K1EA 4W1PA 4BV8A 3LCVB 1BNCA 2ZT5A 4PLCA 5EKXA 2WT8A 3ZNQA 2DAPA 2YYZA 4KQXA 4PGHA 3FOEC 4LF4B 2YRWA 3S1SA 1NVBA 4Q24A 3E9YA 5B3JA 2FF4A 3BAFA 3SC3A 3ANSA 1I1NA 1G41A 3HG7A 4TWRA 2PUEA 5KVAA 2HJWA 2XPCA 2W2LD 4CT5A 2UYHA 2VO1A 4HEHA 4OOFA 4RQUA 2GXQA 4XOUA 4UZFA 1OSNA 4LX8A 1JDUA 1VCIA 1L4FA 5IUJC 2FGKA 4C14A 1YS4A 1JI0A 1GAWA 5D8DA 4ZT7A 5JMTA 4G8DA 1YB7A 1ZU5A 3RIYA 1G9TA 1L3IA 1Z2CA 1SXGA 4J49A 1MKYA 4TZ6A 3UJ6A 5B3LA 2BKVA 4TYYA 1FCJA 3VZBA 2YV4A 3DAOA 5BMVF 3PEWA 2C94A 1M2GA 2WTUA 3GCGA 2B94A 1CG6A 4DJDC 4I1RA 1V95A 5AI8A 3RRXA 3AI3A 1SQSA 1UT5A 5INTA 4F8JA 3EGEA 5TT0A 1HSZA 4RZHA 2WYUA 3DMTC 1UK6A 4JL5A 3KPYA 1QX3A 4MA0A 4R1MA 1UP4A 1T2CA 4TN5A 2PVCA 3RUHA 2VQ3A 3ODPA 1JHOA 2CL6X 3PEUA 2O4UX 2RGXA 3P9PA 1AKVA 2W2TA 5T3YA 3C87A 5LKAA 1QH8A 4AUEA 3THYA 1CUWA 4PHFA 3P5BA 1AHPA 2X1HA 4F4CA 3T94A 4QYWA 1ZMTA 1TMYA 2FEWB 3ILXA 3SGLA 4DHWA 5BNZA 1XZ8A 721PA 5AW2A 3T5AA 3RSZA 1YZVA 3MGGA 3O2JA 4GX1A 4ZQCB 3VR1A 1UZMA 2KMLA 3HQ4O 2V97A 4WFKA 2ZREA 5D6OA 4JHLA 1T34A 2H8KA 2I87A 2ADOA 2ZJOA 1YRQA 3EQ8A 3E8MA 4KR6A 2O5VA 4BKRA 5IDQA 1XJWA 5MFZA 4RBNA 4ZDIA 1H1TA 2J7PD 4BO9A 1PJZA 1E61A 3TSAA 1H8ED 1XP5A 1KK2A 2I4RA 3OZFA 6REQB 5KSZA 4ZEWA 1TK3A 3N76A 1GJRA 4LIPD 2OCGA 1OBHA 1FFHA 5DNVA 5TPWA 1RYBA 1A98A 1XLTA 1M66A 1Y9JA 5ILGA 1T35A 1W4CA 4LBZA 3SJZA 1IDOA 3GA5A 4PR3A 4W9MC 3OY2A 4GYYA 5SZKB 4ALIA 4L15A 1F8GA 4UOZA 1RKUA 1GN8A 3EJWA 1GLVA 1FJGB 5A6VA 1US8B 3KQMA 4F4UA 2YJGA 5AKXA 3EEQA 2XVMA 4RQTA 2PGJA 5B2ZA 3O91A 1YR1A 3BJRA 3E9RA 1UKYA 3GZTB 1J99A 4R8VA 5AI9A 2CFIA 1GUDA 2Y2VA 4BLRA 4I4IA 2YXEA 1RXIA 3AOEC 3QFSA 1C41A 1ZK0A 2BMFA 3FPBA 4YACA 3E7WA 2JH9A 1T10A 4GWLA 4R9RA 4LDJA 3H4IA 3D6HA 3FPJA 3PRYA 4BNXA 1P2DA 3B53X 4CLRB 1N2SA 2I4OA 1LC3A 1MJ5A 2RARA 4OGWA 4M8IA 4XWYA 3NDPA 2FDXA 5BR4A 4MWGA 4ZA2A 4DADA 1NNI1 2MSCB 5LBUA 3UHAA 5DM60 3LUJA 2Z8YM 2FPGA 3UWPA 2QRJA 2Z09A 3DVQX 2XUKA 4TV8B 1CUGA 4W82A 3TXYA 1IZZA 4YREA 4YBRA 5KNCH 3JWPA 3L7IA 2P8SA 4MGZR 4B4DA 2GCOB 1S96A 4QEDA 3QUTA 1ZUNB 3EQZA 5HEKA 4CLEA 4OHOA 5LD2B 1EGVB 1MV5A 1RVV1 3HB7A 3QXSA 3EE6A 4AS3A 1SVLA 4F2WA 3QHPA 4DKJA 2VN8A 2NW6A 2J6HA 3HP1A 2UZ1A 2VCYA 1Y7TA 2H18A 1ZRSA 2QTVB 1YS9A 1OF1A 3ST7A 1H1LB 5BQOA 4BQPA 4KHZA 2IU4A 2XUAA 5IDYA 3ZU2A 3EAQA 1NQ5A 2B4QA 4XUCA 3ANTA 4YAFA 3U62A 2E5LB 4OQ4A 1U6IA 1MFPA 1WUKS 4N6NA 1RAHA 1ZC4A 3JZMA 4JV5B 4MIOA 1L5GB 4AJLA 4ES6A 1II0A 1WMSA 2H8GA 2QM3A 4QTXA 1DOZA 3E82A 3WB9A 4RULA 4IIDA 4EHNA 4FWIB 3FTFA 1R15A 4I1UA 4JVMA 4LF5B 1PQUA 2Z9BA 4AN1A 4HB4A 1RJGA 3KQWA 1I2AA 2QN1A 2PX2A 1MX3A 3D8NA 3GJYA 3L79A 3Q7SA 4IDNA 1DFGA 5FT9A 1Q0LA 2HEGA 1N0HA 2ZIZA 4GMDA 1MEJA 1GZSA 3M6AA 3DDUA 5BT9A 3W5IA 5A4IS 1ISHA 4QGAA 3IPCA 5LC1A 4ZZ2A 4HWSA 5TV2A 4IVPA 4EHAA 2HADA 1AKNA 5JRZA 4YALA 2Q6LA 3WRYA 3OT1B 1G8AA 2XI4A 4EELA 2H07A 2IDKA 1B93A 3NPMA 4LYJA 4GKKB 1V37A 4IDHA 2A5YB 4RGYA 5AK5A 3T7DA 1NBMA 1E2MA 1LFDB 1BYUA 1R4AA 1U7TA 2BI4A 4IX1A 2XRMA 5G53C 4OHWA 3RRJA 5I47A 2R1VB 2VDRB 5ITZB 3MCUA 5E38A 3IC5A 5EZYA 2OLKA 1HZJA 1XQVA 4OFZA 1PO7A 1PNVA 1V11A 1JXOA 2YZ7A 1JPVA 2NV2B 1H3EA 1Q1GA 3M4JA 5CP8A 3RIMA 2HR1A 1MAUA 1OWLA 4NENA 3GLFA 3INYA 3N7UA 4CUJA 2ODQA 3F96A 3MWDB 3Q10A 4RYLA 2FPOA 4G5SA 4QXMA 2JFQA 4H35A 4E03A 4UTRA 1SUWA 3FBWA 1Z08A 4MQ6A 3WMXA 4BBJA 2A67A 2ORIA 3I0ZA 1CERA 3VZPA 4DV6B 4CL8A 1YK1A 1ZKDA 2I8AA 3EN0A 1H2WA 1NRIA 2NQ8A 4IO1A 4TL6A 3FYCA 5GJWC 2DERA 3N0XA 3LRPA 4KUEA 2KYRA 1O96A 1S2MA 1XNHA 1W2GA 1S4QA 1XMJA 4FQ7A 4UAUA 1TMOA 3LQ2A 4D7AA 4RKYA 5DIZA 1V5FA 3EC1A 1HY3A 3C3YA 5KTOA 3LECA 1EGHA 2WZDA 1TOAA 3L18A 5IK2D 1QYXA 3HA3A 5AOCA 4O33A 1F8FA 1ORIA 2B8JA 2XGMA 2JGNA 4N3CA 1UQTA 2R6ZA 4AJEA 1JT9A 2R7NA 2ZXFA 3KXLA 1B0UA 1I24A 5JE8A 3QQPA 1OROA 4LVNA 2XDWA 4MW9A 2A86A 2ZRDA 2Q2VA 3FPHA 4O1MA 2D4HA 2FW6A 4HTAA 3TRHA 4LYGA 1VLVA 1FXWA 3DZHA 3NNDA 5DN9A 4XIYA 3K0BA 1MDFA 4B1FA 1JHVA 4EPXA 3N87A 4PONA 4AJHA 5LQUA 1FNNA 3PPYA 1UMDB 1ESNA 1ECFA 4HQOA 2CGEA 3V3KA 1PFYA 3MUNA 3P9QA 4W7IA 2J30A 3DGFC 3MJSA 1EUZA 1XTIA 2G7ZA 2EFHB 1BMFD 5HILA 5B53A 1M2JA 4Y2JA 4FQ8A 4EVRA 4BRWA 3AQIA 1U7XA 4FOSA 5JHGB 4EECA 4RTOA 1F3LA 1NY5A 3PVSA 5KYNA 4MV8A 2EZ9A 1B4DA 3DE4X 5DRTA 3VNAA 2E4XA 2CVPA 1RYNA 2HCBA 3M1LA 5HS4A 5H0IA 2FWMX 2VUUA 2GI4A 4ZHQB 1VL1A 5HJ2A 5FTLA 4LDQA 2AWOA 3QG5A 4QDTA 3R77A 3O4VA 4NSNA 2RH8A 4BNVA 4E5KA 4FSXA 2JHFA 5JJCA 3FH0A 4I8XA 3VAYA 4Q9AA 1QE0A 4FJ2A 4ER5A 3JARB 4GOKA 5ALGA 5AM2A 4ER6A 4DM3A 3CUSA 1PEDA 2O6LA 4P4UA 4PC1A 1CEEA 4V0LA 4Q37A 3I3OA 3DV9A 2HBQA 2VJBA 3KIPA 4KQ1A 4DIFA 1YS1X 3FVRA 2JGIA 2WJ3A 3T54A 4BVEA 1FRVA 1NJ2A 3F3SA 1DX4A 2QUBA 3I32A 4HYYA 4IMRA 3WMRA 1CR1A 4ZTBA 1XYGA 3ESXA 5FP0A 5BSRA 1UQUA 4Q6WA 