5EJGA

Crystal structure of nad kinase p252d mutant from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
262
structure length
253
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKKEATYLALNESTVKSPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFDFWRRVHDSFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NAD kinase 1
publication title Crystal structure of NAD kinase 1 from Listeria monocytogenes: P252D mutant
rcsb
source organism Listeria monocytogenes
total genus 62
structure length 253
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5ejgA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5ejgA01
4WERA 3V7YA 5DHTA 1U0TA 1Z0ZA 2I29A 1Y3IA 2I2CA 3VZDA 2I2FA 2I2AA 3PFNA 5DHPA 5DHQA 5EJFA 3V8QA 2QV7A 2AN1A 2I1WA 2JGRA 3S40A 3V80A 2I2DA 1U0RA 2Q5FA 5DHUA 1YT5A 4V24A 1Z0UA 4HAOA 3VZBA 5DHRA 3V7UA 1SUWA 5EJHA 4DY6A 3V8MA 5EJGA 4WRRA 1Y3HA 5DHSA 2BONA 3V8NA 2QVLA 2P1RA 3V7WA 5EJIA 4L02A 3V8PA 1Z0SA 2I2BA 3AFOA 3T5PA 3V8RA 3VZCA
chains in the Genus database with same CATH superfamily
2CXTA 1IXSB 3NTLA 4XDYA 5JSZB 1EUDB 3X1ZA 4UNSA 1YI0A 4V02A 3PXGA 2CL7X 2PH1A 4F56A 1J56A 1I7NA 1X1BA 4E6EA 2NVUA 2XNDD 2KKLA 3KL2A 1EUZA 1FTWA 2GI4A 4P92A 5A9RA 1ORWA 2K87A 4P82A 1ZNQO 3KZOA 2GO7A 3EBOA 1ILEA 1M0WA 4GX2A 4Y7DA 5JZVA 4YRLA 3QV2A 5CVEA 3MLAA 4PXYA 2B1GA 2IP1A 4XYMA 1OHHA 3X2FA 1ZXXA 3EDYA 1U4SA 2P0AA 4YGXB 3EEYA 4FYJA 4KFRA 2HDNB 2XDWA 2XCIA 1WDLA 4BCDA 2PRJA 4FHEA 2FZCA 4HN4B 2XOKA 5JXHA 1YR9A 3KKMA 2NMVA 2AKYA 2C42A 1ZU4A 3IEPA 1UH5A 4TM7A 5TLSA 3U2QA 2WPDA 2YXDA 1IQ0A 1SXJD 4L95C 4C30A 5I4IA 3Q10A 2OPBA 3HHEA 3ZNPA 3UXMA 2CFSA 2W6PA 4J3NA 3LT0A 4R9VA 3EXHC 5DOZA 5CLLA 2QVXX 3LWBA 1R6DA 1VLLA 4BP3A 3G2PA 4AN4A 3G3EA 4WLNA 3VNAA 1CY0A 3DB2A 1B73A 4F3NA 4OUKX 2RKBA 2AW5A 1U90A 4U2CA 5BVGB 2FSIA 2H2WA 2RH9B 4IHQA 1YTUA 5F33A 5FNVF 1P5RA 5DLEA 2ZB2A 1LTHR 3L7DA 4L76A 3VSEA 3AFIA 1L7VC 2C9OA 2WKPA 4G26A 4I1OA 1GPMA 1VLQA 4G8CA 5AW9A 2ZUTA 3DWGA 1DBVO 1DO0A 1GD1O 1KK1A 1QE0A 4B75A 3FXAA 2KB0A 4F4DA 4LDRA 3M70A 2JKVA 2NVOA 1COWA 2ZB3A 1ZUNA 2HO5A 5JVDB 2BI8A 4OX9B 3W8NA 1R50A 3BG5A 3ADOA 3O74A 2NZ2A 4H4EA 1T5DX 3VOTA 3FZQA 4LJSA 3ZLUA 2UUAB 2XMGA 5CA0B 4FS8A 1PQPA 4KL8S 1IBMB 4IJMA 3RUHA 1A4XA 4E14A 3QELB 3I92A 4OB6A 1EX1A 5L3SB 2FH5B 