3SYMA 4ED9A 2PD6A 4DRZA 4Y1EA 3H1FA 4H7JA 1G38A 1YGSA 4JNKA 2AUTA 3BCUA 3PBKA 4LY6A 2BM1A 2C04A 5C52B 2PXXA 4HB2A 5B5SA 1I7QB 5BXQC 4LZWA 1NNEA 4MRMA 1I0LA 2XADA 2VS1A 3AR8A 3ORYA 2Y3IA 3LW8A 3TD2A 3A1NA 4H77A 4D8UA 4H7FA 3GLIB 3EPKA 3IVCA 5JD4A 2DCMA 3O7MA 4KAAA 4EEKA 2BZGA 1CZOA 4HTFA 5IZ4A 4O4JB 3RQIA 1Z63A 1MVNA 3D3WA 1MVLA 1XD9A 3S99A 3VDNB 4D3XA 4WBXC 5K8IA 3NJ8A 3WGMA 2NV6A 2J3EA 1J0AA 3DBLA 3JQ6A 4MS3B 4XPIA 3CNOA 1K8XB 5M2QA 4KPUA 3A9VA 5E1BA 3MHPA 3RC8A 1JMYA 1M0TA 2A9FA 4IXNA 1Z4NA 1NMEA 2N9UA 2QN7A 1QS0B 2AN5A 3BRCA 3GLKA 3O4FA 1G66A 5E0OA 4F85A 3OO0A 2VYVA 2AFHB 3SX0A 1Q6YA 5I7WA 1FP6A 2IIVA 3GG2A 4WRRA 3QUAA 4RABA 4Q1BA 2IXEA 1ZISA 3EGXB 1NI4B 3QNMA 1N9KA 2O2EA 5BWCA 1PVOA 1GUYA 4MULA 4F9EA 1M2VB 2FZCA 1D9XA 4YRSA 3BHJA 3SYNA 2AJLI 2QUAA 4BMDA 2XCQA 2YVLA 5KQLA 4E7OA 3QSYA 1G3QA 1XTRA 1WCYA 3FKJA 2R66A 3V4PB 3U19A 3DCIA 1II8B 5COQA 3NTRA 3STYA 4C05A 1TTTA 1P3JA 3B6IA 1E4EB 2VPZA 1EWYA 1G55A 1WJGA 3G8BA 1Q11A 2E9SA 2J9RA 2PWAA 2QK4A 3A8TA 4HNTA 2ZJ7A 3I2IA 2VNSA 4YMTA 4NBNA 4OOEA 2HH9A 1LPAB 2BFAA 2PBFA 3R24A 4L6CA 3K9BA 3L1JA 4LOHA 4OMUA 4L4SA 2CYBA 3QUQA 4MKRA 5DM4A 1T1GA 6CHYA 3O75A 1MO6A 3X1KA 3SOZA 1RM0A 1PS0A 3PITA 4GI5A 2YJNA 4ZICA 1O5TA 1T1EA 2QR5A 3K73O 4C7BA 5ED4A 4R8RA 1YR7A 4ERNA 2F8TA 2DBRA 1P1IA 4UCWA 3P9YA 3CTPA 4GE0A 4BNUA 4EHBA 4EUHA 4CKEA 1MFZA 1MPTA 1B15A 1XDSA 2C4UA 1I3KA 2CXSA 2X7XA 3AEXA 4W5HA 5HYVA 3M7IA 4IYRA 2MYUA 2OC4A 1NVTA 4B6PA 2YWCA 3GLGA 4MICA 4ZVVA 4F5DA 1KAGA 4Y0AA 2WPDD 2BFEB 2QD5A 3OLCX 3MWKA 4RCVA 3BKXA 3K70B 4I46A 3ELUA 5TVGA 1XWIA 1U1CA 1FDWA 3VPBA 2BFFB 1G21E 5FPHA 5AVRA 3I4CA 1GCIA 2WU1A 4MV4A 3SQNA 1PNOA 4KIJA 3RGGA 4X64B 1OWOA 3C3JA 3GEDA 4MI9A 4RPJA 1JU9A 1DQZA 1S3FA 1W4RA 1HMPA 1QZ3A 3DC2A 3VKUA 4H6XA 1CF2O 2HHAA 1PGJA 3IIKA 4N5HX 4AY2A 4A8JC 4D41A 2KPOA 1NNLA 3AX6A 3KYIB 1RVDA 4NNOA 1RKXA 1GUBA 4JT2A 4JQSA 1KI4A 4IIJA 5AT1A 1TLTA 1G2PA 3JYQA 5GIOE 4ND5A 2IL1A 3HABA 5JPIA 1JZSA 4MUGA 1Z7EA 3PEFA 4YASA 1CJSA 3EIQA 2P2SA 4DABA 2TMDA 5B58T 1B2LA 4UQOA 3NHSA 1AO3A 3WHKA 2DC1A 3I1FA 3CNBA 1X13A 2I2CA 3H4MA 3LUFA 4HMOA 4NOMA 5H7XA 2YUTA 5ETJA 5B7QA 5L4SA 2M1ZA 3AZOA 4OAQA 1L7XA 1VI5A 4Z3DA 3I62A 1M2EA 2BGKA 2FFJA 4XIJA 2Q5OA 1VPTA 2YRXA 1JJBA 3EGDA 4PF1A 2ZJ1A 4C43A 3DHEA 2VTEA 5CFZA 4U2BA 1HDYA 1FDSA 4KE6A 1XXHA 3LOUA 4XWGA 2MDTA 3U3JA 5KNDD 4L4XA 2A5JA 1OAOA 5EIBD 1JH9A 1RIFA 1P6XA 3AR9A 2AKEA 5FBZA 4OSOA 5JNSA 5LUAA 2Q07A 3OZ7A 3V34A 3AB8A 5LBIA 2MYPA 3TPZA 2OUIA 3KE9A 1RWPA 3WKAA 3PFGA 4KQKA 4HCJA 3V9AA 4MVJP 3RE1A 2G9ZA 1P8AA 3OFSA 1E6CA 2BRFA 1YQWA 5BNWA 1J25A 3RYHB 3EF3A 2IU6A 2YZKA 4E3WA 2H31A 3UICA 3RDPA 3QXXA 2WKSA 3OPQA 2PX6A 4UJ5A 1V26A 3CZCA 3F4KA 4JYPA 2OM6A 5LYJB 4HNQA 1HT3A 1GOTA 1FEZA 4O2AB 1AXEA 1UOOA 1W5AA 1YL6A 3PI6A 3HU3A 4BUZA 3LSTA 2Q9BA 4P93A 5CNKA 4O4HB 1L4MA 5LQDA 3ITEA 3T9EA 2OO7A 5L4NA 3W6ZA 2WSLA 1E9VA 3KTAA 3CJTA 3OLVA 4BMXA 1MX1A 1LJ8A 2C0PA 4LHXA 4GECA 3ZWKA 1ISGA 3MTAA 3IELA 1LSSA 2Q0HA 3VOSA 1ICEA 2Q2WA 4Q3DA 1GNVA 3T7TA 1T8TA 1TYDE 1JG4A 1WQ3A 3HWX1 5HIJA 3V8EA 2BMDA 2ZYTX 2J46A 3LA8A 3VR5A 5HRUA 4FI3C 5IP5A 3WJAA 4J75A 4IH1A 4KXUA 1NI3A 5C3UA 1AKMA 1R0CA 5T57A 1H93A 4Q7EA 3NBUA 5C3MA 1SKYE 1QR2A 2D2EA 2FMXA 2J3HA 3LVRE 4LQDA 4L78A 2ZAIA 4XD2A 4C2AA 3I39X 2HDOA 5HRAA 1KU0A 2H16A 3G2IA 5FI3A 5TQ2A 3T3EA 1O1YA 4BO5A 5JAOA 1J2FA 1LD3A 3MBKA 5U1PA 3H04A 4EARA 2WVGA 3G1TA 3NBZC 1KP2A 4PLYA 1OU0A 4X41A 4EFKA 4ENUA 4YRJA 1W4BA 2GEKA 1JG1A 2IOFA 3KYCA 4KXNA 5AKGA 4KQFA 5ED0A 3WLEA 521PA 5FBVB 2OO5C 5AMXA 1MF7A 2GM4A 2LXNA 1QQ5A 4LZPA 2A59A 2EG9A 3AJ8A 4I9HA 1A9RA 1G63A 3NRJA 3JQAD 3ER6A 1SC9A 4OHXA 3AINA 2A9OA 2HTEA 3GT7A 4DNOA 4LHEA 4HNAB 1PYGA 1SKQA 2I9PA 3QFCA 2BEUB 3DUFB 1DSSG 5KQMA 3OJ0A 1UBJS 4OLHA 3ZY4A 4B48A 3N2ZB 3O8DA 1G5IA 1G98A 3FNRA 4MVJF 3INGA 3DL7A 3RSOA 3DXYA 2WJVA 3EXG1 3OOHA 4HWPA 2H1WA 1NXWA 1V3VA 1DIRA 1FXUA 3EZ9A 3DGEC 1L5SA 1Z38A 3C6QA 3LMKA 1Z6TA 2BFWA 2PD4A 2YZ2A 5K8CA 2WZBA 4AZSA 2P11A 3PFIA 4EMBA 2ZS7A 2EKBA 4MMYB 5EJ9A 1PR0A 4C87A 4EHJA 3T41A 5JSZA 3PICA 3W5DA 1P3DA 4U2EA 3TLCA 3N3BC 4QXOA 4TXJA 1ORRA 5ALVA 5KYUA 2R1ZA 1PNQA 2BHSA 1UM9A 2O57A 4WEQA 5JVDF 4REQA 4UDNA 5FA5A 2EERA 1RWKA 3QIVA 2EAUA 4V39A 1A9YA 4LMPA 4YUYA 4RTLA 3RLIA 5G02A 1N57A 1WXQA 1PDVA 2YW9A 3UK0A 3VSEA 3X1WA 5GZ1A 2SBTA 2FPLA 3STXA 3ZZ1A 9GPBA 3SMQA 2Z6VA 3HZOA 3RNOA 5IXSA 2ID9A 5J2TF 1PUXA 1XLVA 5F73A 2LUOA 2EJBA 2QIOA 3SY8A 3HGTA 2AQIA 3PJRA 1TLLA 4J43A 2I5PO 1SCDA 2D74A 2WAYA 2R7MA 2GFIA 2Q9AA 2WICA 1C0LA 3JVVA 5T8KC 1JJAA 3JZIA 4KDCA 4OB8A 3TZKA 2ZB4A 2PLWA 4FNMA 3GQVA 4XARA 1F1BA 2HNKA 1XROA 2QNRA 3CEJA 2XB2A 4MI3A 1E2EA 3ZCUA 1AU9A 5JPCA 5SY4A 1MIOA 2QE7D 5DW3A 2P65A 2YS7A 3QGMA 5JWHA 4HO1X 5IYZF 3WHIA 1R6XA 4MDHA 4CFYA 4TKVA 1WB9A 3D2BA 3FUCA 3GV0A 2WA1A 3NTLA 5ICMA 2F9MA 3QH4A 3Q3GE 3N5CA 4UASA 1XZAA 3FWYA 3DTYA 4EAAA 1J42A 2VC2B 3DFKA 3PC8A 2ZB7A 5CNIA 3VA7A 3PHBE 1H1DA 3LTEA 4OQXA 4ZPJA 1YVRA 3SU8A 1H5QA 1EP9A 2GJSA 3GAAA 1GTVA 5A6SB 4PYIA 2BY4A 3VDXA 1IAQA 4NYMR 1OZFA 2IWRA 3Q3IA 1SXJA 3CX7A 3CZ5A 3Q1LA 5DM0A 4C22A 3I30X 3T5GA 1YVEI 5GINE 4G0ZA 3TKAA 4HAWA 1RHKA 4UW9A 3R4VA 2I6SA 4C0JA 1XZKA 3MMNA 2XCUA 3NBFA 2SKCA 4LTMA 4WNIA 4Q9IA 3DAPA 3UMZA 2EZ4A 1EFLA 3COPA 3RHFA 4G2NA 3WBFA 1V41E 1WUJS 2W37A 4BTVA 1N5DA 3EEBA 1DMSA 1U7WA 3T95A 4HV4A 4MYDA 1NFQA 1O97D 2MSWA 3AVXA 2OVFA 1E6UA 1YDFA 4D99A 5JXIA 1V9LA 2P41A 2WF9A 3LX4A 4MP3A 4MQEB 4NULA 3K0AB 1K0UA 5K3FA 1DIOB 3OFNA 3CO0S 3DWIA 4ODIA 4F3KA 2Q2QA 1FBNA 1XD2B 4MW2A 3RUDA 2VRBA 1CUAA 5IMSA 1E6WA 4XRGA 1V1JA 3QEOA 5JZBA 3C3EA 5DI3B 2VXBA 2NSLA 3SLRA 3ENVA 4TV9A 3AO0B 3V00A 2RGRA 2EBHX 4ND8B 4OHFA 2AI2A 5THKA 5CDGA 3IULA 3QPWA 2XQFA 3AR5A 4M53A 5K7SA 4OBWA 1WU7A 1VG1A 5AW5A 5FOVA 1X39A 3TQTA 3VPHA 2ADMA 5ESRA 1DO2A 3R7SA 1FUIA 4X20A 1KOJA 1XEXB 1YE5A 2W5UA 4ZAWA 1XQ9A 3KEOA 2DLCX 1GG9A 3JQFC 2O8BB 2R6FA 2XOEA 2AMYA 1CFZA 1OB2A 1QOZA 2BBTA 3OQIA 4JWTA 4L07A 1RS0A 3MCAA 1YA4A 3QU7A 3L41A 4X6XA 3MCZA 1QU2A 3TSYA 4NATA 4HXGA 1R64A 4PAMA 1NW3A 3AR3A 3PIIA 5IEBA 1G42A 2IVFA 3FZNA 2CNWD 1BGWA 4ZAGA 1V16B 2YW2A 3GYBA 4YEDA 3PWTA 4ZRDA 5F7XA 5EY5B 2DLDA 3GZNA 1JQJC 1XRPA 2PNFA 3JZAA 3RTEA 4LTDA 3IQEA 1TNDA 4K3UA 4OYLA 3KSMA 3VSBA 4G1UC 2ZG6A 4P3NA 3MAGA 4M1QA 2ZM6B 1XT6A 4X7RA 1EFHA 4PZCA 1FYFA 1EVIA 2UUCB 1O94C 3M89A 5LPNA 2X2OA 4WX2B 2V7UA 1VJ5A 1H2AS 1XDUA 2VIIA 1JAIA 4ETIA 1WF3A 4DGSA 1KE1A 2BGNA 1K2VN 1PUIA 1RMQA 2RBKA 3PXEA 2IUUA 3HBFA 4H7EA 4XVUA 2OXEA 3D3QA 3T7KA 4KWIA 1OLXA 5C8ZA 4RHUA 1HE2A 4P5EA 2ZJZA 1RHJA 4UNSA 1ENPA 2EW1A 1C4WA 2JCBA 2YMLA 2G0AA 2CVHA 2IXDA 3E48A 2PLRA 4X90A 4RW0A 4M0EA 3I92A 4A7PA 2ZUEA 1JSRA 3QPDA 4HSGA 3OJXA 1B2RA 4D9BA 4DLSA 2MR6A 1EFRA 2B0CA 4AYWA 2O2JA 4DBVO 1P75A 3OTGA 2PFKA 2OHGA 4ZYTA 4LA4A 1YJ5C 3PLRA 4TQAA 1EFVB 2VT7A 4ZI7A 1UDWA 2FPIA 2RSLA 4PSVA 5EHGA 4KR2A 4WBNF 2Q6TA 3KSUA 4FFNA 5ICEA 1RRGA 1ZD5A 4O2RA 1Y9EA 5KNBA 3C14C 1KAEA 3W6UA 2W58A 1AVTA 2GVNA 1UFQA 4DGQA 1NW6A 1C4XA 1DTSA 2EWWA 3CW2A 2PLNA 1G291 3EK2A 1T0UA 3LWBA 3P9ZA 2J9FB 4P80A 4YQZA 5K0LA 4AMUA 1R0ZA 1YZKA 3ZD8A 1NJ5A 1FP7A 1X3SA 1Y8QB 2R8OA 1KRWA 4PSCA 2DUWA 4Y9RA 3UJHA 1II9A 1P5RA 2XT0A 4KQJA 1EGMB 3MJFA 3PT5A 4TLMB 3KKMA 5ANRB 3S1AB 1A8QA 2CF6A 5TJHA 3HADA 1QTNA 1HNZB 1SN7A 4R2XA 3EUFA 4WACA 2IZ1A 1CVLA 3N8KA 4JBLA 5FA8A 1CD5A 4HQ6A 5BW5A 4A0HA 3OICA 2PUFA 4YJFB 2O8CB 3KJNA 3IUBA 2PGDA 3KB1A 1SB9A 3IA2A 4UDOA 3RCBA 1N2GA 2EFEB 3GRRA 4TT8A 5HQJA 3GH3A 1GNPA 3F71A 3JQDA 1P4AA 2WYVA 5DDIP 1FK8A 2AOWA 3HR8A 3I4FA 3KOMA 2OQRA 4C4AA 4X9XA 5IJ9A 1ZP6A 5K4AA 4U6QA 1FQJA 1KU6A 2FK8A 3QBJA 3RF6A 3E53A 2BLLA 2FHSA 2LDBA 3WX0A 2P6PA 4NP6A 1LBSA 1IH8A 3K05A 4D42A 2OSVA 5JCOA 1R10A 4E4TA 4JI7B 4FGLA 4IHAA 5AKHA 1YHNA 2NGRA 3N2IA 3VGPA 5AKIA 3W5HA 5EIWA 1P4HA 4OGLA 1QHYA 1F6BA 3GLIE 1ONBA 2GZDA 3HPRA 1YZTA 1OFTA 2AOVA 1DC4A 3MWEA 1OFIA 3F98A 4FZ3A 3NHWA 5J23A 1KQFA 1I3LA 3OJCA 4EW3A 2WFZA 3CLUC 3LUDA 3QHQA 1KVSA 3QMWA 4IQGA 4JR1A 4KVGA 3MJRA 2II6A 4RDHA 1GY8A 4M0MA 1CJTC 1V96A 5I7FA 4JMPA 3R74A 4I9GA 3WO0A 3ZY2A 4EEXA 3I09A 4QPJC 4G2SA 1H4VB 1I5OA 4AZ0B 5TR9A 1U1GA 1ZXLA 5BQ3A 3DULA 4YCAA 4U2CA 4EKYA 4KITB 3KQTA 1FFAA 1TJNA 2XQIA 3E81A 4B43A 2AFHE 3KAKA 5SZHB 1A5SB 1P9WA 1SCIA 5LMCA 1A5AB 1T4GA 3NDRA 4UOQA 5DHAA 3CT6A 4QOJA 2HK8A 5DN6D 4GLOA 3S2GA 4NJEB 2ZBPA 1QHXA 4V03A 1E0AA 4I1YA 2Q5CA 3Q7IA 1N9GB 4WW0A 4ZCTA 1H3FA 1HH4A 4HH3C 1KJQA 2H5LA 4J0KA 1NBOA 4ZO6A 1Q1BA 1C4OA 4BZXA 1EX1A 2NZ2A 3CUEF 2JFVA 4JT9A 2YBEA 4BDTA 5JROA 3L07A 3KQPA 2C1EA 3N2EA 4BVGA 2K2QB 2BONA 1KQPA 1QG2A 3DQQA 4HFRA 1ESCA 2HK7A 5KJCA 1IB6A 3E9MA 3C4VA 1EK2A 1G1AA 3EWSA 3QK7A 5MGBA 3JWJA 2RHOA 2FX5A 2LCIA 3PJDA 1CF4A 3HO8A 3BGWA 5CYFA 1ZHFA 2EKPA 2OXRA 3OA2A 1GXSA 2VWQA 3TZBA 4MUMA 1OLUB 1A2KC 1IN6A 4W9NA 1AB5A 3RFCA 4ZDWA 5FUBA 3G2OA 4KQ6A 1K89A 1SXHA 4G4JA 4L5CA 4MGHA 1SXQA 4K88A 5C2JB 1IJFA 3ZGNA 3W04A 4JLVA 4B45A 1IEWA 2IYNA 1UIRA 2IP2A 2JZCA 1A5TA 2BCGY 1QPZA 1KS2A 5EFOA 1FP1D 1NU6A 1GZ7A 3GJXC 3VZCA 1VFNA 2GETA 1D2EA 3ETEA 3K8QA 3GJ8A 1DE0A 3VHXA 4AVYA 3SK0A 4D98A 1H4TA 3NP7A 4PQEA 5L8VA 4H7HA 5M04A 2W71A 3PDJA 2B3TA 3TOSA 3QSGA 1NRWA 1W76A 2ARKA 4L51A 5IXYA 5DTEA 1L8XA 1MAVA 4PRLA 3FB1A 3OQ1A 4QJIA 4YDRA 2FI1A 3EXHC 4U7JA 3BL5A 1ML3A 1QH1A 3OZUA 2XLBA 2FCAA 2OHOA 2VJKA 2OECA 1DCFA 4RFVA 1B0ZA 1BROA 3UMVA 5ABPA 1VOTA 3SHTA 4B7XA 3LLVA 4YAIA 2O8NA 4M7OA 2GCIA 