2I1VB 4O2BF 1CUXA 4G5XA 3AILA 3TS1A 4Z5XA 5LDHA 5TEWA 3WGMA 5CAEA 2PTGA 4WMLA 2C1EA 2BUCA 1XMXA 3KR9A 3LT4A 4WA8A 1YV9A 4KO4S 5HWSA 1SOAA 5BW5A 3AV0B 3M6FA 4UNPA 2QTBA 2CMFA 3WBBA 1QYXA 4PNEA 3ODPA 4F8EA 2R4UA 4P3OA 4O3MA 1VHJA 3K0KA 4LXGA 1XG5A 2IXAA 4OATA 3UUFA 4FYMA 4JBHA 1W6UA 1C7ZA 1QO7A 2G77B 2C1ZA 1IVNA 5EKTA 5ILQA 5CEEA 1C1DB 1IHXA 4HDMB 3E2PA 2PUHA 3U0VA 4OI0A 5CMLA 3NCHA 1HORA 4LOKA 1KU6A 2HPHA 2FPPA 3AI3A 3GG9A 1MIOA 1XL1A 4TM8A 1N3BA 2G82A 4PC7A 5E7QA 3VVCA 5C7IO 4MWZA 2IZOA 4MZDA 1YRAA 3C6MA 3EK2A 3VYRB 4EPTA 1PR0A 2BM8A 2W11A 2XWBF 2AN9A 1IY0A 3IUSA 1JJBA 2JASA 3UUWA 5BQ3A 3V4OA 2AKAB 1I0IA 1MOPA 2CLEB 3LLUA 4G0QA 4HYEA 4CQLA 2BP7B 2P2ZA 1S9HA 3HBAA 4MPDA 4ZCLA 1UWCA 2A9OA 1LPMA 1TXGA 1JU9A 3DQQA 4WXYB 1XU4A 5CHYA 1BMFA 2AC7A 1ECLA 1LH0A 2DQ4A 2Y8EA 3G5TA 7GPBA 1ZUIA 5JYCA 1C30B 2C2GA 3BMNB 1S0UA 1QP4A 1Z2AA 2EAUA 1P39A 2VXCA 2WHQA 4JP5A 3U1VA 3WZLA 4EWLA 3N70A 3AU9A 2HTFA 3PHIA 1T9GS 4MHOA 4ZVSA 2IXBA 2J67A 5GOTA 1ZMXA 4JBWA 4WZ6A 4P54A 4CUJA 3UN1A 3FDJA 1UF9A 3AEKA 2JLWA 1J06A 2FXIA 3F4BA 3LNTA 4JJ8A 4EYGA 4H77A 2AZDA 4KN9S 1NVMB 3WGQA 3FUUA 3VA4A 2PFKA 1DPGA 2YICA 3CNHA 2I55A 3MHPA 4PLCA 3TH5A 3U16A 1IFXA 4KR6A 3STHA 4MDYA 4L8VA 1ZA1A 3RKRA 2IXEA 2GS9A 1U7TA 2HC9A 4P58A 1X1AA 2IU4A 3ZX5A 5BSFA 1DNPA 3BFXA 2OV3A 4XX0A 3AUTA 5AR1A 4C06A 3H2JA 2RC6A 3INGA 1NW9B 3GA0A 1ZIPA 1T2DA 2PGXA 2ZRFA 2GEFA 4B6EA 3OKFA 1K8ZB 3VFDA 1PGQA 3WDSA 1EGHA 4U7DA 2Z2IA 2PN1A 2M6RA 2UUOA 1IQRA 3VU9A 3PX2A 4GM4A 4UU1A 5DWQA 1RPJA 2C3MA 3DEJA 5D5HA 1L1FA 2VQ3A 1EVQA 1FQWA 4I99A 4ZO9A 4EF5A 2F1IA 3S29A 1BNCA 3C7KA 3MSCA 4R1NA 2QAJA 5DCLA 2YWFA 1MUUA 2DE0X 4GPD1 1CY8A 1KO1A 2IFTA 2IYFA 4N47A 2R1VA 4MV6A 3GY0A 5HVNA 4L22A 3R7SA 1AXGA 4CU2A 4X1IA 3K15A 4Y1RB 4MCAA 3CE6A 3DE4X 4LJKA 3TL6A 3LFHA 3WLFA 2BJWA 3IT1A 3ZDZB 1ZQ1A 2B8NA 1OLUB 2O1WA 3CVOA 3ENVA 3L8FA 1PJQA 1UDCA 3RSFA 3THXA 3MG9A 3DEAA 2Z83A 5K7SA 2HF7A 2QY6A 3F0TA 5CVUA 2PT6A 3GXBA 3OHSX 4S12A 2B6NA 3DEFA 1G3GA 1TYAE 3P2IA 4JB2A 4B2YA 1Q83A 5GJBA 4YJGB 4DQUA 1GTVA 1N36B 1X3SA 2VBIA 1DC7A 2GZRA 4P3NA 1M10A 1T6BY 1YR1A 3IQEA 3OZAA 1YH3A 2JGDB 4GM0A 4K0RA 1Z7EA 3W4KA 1DFGA 1ENPA 1I30A 2X1HA 3K2BA 4R8RA 1L5FA 5G0UA 1E79D 2EHDA 5BPHA 1E6LA 1N3YA 2F55A 2O07A 3X1XA 5EIBC 3N0TA 4DCOA 2GD6A 2B6HA 2REQA 4PBSA 