1JEQA 2I3ZA 5C7IO 1PK8A 1TM4E 5LU9A 1QANA 2NPOA 3ZVMA 4PXYA 2J08A 1KDZA 2PO5A 2PSFA 4ME6A 4A6XA 1GO2A 3I23A 2F00A 1VIAA 1W1WA 4TTVA 5E0KB 5HIMA 4BX0A 5KYTA 3RARA 5J5CA 2LPMA 4X24A 2BELA 3MUEA 2H7YA 1XDGA 3ZLBA 3HDQA 1U28A 3GRCA 1CRLA 3OIWA 2UZ3A 5EKDA 3SHQA 1FNDA 1L5NA 1TCUA 1X80A 2DWUA 2REBA 3QWBA 3T3MB 1SOAA 4EG1A 1M72A 5CG1A 2BTQB 4TZ0A 3RVMA 1AY0A 2XW6A 3FVQA 3GFGA 3IJ5A 5HKLA 1RLTA 1N2XA 1VPVA 4YRCA 3A4VA 1F48A 2X8WA 1R5NA 3IVMA 3FY4A 4Q00A 1DCKA 4BFSA 2NUTA 4YLGA 2G07A 3GUYA 4EI9A 5BWNA 5FX2A 4DV7B 1K6JA 2Y66A 3VM6A 4CEIA 1H23A 4ZDJA 2ZYSA 1K75A 2PH1A 1TEXA 2JIOA 2N3ZA 3HP4A 5ESDA 4QYMA 4MO9A 1U31A 4CM4B 4Q66C 3HJRA 3T9CA 3ZW7A 3K71B 3GPIA 1SC6A 2QP3A 4NU5A 2O6HA 1GPKA 2GEBA 3UUEA 5BNTA 1XNRB 4KXMA 5FWYB 1PZFA 2FZKA 5C51B 1G3GA 5DNUA 3NWBA 1N2JA 4MWTA 4RD4A 4IQ4A 4PN3A 1VGVA 5FBWB 2Y4NA 5E6RB 2D0DA 1FY2A 1DU4A 3M4YA 2IE0A 3QPVA 5IPFA 2QSZA 3GI1A 3GA7A 3HWSA 2FQYA 3CCCA 5AHRA 4EHKA 1NXOA 3AT1A 1POWA 1Z07A 3ZD9A 3BXEA 3FUWA 3FJ1A 1BKDR 2OCYC 4QODA 3PTAA 1XNGA 2OHXA 2BP7A 4N5DA 1XRLA 5B37A 3CG4A 4JLNA 3HCOA 5GGXA 4YDHB 2QE6A 4XM0A 2CF5A 2WRZA 3LBAA 1MHTA 2PJRA 2ZFUA 2QGFA 2Y6VA 4TRRA 3O21A 4NCXA 3EXIA 1EZ4A 1SH7A 3I58A 3L0ZA 3EGCA 1YQQA 3MSXA 4ILKA 1TAGA 4TM7A 4AWAA 1WBBA 1EUQA 2GZ2A 2ABWA 2PGAA 1ODSA 4XW2A 2J8ZA 1WV1A 1MJNA 4BO1A 5CCEA 1F8YA 3GMDA 3NKVA 1JG7A 2CBXA 3VA1A 2O9JA 2WVHA 1KDTA 1ZH4A 1WU8A 3C41J 4JBWA 1J22A 4PFKA 2AC7A 2CVFA 3VR3A 1JWLA 1E3QA 1KI6A 1YB1A 1M8PA 2QZSA 1FP2A 3BL8A 3FNBA 3GEEA 3R40A 3K1JA 1BEZA 4GOND 4O5OA 2P6UA 1FLVA 1VJGA 2Q5JA 5REQB 3UC9A 1KEZA 4DV2B 3T5CA 1CUVA 3GVPA 3LCMA 5A2GA 3F47A 2HZ7A 3E9EA 4PO3X 2RH5A 3DVAA 2Q6OA 3NANA 5TSDA 5JRDS 1SC3A 2AS0A 3RS2A 3T34A 5HF5A 4OMCA 3TO5A 4LFBB 1FX0A 1O87A 1JG3A 4MWZA 3CIFA 1T4BA 3WIUA 3L4JA 4G81A 3LDGA 4ANFA 2FMUA 1F2UB 5C9ZA 1ISPA 1QCCA 1TIPA 2FFAA 1ENOA 1UUFA 4V0SA 3UM9A 3HKBB 2A0XA 3G5UA 1XYYA 2XNKA 3OURA 1DKRA 1GA6A 1W48A 3IR7A 4H6PA 4XEHA 4H4CA 3PFNA 1VE9A 5HR5A 2HBZA 1WUHS 3C1OA 5TMEA 1YUNA 2IQ5A 3U4GA 4AG6A 4ZGGA 2AEFA 4RX1A 4EF5A 3COJA 5MHTA 3TFWA 4CEHB 1CXZA 4F6LA 1P7YA 2XX3A 2XRYA 4P58A 1V35A 2HYIC 2MHCA 1WTAA 4GPD1 5DYYA 5JDIA 1P9LA 3B7PA 3L8YA 2AUMA 2AX4A 4RAQA 4R9VA 1H65A 4Z0HO 3TW8B 4DIEA 3C98A 4QOEA 1YVPA 4IWNA 4TYWA 2EZTA 3DBVO 4PX5A 5A4AA 5CGQB 3OZRA 4AY4A 4WERA 1PZHA 2FG6C 2ZETA 3GDGA 1RLJA 4UNRA 1TUBB 1V25A 3BGVA 3UFXB 5GTDA 2QVBA 2EV9A 5JU6A 4TYNA 5KTPA 3I0NA 1DEXA 3JWGA 2VYVD 2Y68A 1QHHB 3NDIA 1M6WA 2WMOB 4HDRB 3BMCA 3TZ6A 1GGVA 2C7OA 5JLAA 3Q5EA 1M1NA 3LLMA 3QPAA 1NT4A 4RMJA 5CVVA 3PHGA 4X8OA 3UPUA 2AWNA 1P4GA 5EZ5A 3RT7A 4IPTA 5LQCA 2C00A 2IYZA 2KBFA 1XKQA 2IS1A 2ZJAA 5IAJA 4QL3A 3TD9A 1VKHA 3T5PA 2HJRA 4LJ7A 3HEAA 2NLOA 1W36B 5EG5A 1V8OA 5CITA 5B30A 2WSSA 1QXSA 4KUHA 4D0SA 1YIAA 2X4DA 1BZYA 4X71A 1A96A 1WZEA 4WKCA 5KHOC 2QWXA 3AWIA 4HDNB 1G8MA 3RV4A 3MS4A 4IX9A 2VPXA 4CLXA 4C6TB 4KP7A 5DEOA 2PBLA 1QCDA 4IYJA 2D1RA 3LNCA 4ZP1A 3THOA 1GU0A 2I55A 4MUKA 4AG3A 3NVAA 4XGRA 3ZS8A 4KR9A 1CIJA 1STOA 2XAAA 3AL2A 3P71T 3PV0A 4DSZA 4N82A 1QFSA 5AKZA 4KX5A 3KFXA 3LUHA 2PZGA 4TWJA 4BVLA 3DVRX 4E5NA 2H85A 4Y67A 4KKVA 1ONPA 4WUVA 2P4UA 3LUGA 2X5XA 1U98A 2VP2A 3O26A 2RI1A 3C70A 4JJGA 4QT0A 3WLPA 2F8SA 4CYMA 2CC2A 1CEYA 2ZSIA 4GI2A 1EUYA 3ZVKA 1TW3A 4L9SA 5J5VA 2C2YA 3I1YA 1OGIA 2VHVA 4G25A 1VE5A 3K8ZA 4FYVA 4K9QA 5TGTA 5AH0A 2X7JA 4E6PA 4FDUA 4KN6A 8ABPA 1SAYA 2VHEA 1DT3A 2L82A 1W46A 3N70A 3W5CA 3GCWA 4GLFA 4RV5A 4WINA 4WOJA 3RU9A 2OC9A 1O6CA 3SE7A 5K6AA 1SU8A 4IIXA 2DT5A 1YRAA 2I2DA 3OEWA 3TQHA 3FKSD 1RIIA 3CE9A 1RTKA 1Z13A 1M34B 1PEKE 1UOEA 2R8BA 4UVGA 4HZUA 2HLNA 3O8CA 3ZDCA 1IAVA 3GK3A 5DT2A 3QBTA 1N5KA 4XD7A 2Z5LA 2ET6A 4JLOA 4IIGA 4PPNA 4ZGWA 3OCXA 5C1BA 3UMMA 5KUTA 3OE7D 2NG1A 2WHYA 2PM8A 3I53A 2PE5A 3T3IA 3HHEA 1HA3A 4OO3A 3N58A 4KIWA 4H7IA 4QHYA 1NJ6A 2ID7A 2B5WA 4PSDA 1OI7A 2EQ5A 5C1OA 2D4AA 2ECQA 5LKRA 2ODEA 4GFDA 3ZQ4A 5KOHB 1M6HA 3OUUA 1Q7TA 1UPAA 3P9RA 3ZY6A 4K87A 1GRRA 3DL0A 5CBPB 3NUQA 1UWLA 3QKSA 3WK4A 1W85B 2PU7A 1A4XA 1MNQA 4C2UA 3GZ4A 4BTLA 2V0GA 2XMPA 3J80A 1EIWA 1L5WA 3NHZA 4BP9A 2COEA 1ZGJA 5BUSA 1I5RA 4ZN6A 1UQRA 1PFVA 2XH8A 4WCFC 1O8BA 1M8JA 4OH1A 4JOBA 4XQ0A 3PQ7A 1EVYA 1ZVKA 3TLJA 3D4NA 1ML4A 4JJAA 5IU6A 2GYYA 2WKWA 5DLPA 4YJGB 3OFJA 1CUXA 3TQQA 5EHZA 3N3AC 1MGPA 5DMHA 4DT1A 2EHJA 2EWMA 4ETWA 5EMHA 4D9MA 2BI8A 2ZRHA 4HMQA 1UF9A 1T8UA 3FTPA 4L2IA 4Q7KA 5BW4A 4X3CA 4U9UA 1OXTA 3B12A 4Y2QA 3WLMA 2O05A 5EI5A 2AVNA 1XRRA 2QM7A 4JNCA 4QYSA 4KBYA 1ZD1A 5FNVB 1YU6A 3AR4A 1Y3CE 3MBIA 4M99A 3ROTA 2NYRA 3TD6A 5A0VA 2EL7A 6AT1A 2YR0A 3ER8A 3AWDA 4PLHA 2V6GA 4KGXA 1Q7BA 2AEJA 3NFYA 4TV8F 1L5HA 3I9OA 3TYXA 4LDPA 4KAFA 3AJAA 1CTQA 