3GAZA 4TWZA 4D4LA 5A2GA 3HLTA 2CD7A 2Q6TA 2GSWA 4IFEA 2KLBA 4OBWA 5I9NA 1DT3A 2QT9A 4CIDA 5JSFA 5A0TA 1MB4A 4A2QA 2IW1A 2Y1CA 3CZ4A 1KYIA 3DOFA 1P2TA 1VXOA 4RVSA 1CP2A 3TLGA 4A1FA 2ISQA 3H5LA 3UOTA 2ID4A 3FYUB 5JXIA 4X71A 1ISIA 2VDRB 6YASA 2ZUDA 1LSUA 4JNKA 4OQXA 3W5SA 5AICA 4BTVA 3UY4A 1JG2A 4WTOA 4ESEA 3RJ5A 2FV8A 1O89A 2BCGY 4PHHA 2JD1A 1NW5A 5F3DA 4KMOA 4QYIA 3TIFA 3GLIA 2XCSB 4IG9A 4P53A 3WOHA 3I61A 1KBZA 1V1JA 1E9BA 3PF8A 3K7EA 5EUQB 5SYNA 1W76A 2Q5OA 3F7OA 3QVOA 3KCNA 3TDKA 5IAKA 3H5NA 2BR4A 2B37A 3IC5A 4PRKA 1RYMA 5HS4A 4LFBB 5HP4A 3PO8A 5DRYA 3DAPA 5FNVA 3E23A 3ZKWA 3HN6A 1TYCA 1S8FA 1ZBDA 4X8OA 4ZRMA 2OC9A 4KIJA 1PFQA 5CG1A 3JQ9A 1K75A 1FP4B 3ONNA 3WXMA 3U4QB 3ZGXA 2YC2C 4D9GA 3KSZO 4FEYA 3VVBA 5SZJA 1E1DA 1H5UA 1T8RA 3RBVA 3D0RA 1P19A 4G67A 4O0MA 2HA0A 3WHPA 2IUFA 4CM9D 3AEUB 4EPWA 5F23A 4RTRA 3TSWA 3ZHTA 4WERA 1J2JA 2P6OA 2FPIA 2IYYA 2WLSA 3IELA 5DN9A 5E0OA 4B17A 4F04A 3NH9A 4BO7A 1RAGA 4BFSA 4Z4FA 4M89A 1JYFA 1OBVA 1FBNA 4E5MA 3D2AA 1NHGA 1CKEA 2VXOA 4B33A 1DAHA 5D2CA 1SPBS 1M1YE 3O8BA 1N2OA 5BR4A 3UMYA 4ARSA 2GXAA 5EKUA 1JXAA 2XXJA 1WUHS 4PX5A 3UPDA 5FNZA 1KQGA 2PJDA 2JFGA 2YOGA 1TZMA 3WYDA 2C2HA 1XVTA 5LP6F 3C7CB 3U60B 3BZUA 4JAVC 4D79A 4ZVKA 1ZLXA 1GRQA 1UKCA 3D2CA 2B3DA 4DDTA 5LU9A 2R5FA 5TPWB 1EH5A 3IKJA 3K0SA 3GNQA 1RLIA 2QW1A 4F5ZA 3CCFA 2J33A 3GV0A 2Y0EA 3CRVA 3FVWA 3GUYA 1N0HA 4HAXA 4TL6A 1UBGA 2CDRA 4MVJF 4X41A 4Y67A 3N3AC 1G1MA 2I2CA 2HIHA 3UPTA 4FCWA 1CQIB 1SQ6A 3BRQA 5IT4A 2CC2A 2F4NA 3KEGA 5CG2A 5AI9A 5D01A 4I4TB 3EPKA 2M1ZA 1OYOA 4QQRA 2DHRA 1A7JA 1JSCA 4Q7QA 3KEFA 4MV5A 1KMQA 2HJGA 3NP7A 4OJQA 1VPDA 4M8NE 3L02A 3AVXA 5AKKA 1U5AA 3LGSA 4LE2A 4BQNA 4G3XA 1EFVA 3HJFA 1VRVA 2C8JA 3WB0A 4R7ZA 3A1SA 2LKDA 3AW8A 4DBZA 5MGBA 1DAEA 4BU1A 2P3QA 4I4IA 3M5WA 2Z30A 2VEOA 2XMRA 1O6CA 4RLQA 2C4HA 2IVZA 3GCGA 1N6KA 2IV7A 1UADA 4P34A 2P9ZA 1JHAA 3AGQA 1J2TA 1R8QA 3ESZA 3I5MA 4J0QA 4J0DA 3EGCA 2XT9B 3RSSA 4LZAA 5IUJC 5G1PA 2JQIA 1KEPA 1OX6A 4RFLA 1M54A 3R6WA 1UDAA 4WUVA 3A1VA 1UAGA 1J4AA 4WNCA 1N5KA 1RYNA 3SSOA 2WJ3A 5MFPA 5H02A 5GONB 3BIOA 3OPXA 3WGZA 3HR8A 2WV7A 4M8LA 3RPEA 1FTGA 2QSUA 3DOCA 3FETA 4JITA 4EJSB 4DUZB 2IIQA 2OUKA 3UV7A 1E3QA 4MUBA 4EG7A 2GM9A 2XUHA 4DIFA 3H2ZA 3IXQA 1OPXA 2ONYA 3NOOA 1ZIDA 2FLVA 2Z5GA 2JGLA 4I1RA 