4WWHA 3TLBA 2M6LA 1GTZA 1DAOA 3BD8A 4FCCA 4LWZA 5EYPB 5H8WA 2ZYGA 3HSSA 5ICGA 1J5EB 3CCBA 3FWKA 4IIBA 3KYDA 4GMXA 4MWBA 4E1VA 1NVAA 1PQ4A 3EIOA 3H8WA 1CRQA 2IITA 1GL9B 2H7XA 3C1TA 1KZ9A 1RRKA 3I2GA 2GK6A 4YCJA 3CZ4A 1Z6AA 3RRBA 3FPFA 4PTYA 1H4QA 1U4SA 3WDLA 2F8LA 3F46A 3VR5D 2CLOB 3CJQA 1YQUA 2NO5A 5JAIA 4BEBA 5K05A 5U9CA 3I2JA 1GV1A 3T5DA 1VG8A 3R8XA 4NAUA 1HFEL 1EWKA 1Y8CA 1XCJA 4EZEA 2V7PA 1Y7HA 2ZK7A 3IB6A 5FIUA 5I8PA 4I5DA 3GJ0A 3ETGA 3FUTA 2ORWA 1MH9A 4KIFA 2IU0A 4E5VA 4BPBA 5IG2A 4RJIA 4QVKA 2D7DA 1ZITA 4YIKA 3PHIA 3FGNA 1L3CA 5JLJA 1NXSA 2IXAA 1N2CE 5E8RA 1EDOA 1XNJA 5KS2A 1Q0RA 1MA0A 2V3CC 4DNXA 2ZB2A 3T8YA 5D3QA 3ULKA 2PZMA 4E12A 3C6KA 3SS8A 3AEQB 2IYLD 3K31A 1DMZA 2C7VA 1GV0A 3D1VA 3DS8A 1ZGAA 2VAWA 2XCTB 2TS1A 5HGXA 1UFKA 1ZQ9A 1W52X 4KUGA 2XUIA 3LYAA 2ODAA 1H6AA 3C6BA 2GD6A 1ABEA 5BW6B 4WOKA 1U2SA 2EQAA 3RFTA 2CKMA 1M2KA 4X45A 4YXFA 1QRRA 3S7ZA 1XZMA 3SVTA 1PJAA 3HZZA 4ZCMA 4OYYA 2IHJA 5K0TA 3QEJA 4JJKA 1UOPA 1V39A 2G06A 1JIIA 1SR8A 2WPNA 5HS6A 1O9GA 3JQBC 3L8HA 5CBKA 1IUNA 4EMTA 3ELBA 5TPZA 1TM5E 3U61B 3W5BA 3IDFA 3AF4A 4QVGA 1OD6A 5DCYA 2V3VA 1X7WB 3THWA 1WSAA 3HI4A 1R0XA 5LDHA 1H2BA 4RTJA 4UFOA 1IONA 3H4TA 5DH9A 2NZVG 1R1DA 3ZH2A 4B84A 2R5WA 5DHPA 2EJWA 2QX7A 1X1RA 5JDCC 4YUVA 3I05A 1R2QA 4BHTA 4G6ZA 2FEXA 5MN5A 4DANA 2C2XA 4Z4IA 2UVQA 2QDXA 3U44A 1CDZA 1O9HA 2GM9A 2UYQA 3H5LA 4K6FA 1AURA 4HEA6 5AHOA 5HDQA 1NQWA 4PSKA 4WIAA 1P7PA 4PC3A 2NO1A 5AQEA 5CFRA 1EGAA 1KSGA 5JATA 1MABB 2CHGA 2VH1A 1ISIA 1LDMA 2GN6A 2WYIA 2XCOA 2ZJYA 3IKTA 5AK3A 1QBKC 1ORDA 1SVIA 1W19A 3MJHA 1HLFA 3KPUA 4JL6A 1SHJA 2XUDA 2BSAA 1MPXA 2H65A 4H6WA 5IAKA 3MEQA 4YV7A 7YASA 1U3FA 1I01A 4YCBA 3UHJA 3DZCA 3O3NB 4B3CA 4QDJA 4DRYA 3NIDB 2P9YA 3I9V6 4O02B 5IC6A 1YS6A 2F3UA 2GEDA 4KWCA 2FE1A 2XT9B 5AKYA 3K1AB 3IMFA 4TTSA 1NUQA 2IZOA 3M83A 3VPYA 3BJEA 3VUEA 4S1OA 1NKTA 4CR7A 4NFLA 1L7OA 5EJHA 1RRPA 1VDZA 3A28A 3A70A 1P1BA 3FCXA 3ME5A 4NCKA 2G77B 3GN1A 4DY4A 3ZK9A 2OD9A 5JCPA 3ZXSA 3TG2A 2IDJA 2WDZA 2JRLA 2BT4A 3EC7A 1J97A 4XFJA 3CCFA 4MH0R 3ZC3A 2WG1A 1DARA 3NWEA 4PQYA 3PLAE 1KNXA 4ZHQF 3I64A 3QMVA 3SZ3A 1WXWA 4DNQA 2JAWA 4LY9A 1JE1A 2WFLA 3GA0A 3ITNA 3EMKA 3DJYA 4FGZA 2QTAA 3L7AA 1ADCA 3NT5A 4OFWA 3SP1A 4CMEC 5GADl 1ST3A 2PMBA 3QLUC 5CH3A 4CIVA 4B0PA 4G8CA 2XDQB 3QVOA 2SKEA 3SXUB 1TVMA 2CSUA 4QBFA 1I2DA 1KK0A 3C8MA 3I9KA 4BNWA 4DJFC 3L4KA 3ZS9A 5JJKA 1SXJD 4LV6A 3GCDA 4Q4AA 1P7VA 4JT4A 4OI2A 4CF4A 5MN6A 1T5OA 5HF6A 5KU1A 3AVTA 4D0NA 1T6ZA 4G5HA 1ESZA 4IG4A 1SURA 2HJ9A 4BQNA 1MC1A 4BLWA 3W2FA 3C7CB 1U94A 1A4IA 4J1NA 3D6TB 3V2HA 4HAOA 4EY3A 4J0CA 5CM9C 4PAGA 4MDFA 1N3BA 4BUCA 2XR1A 3WMEA 1AQYA 4G5OA 4ZYLA 4DOMA 4QFDA 2SHKA 1O0BA 2H2HA 2GN2A 2GK7A 4ZC8A 4ZCSA 5KVSA 1BVRA 5FWXA 3AYXB 3GAZA 1JPNA 1P5FA 3JAWA 3LPCA 3B6KA 5K8UA 1ZICA 1XTBA 4RPGA 1AKWA 2AK2A 2GPJA 3EYAA 3OFND 4NNJA 4HYQA 5C8YF 1M75A 2MWMA 1OBVA 3DW3X 3L77A 2A1TR 1J20A 1QG4A 1QGUA 3PLNA 1ZJ4A 4U0KA 3MA0A 4RNCA 3OKPA 4TVOA 5ENZA 3A06A 3G02A 3V4LA 3ZV4A 2HYDA 3G17A 1FE8A 1RKVA 3IHKA 5K01A 3UA3A 3H8SA 2VHYA 4NBRA 1PQWA 1VMKA 4RQBA 1CY7A 4O4JF 4FFVA 3S2FA 5JFGA 3GC6A 1E2GA 2R65A 4CIDA 1T6YA 4MR9B 2ZM5A 1AV6A 3QF4A 4M9CA 5LXTB 5TXGA 5CM8B 4FEGA 4DA4A 3NW9A 2XMSA 2ZAGA 3G1UA 3DAHA 2O8FB 1NPTO 1NYRA 3KSRA 4LJ4A 2NVOA 1YF3A 1TC2A 1PZMA 3FETA 1LDNA 4RPIA 2YVQA 3PDCA 4KACA 3ND6A 1DPFA 1T36B 2APJA 2HMUA 4B6OA 1UODA 3D6UA 1MZVA 1ZD3A 1KC3A 3R6TA 5F12A 4X62B 1F7UA 3B6ZA 3ZE1B 3EWIA 1XHEA 3F90A 3HCWA 4KO1S 3S70A 1L4EA 1W8IA 2XB8A 3EVEA 4KBFA 4PCVA 2A14A 1NQUA 3VHLB 2CLDX 2WILA 3C6MA 4BXOA 2BEVB 4GDMA 4BCCA 1Q16A 3G1WA 4JGBA 5G1PA 1R00A 5JSFA 1E9AA 4DLTA 1S3GA 3KJHA 2KLHA 2NTJA 3GFBA 3U0BA 4ND4A 3VV2A 3D3NA 1O08A 3OE1A 3REQB 2ZRNA 2HU5A 3JAMA 1SWWA 1LQTA 2UVPB 4AYTA 5K6RA 1CQXA 2FMHA 3V4OA 4IICA 4A6EA 3A3PA 4KHPB 2ZVPX 3PDIB 3AF0A 1YVUA 2DH6A 3QYAA 1ZXBA 2DFVA 1KHHA 3J7TA 3K9CA 2RAFA 1PU2A 2ZIUB 5I9TA 1PGOA 1CQWA 2VXYA 3AY7A 1QKJA 1CUIA 1MB9A 4KZPA 2DBVO 1IHUA 5BO5A 4DLBA 5ALYA 2GN0A 1NM5A 3TKLA 5CD1A 1Q19A 4J94A 4UM9D 1AC5A 1FTNA 1P9OA 2ONCA 4ND2A 4NCBA 4D6YA 3GX1A 3NHYA 1EFRD 2JFYA 2P68A 4QUEA 4WUTA 1TYEB 2OZPA 4JMLA 5ALHA 3TN7A 1GNLA 1XQ6A 2Y67A 3VPFA 4TL9A 3A6JA 2GVZC 4DHEA 3LFTA 3OEEA 4URHA 1E3SA 1R18A 1SCKA 3CLSD 2EBUA 3VMFA 2ZE7A 4YFVA 3HCRA 3FZGA 1FDRA 1GTL1 2VBIA 4KW7A 4OBBA 5JYDA 2QLMA 5KNBD 3QWFA 3R3SA 2RH9B 5DF1A 4CKBB 3QUBA 4ECEA 3K1ZA 2O1WA 3ZHYA 2XSZA 5EMNA 1RNLA 2DJIA 1QGAA 1YCFA 4L7VA 4A92A 2AMFA 2Y0CA 2Z9DA 3RPEA 3EW7A 1Q3TA 3H0EA 2BGUA 2I99A 5EESA 5JC1A 4Q3NA 5T67A 3W4JA 1CDDA 3V33A 5KCZA 5FEMA 3D1JA 3OCCA 1GG5A 2OP0A 2AMVA 1CE8A 3CNQS 3AP2A 4FSHA 4YWJA 4P53A 4NZPA 1KEPA 4JP1A 4LMBA 2WIKA 3HMKA 3WB0A 3V2GA 4XDGA 3QW4B 2X0DA 3R2JA 2QU7A 1E9DA 2X13A 3OOWA 5ARCA 5F5NA 3RFVA 2ZE8A 3PQDA 3TEJA 1QTIA 1EE9A 3ITKA 4QOHA 1V7QA 5AP9A 3Q9SA 5EC8A 4EL5A 3SWWA 4CMIA 2PRYA 2HJHA 1P91A 2ESRA 4MR7A 5FF9A 1EJ6A 3HU5A 4B4UA 3FLEA 2IC5A 5B6JA 1KEEA 5ISMA 4HQLA 4S2EA 4DQDA 4F5YA 2R6R1 3V7FA 1KPGA 3MW8A 4PQGA 1KDPA 3A9RA 3NONA 1R21A 4DIDA 1N5OX 3AK4A 4JIWD 4C4ZA 5JNLA 3WGZA 1I9CA 4FJ0A 2XQGA 1SELA 2R6DA 4B74A 4W5TA 3FKQA 1JA1A 3GIDA 3DVSX 1OAAA 2Q29A 2XNDD 5C8DA 4D4GA 4I14A 1BOOA 1HQDA 5T5QA 3CT4A 4Q9HA 1C8VB 1PYDA 2J87A 3PD0A 3UW1A 5KHLB 3R0JA 1LI5A 1UBLS 3W1WA 1IM5A 1PWXA 1AZTA 1E6KA 1NRXA 4M9QA 4RSMA 5CIQA 3QTTA 1NULA 4PIVA 4AWXA 2FPMA 2LNDA 4W1RA 4RA9A 4W8GA 3RUFA 2F1KA 4OTZA 1RRFA 4S04A 5JH7B 4NJMB 5KEIA 4ISBA 1VMDA 1MV8A 3WGNA 5LYJF 1V6AA 2OT3B 1AS3A 3DMHA 1MHPA 1XDZA 1Y4UA 2CLKB 4FBLA 4ZOLB 5BMVA 1T8WA 1T4DA 3JTMA 4HLUA 4EUSA 1J6UA 4A82A 2OFFA 4JDPA 4YCDA 5T8KA 4ZZ1A 2WVJA 2CHUA 2Y1LA 4FMCB 2BBSA 2X86A 1R0RE 2EIXA 1GNQA 4LXQA 1XELA 2WLSA 4Z51A 1QRTA 1PNTA 1YBMA 2B7BA 4FB4A 1DCTA 1X7YA 3LY8A 3UWKA 3JQ8A 3U6BA 2QN6A 1VYTA 1WV3A 2GR9A 3GEGA 3PHCA 1BRTA 2H2GA 4HH4A 1A0OA 2JJ8A 1YD7A 4JJZA 1G6KA 1U8YA 2AMJA 3JYPA 4U7WA 4E15A 4F6CA 1XZFA 4U4AA 2JLXA 1YQEA 2WU0A 3GRUA 3TX2A 5CDFE 5JY6A 1JWBB 1A7KA 3CRNA 3LGSA 4I9UA 1Z5VA 1JDNA 2QOEA 1PT7A 1Y37A 3HKCA 3IP5A 3NKLA 4G0UA 5CUQA 3QJYA 3TLMA 3L4EA 3OZCA 3OX4A 2OBBA 2J5XA 1X1DA 5EUQB 2O2DA 5LQJA 5JAPA 3MJDA 4EPTA 1C8LA 1O95A 1G5PA 1XU4A 3CX4A 1DUSA 1MJGM 3NOOA 2QI9C 3OIDA 2FG7C 2GBLA 1XAGA 3PWSA 4FMBB 4R0VA 5AUQA 4REMA 1Z45A 3GN2A 1VM6A 3GJ6A 1IXZA 1JZTA 1UL1X 1W1IA 4QUJA 2PUDA 3EOAI 3HKEA 3E7PA 1YXMA 4OG2A 1T1IA 2AG0A 2FJPA 4FCVA 4AJIA 2BUBA 2FZVA 3HACA 1XSEA 4X1IB 3UWMA 2Y1OA 1MQAA 3H13A 4DDHA 4CNBA 1FTYA 1ZI9A 2QTGA 4NFYA 5GQSA 3EZLA 1ZZEA 4Q4HB 4ARZA 1GARA 1KZHA 3D59A 1G7CA 1H8HA 2EW8A 3KQHA 4R16A 1NA5A 4MQBA 2C9OA 3HB1A 5EZ6B 1A9SA 2HUNA 1K8QA 2FPPB 2ZSBA 3QTBA 5LZ2A 2GD1O 4K9OA 1VCOA 2HB6A 5FQNA 4AJ2A 2TMYA 3R6GA 2HDNB 4CM7A 1APBA 3MGAA 1H2HA 2M32A 2HGZA 2W0SA 1OFUA 2LP4Y 3WIOA 1QGDA 2OD2A 2GHRA 5EXEA 5IWCA 1S89A 3D6VA 3FCYA 4NYMQ 3VJMA 3R20A 4ZO4A 2JRCA 4EJQA 3GOQA 4ZQEA 4RGVA 4DZRA 3NX4A 3VGJA 3A6KA 3EIXA 4O2LA 3JQFA 1L1FA 3WDMA 2YNMC 5LIRA 5EE5B 1ULSA 4WAUA 3L2OB 2JK0A 2A9VA 2XUGA 1E2FA 2PT5A 1XDBA 2OHIA 4KVZA 2DLNA 4JSYA 5H81A 5FUYA 1EH5A 2V6FA 1E1CA 5C1IA 2HF2A 4E4RA 2EHDA 2JQIA 2A9JA 5G4KB 7ADHA 5I5EA 4G41A 4KQGA 2ZUCA 2WTMA 5C5IA 1F2TB 2NWQA 2ZB3A 3IUYA 4KAXA 3IT0A 5ICFA 2D13A 4TLBA 4CR6A 3PFHA 4YY3B 2HZBA 2E6UX 1YOBA 3L8MA 2CLMB 5AJVB 3CW9A 3A1WA 3I9LA 2HMWA 4X95A 4E21A 2R96A 1XL1A 3LO5A 4C7OA 4IV0A 4EGXA 1NYTA 1HOXA 1N1GA 3SBDA 3SZGA 3CONA 2Q21A 1M1ZA 3WGTA 5LMUB 2NTNA 3B2NA 3WAKA 2WWYA 1K2NA 4FWBA 2R6JA 2CHEA 4FWTA 4RD0A 1U3TA 1RPJA 1NW4A 4ZOBA 4DG5A 4OJTA 2V98A 3FF4A 2BHTA 1KVUA 1T9GR 3AM3A 4AY5A 3U4IA 3NATA 4KMMA 3DDCA 3OM0A 2HX1A 3GRFA 4BQOA 1U9CA 1FP4B 4BX8A 3PGJA 1KRHA 4F6RA 1QP8A 1RYEA 1EK1A 3U7JA 1OFHA 3VU3A 4IBOA 2VXCA 1L8OA 3WA6A 2GTPA 3F4LA 4CL0A 1O5OA 2FSHA 1YFLA 2FN3A 2WKPA 1LK7A 2Y71A 1AV7A 3KLBA 4IZIA 3QRWA 4JKOA 2Q6IA 4LRWA 2YYSA 4OATA 5K45A 1J70A 4MLDA 5A04A 1ZM9A 2AR7A 5AM4A 4XB2A 3UKDA 1JW9B 2ZSKA 3MRVA 4H18A 5CH5A 4AQDA 2QY9A 2Y1XA 2VSOA 1MU0A 2ERYA 3ENKA 3LK7A 3NV9A 4S1TA 4OP1A 2P2NA 5G0TA 2XA2A 4Y1FA 1KJZA 1G5TA 3G9TA 4IDCA 5JR3A 2XB6A 2YIVX 3FPLA 3PDWA 2EF1A 4OD0A 1IY1A 3AF6A 1MB3A 3BHNA 1LX7A 3E2MA 3FB4A 3PHHA 3D0OA 3FAZA 4D4LA 3IE0A 4G1CA 2HCTA 1WM1A 1W35A 2B37A 1JLLA 2XA9A 3ETLA 4XKJA 4JN6B 4PYKA 3W2HA 5KNLA 4DJAA 5E7MA 4G9EA 1ACLA 1T1RA 3FYUA 4P4SB 3WHLA 3OOYA 3M4XA 4J0DA 3ICQB 1RBMA 1DC3A 2WJAA 1O77A 1TUEA 1WHTB 1CJVC 3F9IA 3N2YA 4OQPA 4Y7CA 5ALQA 3ZGVA 4Z54A 5KMGA 3QTLA 3P9SA 1WSBA 2VYCA 4YP1A 5BOVA 3TUZC 3KOUA 1Q95A 3BA1A 1OWMA 3GPLA 2XTZA 1ZQ1A 4F7WA 2HGSA 4GP6A 5T7BA 2OVBA 1XTSA 3FOFC 2HNBA 4CG2A 5JZSA 2DULA 4LHZA 1Q0ZA 5JASA 1J0EA 2OG1A 2AB0A 4E32A 1DUIA 5EERA 5CT8A 3ANNA 1BMDA 5I7UA 2C3YA 4M6WB 1Z15A 2Q2OA 5MN4A 4GNRA 1ECPA 2M1XA 1U0LA 2HSGA 4PHCA 2PKQO 5JJLA 3QE0A 4IHJF 3AGQA 1BXZA 4F2DA 3GAFA 1PJQA 4CTKA 5JELA 1Q3HA 1Z17A 3WR5A 3U37A 4PGFA 4M0PA 4PRZA 1NLZA 2UUOA 3EDYA 4FNGA 4DSTA 3BJZA 1O6BA 3LHFA 1HQYE 1BYIA 5JAUA 1KYQA 3B1XA 3P9CA 4JR2A 6PFKA 2HA0A 3OAAA 2ZRFA 3HBLA 4N9QA 4P34A 4F46A 4FDAA 5CK4A 3GARA 3E58A 3G82C 3HR7A 4L57A 4F3CA 2WSMA 3CH6A 4HI0E 3TL2A 2GMWA 4U02A 2BR3A 3H2GA 3SYLA 1UJ6A 2PZEA 3C24A 3NAGA 3C97A 5DW0A 2PK3A 1XFAA 2XMGA 1U0FA 2A0KA 1KH3A 2JF0A 4I99A 4KH1A 1QJCA 1DKQA 2BRUC 4Y9UA 3IOEA 5G0WA 3FFTA 3DZJA 3WRXA 3ZWQA 2YWFA 2HRCA 5L3VA 2OZVA 5AVWA 1J23A 3I3SR 4IY1A 1U1DA 2IPLA 7REQB 4NYJR 3L4BC 4GE3A 1C30A 4I50B 3AVVA 1NVVR 