4I9HA 4FINA 1GHTA 1QAOA 3KR2A 2MR5A 2QF7A 3OT1A 2O2DA 3ZQUA 5LC1A 2Y1DA 1U63A 4ALJA 1UWKA 3JAWA 4PC3A 1PCXA 3DP7A 4QUEA 3WICA 2QL9A 3TUIC 3JVVA 3WA7A 2OBNA 3H2GA 4NY1A 3R9KA 1QS0B 4DR5B 3AC0A 1IJEA 3GH3A 1FP2A 5BSVA 4NBRA 1EAMA 2QI9C 4DAOA 5K01A 3PDWA 2NPIA 2FWJA 1QIIA 1FXWF 3BB3A 3EGWA 4GSLA 5BO5A 3ZUGA 4FSDA 4BP1A 5E2AA 1V4NA 2HAEA 4E5NA 1WZ2A 2AMVA 4QDZA 1A7AA 1A88A 4YRBA 4YMWA 1HE4A 2VWHA 5D3KA 3UTDA 1ZM4A 4KAFA 3MPUA 5INTA 1SUCA 3W8EA 1C3XA 4YRKA 1YC5A 3LK7A 4U9IS 3E22B 3SF8A 4FHCA 5KQRA 2O8CA 1LJLA 4YP0A 4H7IA 2VG8A 4UFOA 1HL7A 1R6AA 1V6CA 2WD8A 3MJSA 5ARDA 5FBKA 3IPXA 1NVFA 1XQWA 1Y4AE 1OZAA 2IYVA 4OHMA 2PA0A 2C4MA 5DGXA 4NIMA 2BD0A 3F47A 4O4HB 1JFFA 1QVRA 4LZPA 4DZZA 1TYDE 4PLZA 2JBWA 1Q14A 1RJ9A 1VSTA 1XXHB 1YS6A 3KUUA 7MDHA 3T3DA 1WS6A 3Q98A 3UATA 4W5WA 1VMKA 4YAKA 5FWYB 5K0CA 3W5DA 5JMWA 1JSXA 4RETA 1Z88A 1C9DB 4IXWA 1TUEA 5E6SA 4EHAA 2RI1A 4B4KA 1MQSA 4HG2A 5T4EA 4CKBB 1GRCA 2V8OA 1KDYA 2PNJA 2IUEA 3OMXA 1XMSA 3PQ8A 3CNOA 4UHDA 5HHTA 3HP4A 4KFCA 4HFMA 3O3OB 2I6QA 1OXUA 3BYZA 3QUTA 1IRIA 4IRUB 4WRRA 4QOSA 5JLJA 5EKSA 1XCBA 2PUTA 1F20A 4LXYA 2PGIA 5D8DA 3HXLA 4F6CA 5C81A 3W4JA 4WLEA 5J59A 3IIEA 4C1NA 2IS1A 2NU8B 1DLIA 4HY3A 3M2TA 3BWYA 1K8XB 1CTQA 5EMMA 4ZC8A 5AW6A 5GTDA 3EQ6A 4GR9A 3FHTA 3WSVA 3FKJA 4Y2TA 1NZDA 4JEIA 1GY8A 1RHRA 1ZJ6A 5HBGA 4PAOA 4I6EA 5JOQA 2GJ8A 5A1TA 2QJTA 3RAJA 1NXVA 5BSHA 1NQAO 1B3RA 2O48X 4UAUA 3VR1A 3GEIA 3ITKA 3QENA 3AY6A 3N28A 2ZT5A 2HCTA 1L4YA 3QA3E 4MAAA 4C0WA 2AQKA 2PYDA 1G8KA 1R9NA 3GA5A 3X2EA 3Q8MA 2NWQA 4XR9A 1TYBE 2ZYDA 2QLFA 3NHFA 3TNDA 4QOEA 1KEUA 1UFRA 4XD2A 4F5YA 3AVTA 4QASA 5I5EA 2LTAA 1DL5A 1E6KA 3OFJA 3IO5A 3OPNA 4PSVA 3VU0A 2NO7A 5LA6F 2TMKA 1Q57A 2ZTSA 2ZULA 3VZRA 2PMWB 1S2LA 3CGWA 5JDCA 1XU9A 5JQWA 3ELSA 1U9JA 2D0DA 3IAS6 4IUBS 4RZUA 5KNDD 3G59A 3IPLA 2PNFA 4XWYA 5IF9A 1CW2B 2FK7A 3RODA 2IPAB 4V0MA 2B9VA 4KWIA 4EZBA 4BRWA 3FCSB 3ZJTA 4FFVA 4ARUA 4TVBA 1A4UA 1BE8A 2QR5A 2CFTA 3OE5A 3PQ5A 4U3JB 1AUVA 4KUHA 2Q4BA 2V7PA 3QEOA 5DGHA 4DT1B 3BMOB 4KXLA 2DZDA 3PA6A 1RLJA 3OA0A 2Z1NA 3NOQA 3ZJ5A 4Q02A 2QT0A 3PJRA 2IZ0A 3KNZA 1P74A 1NAHA 4WHMA 1GEGA 5CGZA 4Z0TA 2PL1A 2BGWA 2XNKA 3Q9SA 1E4EB 2P9QA 5ALFA 3BH6A 4F5EA 2JQJA 2QUHA 1O5IA 2ZP1A 3OLYA 1LD3A 3H5WA 2KSQA 1Z4PX 4OI4A 4D92A 1XRNA 2WTXA 5BSWA 4YP1A 3DV0A 1DRKA 1V7QA 3UMFA 5JNWA 2JARA 1BQ3A 2LKCA 3DLCA 2R4TA 1H8ED 1K3FA 3MYRA 2QAIA 3RIYA 1DKMA 4ZD6A 4WNYA 1SBYA 3L7OA 2CUNA 3EZLA 5JBNA 1QQTA 1QCCA 5DM1A 1OD6A 1RM4A 5DIZA 4RY9A 2CXHA 4FTWA 3ONVA 1KFEB 2FJUA 1Y3HA 1JDPA 3BTSA 4C4OA 2BKLA 3EEFA 2JGMA 3VVLA 2WG2A 5FYDA 4Q5IA 5K5EA 4DR3B 2M6SA 1T43A 1L7MA 3N58A 3OQIA 2FP4A 1A98A 4TS1A 3RRXA 2B25A 1CUDA 4EA6A 1JWLA 2E4ZA 5E2IA 2FK8A 2VJCA 3M83A 4IFBA 2WT9A 3JPWA 3B6KA 2D5AA 2QXYA 4D96A 1OTYA 1P17A 2OHJA 4E46A 1ONOA 2V7BA 3CJQA 4IIHA 4ZEWA 4DVJA 1BG6A 1WNFA 3HU3A 4IEFB 3JSXA 2CLIB 3N3BC 4PVDA 2GYVA 5K0EA 3IEKA 1KP2A 3NU1A 4GKAA 9LDBA 1NF2A 3FOZA 2VHVA 3WIEA 4YUAA 1GZ5A 2MINA 3VDRA 2Z5VA 3BXOA 3UOAB 1T5LA 2AZXA 1W88B 2AZ4A 2H2GA 3W0LB 1NXPA 1IXYA 4PLPA 2QM7A 4YJ2A 1EA5A 4I19A 4JP1A 1V43A 2J7KA 2IYQA 2QEQA 2Z3WA 5IJXA 1JLMA 3D0QA 4QCJA 1IJBA 2P1ZA 2PX5A 5ALIA 1ZC3A 4G84A 3I4CA 1CJKC 4PSAA 3WLKX 2R8XA 3SICE 5CITA 4L5AA 4MCHA 1ZJ4A 1TJNA 1TEZA 1CYDA 2BM9A 1KYYA 1QDLB 1WSBA 1Z34A 3ME5A 4E88A 2FQQA 1FVFA 2NPOA 3PDIB 3U4CA 4YCLA 1I1HA 3QBJA 3O4HA 4WOBA 4WNAA 3TQHA 1YS7A 2P35A 3LDGA 4LXTA 3JASB 2HEIA 2R7AA 4MRMA 3ZCRA 1FYWA 3ZCPA 3H8SA 1APBA 1GPH1 1FUKA 2GBFA 1IVYA 3DKIA 4DWOA 4AVYA 4ZZ1A 4GMFA 1FXWA 2NO6A 3K0AA 3K6KA 4I81A 2PQ0A 2AWNA 2HMTA 1Z75A 2FCAA 5EEHA 3MWKA 3EMBA 3EX7C 3JX9A 2FFJA 2GNOA 3KQTA 2PMDA 2WFZA 3KTAB 3JCZA 4G09A 5EUBA 3SX2A 2PUEA 3TTXA 3PYMA 3EF3A 4AF6A 1JJ7A 3NW9A 4NJOA 3TW6A 3TKLA 2V7QD 1F60A 1AZLA 3QGMA 4G0OA 4BV2A 5LWHA 1T2EA 4MUXA 4JC0A 3KALA 1P7PA 3IMEA 4F21A 4EYKA 1M6HA 3GLHE 5B3KA 4J75A 1HLDA 1XTVA 2C8KA 4JQCA 2AG5A 1TFUA 2J1LA 3VU1A 4HEA6 3VZPA 3V9AA 3VGPA 1JEAA 1KKUA 3G5UA 4F1WA 3PC8C 3H84A 5E38A 4DV1B 4DANA 2II6A 4HGOA 4QUAA 1QWOA 3SG0A 4DV5B 1MX1A 4M2LA 3AI2A 3EZ9A 5T41A 4G9BA 1P4JA 1VLJA 2W37A 3DAOA 3O1LA 4ALLA 4IQ0A 2ZUEA 3QQPA 2RHCA 2WABA 3UJ9A 3L8EA 1RCUA 4WCVA 2GT1A 1GNLA 3AR5A 3BMXA 2E82A 1US8A 1VLZA 1XTPA 3NONA 1ZUD1 2IYLD 4AJNA 2QNBA 2W6NA 4HP8A 3T9FA 1GLNA 1VTKA 3X43A 1Y37A 3H6KA 3M49A 1FDIA 3QKRA 2IL1A 2ZBPA 3CYFA 4YMGA 1KNQA 4A6XA 4IEEA 4ECAA 2CHQA 3LAWA 3MT9A 3D1VA 2F17A 2W3OA 2OV8A 3BQ9A 1ZFNA 2B8TA 2DFKB 1GA6A 3DDNA 4G0UA 4TTIA 2Y6VA 1R15A 3PDJA 5ICMA 3CEMA 4WJZA 1RNLA 3OP1A 1G0NA 2F7SA 3DLIA 5LYJA 5TV2A 3GZNA 2OT3B 3AFGA 1ZNZA 3L46A 5E4FA 1Z4LA 2Z4TA 5K3BA 