4R1TA 4B4KA 3CG0A 2LDXA 2D0IA 1BO6A 2JJ1A 3KT0A 3OP4A 4IOJA 4S05A 2JLQA 4MR8B 2ANBA 3E8SA 1KMNA 1CVIA 2B4RO 1P39A 3E7FA 1K88A 10MHA 1EWQA 3JATB 2C29D 3HXLA 4B8YA 3KT8A 4BB5A 4O4IF 4C4YA 4E70A 2DQ4A 2JIDA 3QE4A 4N3GA 5JJ5A 4YRIA 3BZUA 3EUWA 2Q3DA 3QG1A 4Q02A 2DVMA 3IB3A 1HDXA 4HFMA 1I4OA 3WRWA 2PZBA 2O3SA 4OY3A 4NE7A 1TAQA 3UK7A 3ZU6A 5IJ0A 2BVNA 1U1FA 3HBMA 1B74A 3AKYA 2VTKA 3W3AA 2NU6A 3BF8A 3MT9A 4IVRA 2FRXA 4JBNA 4AJNA 1IQ0A 3GRVA 3SVZA 3NDBB 4QAQA 3FPEA 2P9TA 5JARA 3KEGA 3LC7O 3OTQA 1Z8NA 2HU2A 4WADA 4JP2A 3JWIA 3ZJ4A 3A2KA 3GLQA 1KNQA 2XBUA 4BNLA 1R27A 2IP4A 1XRMA 3QHAA 1UBSB 1YMQA 1H2EA 2EC5A 1OTHA 4I1SA 1JDTA 2E4WA 5K0FA 2YXLA 1DELA 3UK6A 3RLFA 5ECYA 4ZXPA 5EZSA 1ID8A 1BCSA 3ZEIA 1YBVA 1B3BA 2P1ZA 2VJNA 1D03A 3EIHA 1BWQA 3UK1A 3Q8LA 3HYTA 2Q1WA 1TQ4A 3UMYA 1P45A 1H2RS 1FS6A 1TPZA 3BDAA 3L6DA 1EAMA 2WIGA 4D9IA 3LC0A 2JCSA 1VFPA 2MIIA 3Q0EA 1X87A 2AH5A 2X2PA 2E48A 4DCJA 1N2BA 2VOEA 3T4XA 4F11A 4PLWA 4YXWA 1HC7A 2QZZA 5CK5A 2DFNA 1G1MA 4YDQA 2AD1A 3HHPA 3EXHA 4KIGA 4TS9A 2PZ8A 3HM2A 4JC5A 1UMBA 4LHSA 4RA6B 5BRJA 1C4KA 4TTQA 1S8OA 2W93A 3R9WA 2CWDA 4EHHA 1G6OA 2Q3EA 5HIKA 5E4FA 4ZI2A 2VDNB 1R0SA 1N1MA 2FFHA 4J0QA 4UQPA 5BVHA 1WDTA 2QT9A 4NU8X 1W0CA 4ZAXA 4Q9NA 4QTUB 1IIBA 1I8TA 1A2BA 3HZRA 1LNSA 1KY4A 1W8DA 4BKUA 2GILA 3LDAA 3GPCA 3BZBA 2DXIA 4O3MA 1JWAB 1SUEA 2EGUA 2J1LA 3F5DA 4BY9E 4FX5A 4B31A 1SCUA 1QDLB 3L7JA 2H4JA 2HAEA 3X1JA 1K3JA 3T4UA 2CMHA 1VB3A 1E2UA 3LD9A 3H3JA 4ND6A 3TXAA 4PN7A 3PXDA 1KEVA 1YGYA 3GF4A 4N39A 5A06A 2EKLA 4D8TA 3GIWA 2O5EA 5EIEA 2NVUB 2QV7A 1NDUA 3LYHA 4M88A 1V5WA 4TSRA 3L7LA 1Z56C 3ZY3A 2QM0A 3B6MA 3AIKA 5JCXA 4LSMA 2XE4A 3W7AA 4OK3A 4X54A 4B5KA 2JFHA 1Z6YA 3FPGA 3PNVA 4QTZA 3WL5A 3QOXA 5CA0B 5LNK1 4PYNA 2IXFA 2A5LA 1RCFA 1ZIDA 2PL9A 4E22A 2PGIA 2Z2KA 1MZKA 1GQRA 1U9YA 3F5MA 3I9JA 3IS3A 3TE7A 4A2WA 4UPDA 3T7EA 1G2OA 3HSYA 1J4QA 1Z0UA 4HFJA 3IEMA 1W30A 4P3PA 1DJNA 4Q15A 5KYYB 1ZJJA 4MS1B 3WTBA 1N5JA 2PR7A 1YJCA 3MOIA 3VYVA 4EJSC 1KJIA 1DIBA 1FU8A 3H65A 4MVJM 5I3ZA 1DV2A 2C77A 4PBRA 1DT5A 3EH1A 5E7IA 4HATA 3BWCA 1N1EA 1DRJA 2YASA 1L6RA 3HVUA 3LDFA 5A5FA 1E2BA 2YZMA 1RADA 1UOQA 4DLUA 1CJKC 1MXHA 2B8TA 3NPAA 2R1TA 2NADA 4LV5B 2V3WA 4I5FA 1T1JA 3FJOA 1AZLA 4IIHA 3IPXA 5B4VA 2BUCA 1MLDA 3ZE6A 2CZQA 4U6SA 5IHPA 3LKZA 4R4JA 5E7QA 1I13A 2C0QA 1J4LA 4TVBA 4MPJA 2RHHA 4MARA 1HX7A 1ECJA 2YUIA 3C5HA 4BNMA 3DTVA 1HDZA 3A1CA 1EVZA 3KELA 1JVNA 4IDFA 5CRIA 2QORA 2NUPA 5AVUA 2F9LA 2ILVA 2PMKA 2RJNA 5DLEA 2BZSA 2C7QA 3OWHA 4FEEA 5HX7A 1XJ0A 3M6IA 4URWR 3W6OA 4CBVA 1GQFA 4D92A 1CF9A 3R6LA 4Y9SA 1NVXQ 4YVFA 3CVOA 2H1OA 5EXSA 1M1YB 1GPAA 3DOJA 2A3RA 3EZ2A 3F9CA 3DPUA 5GGYA 3UB2A 1PTJC 4G67A 2QMEA 3P2MA 2X3FA 4KPGA 4NHEA 2PX4A 3H11A 1KAQA 3PENA 3FDZA 2P0YA 4RJLA 3ORQA 3VR4H 4JEIA 1E7QA 3NT2A 4YJKA 2CE2X 2XVXA 2XQKA 3NXSA 4WY5A 3NTXA 4KL8S 3F3MA 3B8HA 2H4WA 5T3UA 3CVUA 3G5MA 3N9IA 1J4KA 2CD7A 2IEZA 1JZQA 3B3GA 4OHBA 4ZOQI 1KZ6A 4YPVA 1QM5A 1XVIA 3CO5A 1E2QA 3MGKA 1K06A 1QVZA 4TKUA 5ES3A 3VBCA 1QC5B 4CQMD 5JYCA 1JDPA 2FQQA 2CUKA 3DYBA 3EVTA 3FXAA 3NASA 3PE3A 4GAEA 5H68A 3VNQA 1TGVA 4IIVA 4TSFD 4C9BA 1Y6RA 1UBKS 2E4UA 2JHCA 4XWWA 2Z95A 2FWRA 3RS7A 2P9GA 1MUUA 1SUIA 2ZRMA 4JC8A 3Q3JB 2HJVA 3BE5A 1Z8DA 5DYGA 3SX4A 4C4PA 2W6NA 3OZGA 4RY2A 1U0SY 2WUGA 2XRFA 3HJAA 2D6FA 2ZJ5A 4UD6A 4QUAA 4X3OA 3VPSA 2W42A 4ZQGA 1VP9A 3ISTA 3K09C 4JP5A 2HHCA 2PTGA 1Z29A 3I6BA 4WESB 3W6NA 1XZJA 1V7ZA 4A4DA 2PBZA 3DSRA 1IPFA 3UWSA 4YRAA 1VL2A 4OJKA 4YJHA 1SRRA 1QH8B 1BA2A 1YCHA 2GF0A 3TJMA 5JFOA 3NCTA 1UDRA 2ZS8A 1YFKA 4B2LA 1I6KA 3VFDA 1PD0A 4KLCA 1PG2A 1PX2A 3CWZA 2WAOA 1LCIA 3HN6A 1M67A 4HDSA 1A76A 1QR6A 4AUNA 3NIBA 3WADA 2AZXA 5E3HA 4EAQA 1M6VA 1T4CB 2Q46A 3VOTA 2KJQA 1W88B 2JPDA 3KL4A 4DV4B 2FJUA 4ZJPA 2JA2A 5AWFC 2V03A 3ZHUA 2NSDA 5JD3A 1Q1NA 3EY4A 3NYWA 1FYVA 3D0RA 4H9GA 4PC7A 5JEEA 3ZWBA 4DAEA 4BC1A 4BE4A 1EE1A 3JR7A 3SD7A 2ISQA 4EYSA 4PYOA 1QCYA 1Q92A 3DZIA 4YH1A 4C08A 5DHUA 2HO5A 3BKWA 4MVJA 3VSCA 4X7PA 2NU9B 3TRDA 1BKYA 3PD1A 4FS3A 5ENVA 5ALIA 1CJMA 2VDJA 3ESYA 1A8SA 1D2RA 3KEMA 3M6MD 4JLAA 3UJDA 3VC1A 3M1IA 3OUNA 3KOOA 4DRXA 1W2HA 1UXGA 4L6IA 3PNKA 3B5JA 2GM5A 4TS4A 2BHLA 3L0DA 5AVXA 2RHJA 2L69A 4XM2A 4AJJA 2XCSB 1ZJWA 3T7IA 1P72A 4KCGA 4PLTA 3O5AA 2ZE6A 1ZN7A 5LLSA 1HG1A 1A8HA 5IVDA 2Z83A 2JC3A 2P4SA 2OHFA 2YIDA 3B6EA 5G3YA 4BGEA 5JVDA 1RAEA 5AJTA 4R41A 4ZAFA 2AMLA 1E7RA 3CUVA 5A3RA 1L5OA 4PBSA 3CPHA 1VHTA 2OO3A 3ZWXA 2AHRA 2J9GA 5F4BA 3LY7A 4NVRA 4BFTA 2G9NA 2ZUTA 4MUXA 4UHKA 1V9SA 1WPXA 1N6LA 2RHLA 4OK6A 1U3WA 4ZQFA 5J2TA 3U7HB 1VTKA 1FSGA 4GI3A 4NF2A 1PVDA 4Q82A 1VI6A 2ORED 2IZ0A 3QMMA 5FTMA 2ALJA 4N8SA 3UAYA 4LRTB 2COUA 2DMRA 1P2GA 