1X2BA 2OECA 5IN5A 1C9YA 2ISCA 1SRQA 5JYDA 4OQLA 3HA5A 4X66B 2EDCA 2F48A 3ACCA 4DIUA 1SB9A 4ZGBA 4PXSA 4IDPA 3T6KA 4ZIRA 4A91A 3FOFC 4XIYA 3OETA 4E03A 1QK5A 3RV3A 3UMMA 1LS6A 2ZYGA 1KSHA 1Y6QA 2BRUA 2G9RA 1QZZA 3DZJA 2OHVA 1Z83A 3E0XA 3C1UA 2IDMA 3RV4A 3WLAA 2H1HA 2NU6B 1X80B 1IHPA 3JD4A 2Q5FA 1L9XA 3QEMA 2O2ZA 5C0OE 1A5BB 1C0PA 5AIAA 5I3ZA 2C7OA 2VNAA 1EFDN 3OQJA 1VKRA 1I10A 4AY5A 4DJJA 1W2GA 1FE8A 3IIMA 3JZAA 1IN5A 4HYYA 5KYUB 3C6KA 5AHXA 5KYKA 1TYZA 2IWRA 4PZEA 4D9IA 5FA5A 2XXAA 1YRBA 1GEEA 1ZVJA 4DV6B 2IEZA 4W82A 3R41A 5H8WA 1HY3A 3P0EA 1B23P 3ZH9B 1GAXA 2C07A 1LVGA 4EVIA 4RNCA 5DHTA 1UMCB 3IR5A 2UVQA 3ZW7A 4HRAA 1JAXA 1F2TB 3H0CA 1G38A 4F3YA 1PTJA 1RKQA 2ZIAA 3FB1A 4N8EA 5A9TA 1FMTA 2AOWA 4DVGA 5J2UF 1V7PC 3D3EA 1CEEA 4W6QA 3SOZA 1M2GA 2OGTA 2BAGA 2JHFA 3H99A 1DTWB 3KT8A 3L1JA 4KJZA 5LD2B 2BPOA 2BE7A 3UNMA 1ISMA 1WY7A 2GF9A 4KPGA 1ULAA 4X3CA 1E1LA 4G5HA 3FUTA 4AW9A 2BEVA 1DGQA 4D4MA 3LC0A 1IWPB 3DVRX 2J87A 3B3QA 3C98A 3J81A 2AXQA 2IS6A 1VJ1A 4O4IB 4WY2A 4OI1A 5FH9A 2HIMA 4B5LA 1DBIA 3OQVA 4YJHA 4W7IA 1KTVA 1NIPA 1X7ZA 3PV0A 4OYLA 2XA1A 2Q6KA 1Z5GA 3CC8A 4J16C 3R40A 1OKKD 2XD4A 3R3UA 4CKCB 4LJ8A 5JNUA 4YMVA 2ZI4A 2JRLA 3ODGA 3Q88A 1ZMOA 2ZRMA 4MR8B 4YACA 3ZXIA 5KPDA 2BZSA 4O2AA 1NZFA 1T4GA 4Q21A 3THYB 1BAPA 1U28A 1DAFA 4E4RA 1S4QA 3OD5A 5L4SA 2AF4C 2DTDA 2YUIA 3C3PA 3BMQB 3DM5A 4FFPA 4IIJB 4PHTA 1T2CA 5DBIA 4MV7A 3T99A 1JI0A 3UK6A 2QLTA 3WWCA 4BLUA 3AESA 3ET5A 4QO8A 5C5DA 3CPJB 3NWJA 3AR9A 4EG5A 2HB6A 3FZGA 2XNDA 1VKZA 4YN3A 5FULA 2YS6A 5IUNC 1L7DA 4P08A 1AHNA 2V4UA 1CVIA 1R6BX 5I9LA 4IX9A 4ZHQF 1DFIA 1Y8ZA 2RBGA 5DM2A 2NNWB 3K72B 4D2IA 2CNWD 1FTQA 2A84A 1VA5A 2HGZA 3H9EO 4AS3A 4DYVA 3EH1A 1PUIA 1T26A 1DT5A 2QQEA 2QJRA 1AO3A 3T1OA 1I32A 1MOZA 2YJZA 5E8RA 3ON5A 2AEJA 1XZGA 1UC9A 1RWKA 2W2PA 4YR9A 1PJRA 4JHLA 3RQSA 1IDOA 3MGCA 1HMPA 3TTWA 3ZDRA 1JE1A 3CVXA 2JZOA 2AFFA 5SZIA 1QCYA 1VKOA 3NUQA 3N8GA 4ID3A 3F71A 3JW8A 4X5OA 1P3JA 1JH9A 1A5SB 1XLTA 2YZGA 3N74A 2B2CA 4QDXA 2L18A 4AULA 3OPQA 1JDVA 1T0BA 2V58A 1YZ3A 3DH0A 1SCAA 4RULA 1U0TA 3SHFA 2G9NA 3H9QA 4QU5A 4D9BA 5LDDC 2VXYA 1RWNA 1X1QA 2KE5A 3NVMB 1L8OA 3Q7QA 4ZYWA 1HRDA 3AJDA 1KHUA 1QR2A 3KPVA 4XXHA 5ED0A 1VCIA 4M55A 1JZQA 3N2KA 4GUAA 4WCDA 1KP3A 3MAJA 4NBTA 3GI1A 1N6LA 1JA1A 2PGNA 3G2QA 