3H42B 3HL4A 1M7HA 3EOZA 2N47A 2RI6A 4I55B 4FKBA 4I4CA 4KDRA 3UEOA 3LXMA 2OY0A 1N2ZA 3EFHA 5AKEA 2B25A 5HG0A 1A7AA 2WA2A 4B4WA 3OZXA 5BORA 5EPEA 4QECA 2FY8A 2XCIA 2Y1DA 3Q0IA 5IM5A 2UZ1B 2PL1A 3ICPA 4CDRA 3B20A 3IUNA 4CW7A 5IYZA 4RDCA 3FBTA 4XYEA 5BWMA 3VR0A 2DBYA 2GX6A 3C6YA 4M1MA 5JRJA 1E3IA 5EE0A 2K5UA 3QEMB 3UV0A 3RSHA 4REOA 4WCFA 3QVGA 5FL7A 4CGYA 1E89A 4AJOA 3WNBA 2QN2A 4W5RA 1GSIA 1YDHA 2Q8PA 2VYNA 3CZAA 2Q45A 2Z8ZA 1FMLA 3H6GA 4ZO8A 3ZWDA 3WXBA 4B7UA 2ZYHA 1C50A 1C1XB 1Z73A 3P97A 3B9PA 5C7LO 1KYWA 3W1VA 1ETHA 2I7XA 3KVRA 4HRAA 4YRRA 1JFFA 1QIMA 4R8SA 4IF4A 2VZ8A 2VI5A 5HKAA 4QYIB 3FTDA 1V9CA 2F3TA 3VYWA 1FFGA 2V5UA 1LK0A 2Y8EA 3I45A 4BLSA 2CJXA 3H5NA 4XLTA 3U3OA 1JU4A 3E3MA 4M3NA 3ZH9B 4B3GA 4CVNA 3ANXA 1KZYC 3H5VA 1I32A 1DV1A 4F1JA 3U4AA 1GT91 3O9ZA 5D7NA 2IHTA 1E7WA 1RFLA 4OLJA 3ABRB 4D9GA 4CUKA 2WF5A 2C3PA 1D2NA 1YQDA 2FUCA 3QPCA 4KPEC 5K2MA 1HTBA 2XVYA 3KSDO 1P60A 1HFWA 4G2TA 1J2EA 3PUIA 1ZOOA 2ZTSA 5FYQA 1Q3KA 3G8AA 4Y30A 2HRBA 5EZYB 4N1AA 1EB8A 4A73A 3D4LA 3GJ5A 3VVCA 3PNQA 3R7BA 3N86A 1WOMA 2AOTA 4IOKA 5TGDA 4UVHA 2WHQA 1X8XA 4WNAA 4EDFA 4Z9FA 4KDEA 3CUYA 2IEYA 3PR3A 1RWNA 2DFDA 3A6EA 4NENB 4P22A 5DWVA 1SD1A 4E5MA 2FPUA 3ECAA 1QTRA 4BFZA 1KBOA 1B1AA 2NIPA 1NJ1A 1FDTA 1HR0B 3FFXA 1KTVA 3MT0A 3OEED 4WXRA 3U81A 1L5MA 3IOBA 5IF3A 1H42A 4ZYZA 3F5FA 3DDZX 3UMRA 1SD2A 3KQOA 3OUZA 4PPGA 1BX1A 3ZUPA 3FNEA 3YASA 3X2EA 4R1LA 2PTHA 5AKLA 3R7LA 2I4LA 2P6RA 1OI3A 1R16A 1ZLXA 1J8DA 1TQDA 1X2BA 2KQUA 3AEKA 4YAOA 4YT5A 3RC7A 2XSZD 4D5GA 5EWJA 5BUCA 1GL6A 2BGTA 2NT3A 4M0LA 1OHHA 5FL3A 3IRVA 1T2NA 4FXPA 3FE2A 1W6UA 4PFSA 4URUR 3NHLA 4CL2A 3WAGA 5EXTA 4ZIRB 1TI7A 3PFFA 4L9AA 2X22A 2J3QA 3PE6A 4Z4EA 2FOXA 2KM1A 3GLHB 4OHCA 1SQFA 1PJRA 1SVSA 1U8AA 2AIRA 3SYRA 2CSWA 1R6UA 3DB2A 4EOGA 3MB5A 2XVZA 3N2GB 4F3RA 5I4BA 5C8XA 3A04A 1PSWA 2DBZA 4D79A 5CVJA 5D5PA 3PF8A 2IX3A 4UATA 3ERCA 1COZA 3WLJA 4RY8A 3ZQKA 2ZCUA 2JZOA 4L5AA 3OSZA 1T0IA 2Z4SA 4PO9A 1NC1A 4Z7NB 5CJ2A 4BMVA 1UZNA 4HZGA 1IXSB 4HGPA 3WWEA 1KH2A 1R3DA 3ZGLA 1QV9A 1XYVA 2FF5A 2WIFA 4XDYA 4LV8B 1B8NA 1PGPA 4NFHA 2D1QA 4A0RA 5FUMA 1C7ZA 3C1AA 4GBJA 4RIEA 1QHSA 1N5MA 3VDMA 3BAZA 3JZFA 4RANA 5K3BA 5A4MS 3HRKA 5JV5A 4LZOA 1I80A 2K4MA 5D3MB 3DITA 4IGFA 1FMTA 1PV1A 1QLHA 3EAGA 1WR8A 3BK7A 3RS8A 3X1MA 4BFYA 1YJQA 2X1MA 4NDZA 1I7PA 5E4YA 5F9FA 2ATCA 4NZZA 1BS9A 1EBBA 4UHBA 4HSEA 1PJLA 4BQEA 1U2RA 2ZUDA 2BGWA 4G5RA 4DUZB 2VG8A 4RZSA 4C0KA 3OZWA 4XYLA 2O8DB 1UBRS 2I3BA 2F3QA 1R7RA 4H4DA 4WBNA 4CJXA 1OMOA 2LIPA 3ZVRA 3DT6A 1UBMS 4QWMA 5FNVF 2FR8C 1HMYA 2GYWA 3OT5A 4PZUA 2CDRA 4U5QA 4X1OA 2CDAA 5J4LA 1UPCA 4TMYA 2X2EA 4FZRA 5HE8A 5IVKA 6ABPA 3QU4A 1PWHA 3R5HA 4ZFNA 4YCMA 1K7XB 2WTBA 2YHSA 4BLVA 4POOA 2AJ8A 4FFRA 2B1GA 2X42A 3GLSA 1CS4C 3L7KA 1L7QA 1YQXA 1SBQA 1QHEA 2AEEA 2FPRA 421PA 5BV0A 1KWKA 2YFKA 3R41A 1IQPA 4X63A 1CETA 1PL6A 3Q85A 1T5IA 4LGCA 4PLZA 2C2KA 4QD3A 4MRMB 3ZE9A 3F6EX 2REOA 3F7MA 1N7JA 2C57A 5BN3A 4QGBA 1QMPA 1C1YA 1Y4ZA 3LA6A 5D01A 4D3FA 4IUYA 3O8OB 4M89A 3FCEA 3FSGA 3ESRA 4H08A 2RMKA 3AUAA 3OPNA 2O3UA 3NKFA 2DHEA 3PWKA 4G1MB 2XXAA 2V9ZA 1L5QA 4HTFB 3RREA 1KERA 3D02A 2XUQA 3GGSA 3D3WB 2VUHB 1DQRA 1Z28A 3FMPB 3SC6A 5DK4A 4QREA 2XWBF 1IHXA 1KSFX 2ERCA 3ACBA 3I9NA 4HNSA 4HY3A 4KPUB 1RDFA 2AFIA 4FHGA 3QU5A 4IUCS 1PR4A 1SU4A 2FPKA 3MSCA 4V1CA 1O95D 2IH2A 4JI0B 2GBIA 1VJRA 2B4KA 2H9IA 1KYZA 1KMMA 4KVAA 5I7AA 1EJ2A 3DMDA 1P2SA 2X23A 1ZK2A 1PT8A 3K4PA 2OORA 5FJJA 4C1NA 2G80A 3TZLA 2PAAA 3HDHA 3GMSA 3NZEA 2VZLA 2QD3A 3O0TA 5EJ2A 3F0TA 3RHTA 1VRVA 4NL4H 2VHJA 3GP8A 1ULBA 1D5WA 3HDGA 1E2PA 1ZVJA 2C42A 3CF6R 4U2DA 2OKCA 4TQ9A 3EZ7A 2H17A 2VJOA 2H3HA 3EA0A 1S1MA 2JFXA 2BF4A 1UBTS 4LJ8A 2FA9A 4ZAVA 5CB6A 2VJDA 4R51A 1QBGA 2QUHA 1WKCA 4ENWA 5JCJA 3QKUA 4FW9A 3GPDG 4P7JA 5J2UA 4RLQA 2A7XA 2EL9A 1RAFA 2W6IA 3WV5A 3ZGXA 1JEYA 3BORA 3RUCA 3JQGA 3QPUA 4MPRA 2JI8A 1WIWA 1RE1A 5CNJA 1GL7A 3HLTA 4BIIA 1WX1A 3ISVA 3MWJA 3NTQA 4WXYB 1GDHA 2VP3A 3EZXA 3N0VA 5FTJA 4ALMA 4RXTA 4L3WA 4IVQA 4UPEA 1KQNA 2P91A 4D9KA 1P18A 1L9KA 2FEKA 3F4BA 3OJWA 5EJ8A 3ZX4A 3K96A 4JVNA 3E05A 1XPUA 2DU8A 2OV4A 4CMBA 1E1LA 2KBEA 2R85A 3VNSA 3ADBA 4M2LA 4YX9A 1NN0A 2AX3A 3BRSA 2G0TA 1E3WA 5A71A 3O8RA 4JKYA 1LC0A 2NO4A 3ZDEA 5BP7A 1L1QA 4AN0A 2MJLA 2NU8B 3LUAA 5BPHA 4OQNA 1TF5A 1EBUA 2R751 1UJ2A 3SFTA 2HHLA 2X41A 3FYTA 2CXRA 3N8NA 5DBEX 4JA2A 4Q93A 1D2GA 5L3ZA 2NU7A 4DF3A 2VNHA 2JGJA 3COYA 1UXJA 1C3VA 2DFTA 5L7WA 2WD7A 4YAGA 5J43A 2E3JA 1BN7A 5JHHB 3K72B 4OXNA 4GBED 2XNCA 2GAAA 4C29A 4OCZA 3V7WA 1GQQA 1N5IA 1COWA 5JERA 1Z0DA 2R5NA 5FUQA 3U4MA 1V5GA 4KE8A 2I1WA 2D1TA 1KQ3A 5F1PA 4ZXFA 4ID9A 3KAPA 3T5BA 1O94D 3EDCA 1D0SA 3VR6A 3RWM