4PFSA 7MHTA 5D85A 2VPIA 1UIMA 1F1JA 2F3QA 2J3HA 2FMXA 2ZI3A 3C6XA 4NMLA 4QDKA 2OXRA 3TZEA 2GRJA 4I9UA 4FEEA 3OX1A 1NURA 2HF9A 4XFJA 1M2WA 3GJRA 3IOYA 1CR0A 1KAMA 1FTYA 3OIUA 2D1SA 1OB5A 1NMYA 2WLTA 4OXQA 3K1JA 1NNUA 2YJ4A 1QGOA 4X94A 4LJRA 1BX3A 3S5UA 3UQZA 3LQQA 1N0WA 1YZGA 2GMWA 1MJFA 5IC4A 3TQSA 4MW5A 4E7PA 2P9HA 3GGSA 1T36B 3FRIA 4PGGA 1GKKA 4RZIA 3IIIA 1GAWA 2XY4A 4MI1A 4TGLA 3S1SA 3R0JA 4ND2A 5AVOA 3DLHA 1OUMA 3P5SA 1F8XA 2OCGA 1K5PA 2R4QA 2HQ1A 2RE8A 3AVWA 4KQMA 2PO5A 3DQZA 3KOYA 3LUKA 3AJ8A 1GNQA 4XDZA 1CP3A 1WKCA 2Z1DA 5LLTA 2VZ8A 1RMQA 3PQEA 1PFVA 3NIWA 3TTSA 3KYDA 4OCZA 1U3FA 3FSEA 3BL6A 3ABQB 1Q1BA 4GW3A 4FDTA 4FOOA 3RUFA 3BE4A 1MOQA 2SCUB 3ZVKA 2G6BA 4TVOA 1OXVA 1GSIA 4ZYXA 5J4HA 4ARCA 3AVUA 3RU7A 1JJIA 2RHWA 5JAZA 1HNXB 2FKNA 6Q21A 3DHYA 3UWDA 1P4RA 4BMDA 4FIZA 1N92A 1BMTA 4KLNA 2EFJA 3SQWA 3IV6A 1J8VA 1WZEA 2N47A 3E9CA 1L4FA 2EEZA 4GMXA 5AKGA 2QW0X 5FTLA 4CCYB 4XYBA 1HG0A 3PA8A 5CLIA 5DNEA 4LK3A 1UBJS 5KYGA 1JQLB 3EGXA 1OFVA 1O94C 1VDMA 2R1TB 3O82A 5C18A 3ISVA 1TU3A 3DZGA 4MVJE 1UPCA 4F4IA 1QSGA 2WU3A 3K0CC 3L8ZA 5CM9C 3GUCA 4LRTB 2O2HA 2XKAA 3VH2A 3T7TA 1PW7A 2NSYA 3H9CA 1CERA 1Q0LA 2A30A 2ACEA 3CX7A 1FNMA 3FNGA 3GHYA 5BQFA 5G0SA 3KHUA 4INPA 1CUFA 1NQUA 1NXQA 2IITA 9ATCA 1PK8A 2KHZA 3D2BA 4KWHA 2EGUA 4AJKA 3KOUA 3UV0A 1S2NA 3AERB 3IAAA 5DMHA 2VJOA 3KC2A 1A97A 1X2EA 4GPAA 1M1XB 4KK4A 4OP3A 4KREA 4EYSA 4H15A 1LC3A 1RHMA 2PPLA 1HX7A 3UGQA 3MMSA 4IJUA 1FPMA 2BHLA 2QMQA 1TO1E 4BO5A 1N8KA 1CF9A 1WQ1R 4TMXA 1Q6YA 2BFPA 4LJ9A 1XO1A 4JLKA 1DCKA 3OUNA 4AWBA 5U9CA 3T5PA 2NQTA 2R8ZA 2XMDA 3BCSA 1DX9A 3VR4H 3VPCA 1QQAA 3D6TB 1CLEA 3I6IA 5AD1A 3VMMA 1LX6A 1Y9AA 3G8BA 3SBDA 4AN0A 3TCNA 4R0MA 5J2UA 3JWJA 4DCUA 5AVQA 1EDEA 5SZHB 3ZBQA 3ASYA 3EIQA 3ZDEA 3CXRA 3I39X 1FVOA 1I6LA 4B48A 3GNLA 5ARCA 4LE0A 3V4VB 4NCNA 4ALIA 1IU9A 5JIBA 5DK4A 4MSUA 5K8JB 4BO3A 1RRFA 2I2WA 4E5SA 4JZKA 4RORA 5NLLA 1FSSA 3KKLA 1E9VA 3PP8A 1PZEA 3U37A 3U9TA 1N9KA 1YOVA 2NXNA 2QPTA 2XEXA 1G3QA 1VL2A 3PT9A 3RYTC 2O8NA 2JFNA 4D6YA 4ER0A 5JEJA 4L8GA 3CG4A 4K6KA 4ZCPA 1U3VA 1VG8A 2ZRNA 1WO8A 2PX8A 1ZIYA 1ZH8A 3GQVA 4FHFA 3T38A 4S1OA 2HQBA 2OE2A 3P9SA 4PO3X 3ZHSA 1OIVA 3O4VA 3OOHA 1KZGB 1Y8QA 2Y27A 4F93B 2SHKA 3UYKA 1NQVA 2CLHB 2F43A 4MDHA 2P8JA 2FJ0A 2PD6A 4KQHA 3MUNA 4P4NA 5AJHA 3ZWKA 1DEOA 2PUGA 1J0DA 4CKWA 3CZAA 2ZBRA 3CNBA 5CA1B 4HWSA 2AOTA 2LE0A 4Y2PA 3ZE8A 3LOUA 5G3ZA 3EG5A 1XLUA 1L5HA 1QHGA 2QGZA 1GGVA 4DPKA 5FWAA 1Q20A 1W34A 2NZXA 4FGWA 4M1ZA 4MYUA 2QN3A 4JUIA 4ZHQA 1RHKA 2DY1A 4PO1A 4PIPA 4JB8A 2CD9A 5BWOA 1O58A 1U6KA 2QN2A 1XCJA 5JV5A 5K3DA 5A5GA 1TTQB 1NLMA 2GCEA 2ZG6A 1VMAA 1BEEA 2PYZA 5TY0A 1PNOA 1CVRA 1YWGO 2B99A 4RA9B 1YDGA 4GXTA 3ZJ4A 3C6BA 3H2SA 1A69A 1KZYC 2W90A 1ACMA 1XLWA 5EIAA 1N8TA 3GLRA 4FEGA 4PC6A 4F8JA 2HF8A 3M3HA 2GGSA 4OQMA 1WUTA 2WYIA 1XCOA 3VPGA 3FNBA 3ZE6A 1XHFA 3DXFA 1RZVA 4HB3A 5LMCA 1KHXA 5IDXA 2Z8YM 4FGLA 1NULA 2AE2A 2QR2A 5EFZA 3ANYB 2QMOA 3UMZA 1D7OA 5F4ZA 4UFNA 2ZUSA 3COSA 2P67A 4H3KB 3FPBA 3LLVA 1NU8A 4HDRA 4MEJA 4WESB 5AOAA 1WZIA 5K3FA 2JC3A 4IXMA 2W8BA 3KZVA 3W77A 1TA9A 3SEZA 4KO1S 5JAUA 1RVDA 1KS2A 5DTJA 4ZYVA 3NT5A 3GFRA 1J0BA 4WXMA 5T67A 1KPGA 1N2IA 3SSAA 1YB4A 1M75A 1SFRA 1E3WA 1Y42X 1UZUA 2CMHA 2BE9A 4CM9A 1RKBA 3IFSA 1C3EA 4Z7QB 1GTRA 4J4TA 3ZI4A 1ITZA 1EXDA 1RWBA 2CHEA 3GPDG 1KJYA 2BGMA 1L9KA 2E21A 3HA2A 2HBQA 1VHTA 1Y1KE 1H94A 3LP6A 5KOJB 3LIIA 5LQJA 2R97A 1QFYA 2FWPA 2H4HA 3PC4A 5ALSA 2P0YA 4OU4A 4Q4HB 1PSDA 1V2HE 1U3DA 3EVCA 5DX0A 2QYOA 2BF7A 4HAYA 1TZBA 1CETA 2Z98A 2WJYA 4O2RA 4ZAXA 2P9FA 4DEYA 4JIWD 2OCYC 2PRZA 4LRXA 2I2DA 1EEHA 4TUYF 5CFMA 2BZ1A 3OCJA 1HO3A 5I47A 5GIPE 5JBQA 4ZTUB 3ZY4A 1JR3E 3GGPA 1W36B 4UTXA 1D09A 1RVV1 2B94A 2NUPA 3Q85A 4M21A 4ND5A 2PGDA 4NFLA 4PLFA 4Q9KA 4ONEA 4FWTA 2FU5C 3LIPA 3OQHA 4DMUB 5TEVA 1LA2A 1G59A 4RY0A 1E89A 3ZWQA 2PL9A 2LVBA 2LGJA 2V4ZA 3B13B 4QPZA 5H83A 2D06A 3VNRA 5AI5A 1ND6A 5IAEA 3ZZ1A 2R8OA 5G1OA 1B74A 3THSA 2I22A 3TRJA 1GA4A 1Z56C 4DEXA 5LQRA 2CL0X 4GLOA 2NVUB 4DC0A 3G5AA 5AH0A 4FYIA 2XAAA 1J42A 5HZHA 1JEJA 4OMFG 1A7UA 4RS4A 3K70C 4MEAA 2XGJA 2PSFA 2SKEA 4BEBA 3FWZA 2ZAIA 5I01A 1M5UA 4MUMA 3LY8A 1JR6A 1I4LD 1XAGA 3OCCA 3WZMA 3DDZX 3LXXA 4KU0D 3VO8A 4Z4IA 3KPUA 1LDNA 1OPRA 4B84A 1UFOA 1SELA 2Q3LA 4R2JA 2EIHA 2ZDQA 1KDVA 3H75A 2A0TA 3WLIA 2WVAA 2QG4A 1TMGE 3AB3A 1SKYE 1SVMA 2ZFUA 4ILKA 3AVYA 4EY5A 3IV7A 2G0TA 1Z6TA 1O97D 2C2MA 2ZW9A 4J07A 3UICA 4ZN6A 4BNYA 3K1TA 3BOSA 1M7HA 4QPCA 1AKVA 4P81A 2D5IA 3ORYA 4NH0A 1LGQA 3A1CA 2P4EA 2HADA 4MW6A 4E21A 1KNXA 3B2EA 4DHWA 1YCHA 4RKEA 1G20B 2XUKA 4NBVA 2AZMA 1AQNA 3LFUA 1LQ2A 1J0AA 4MQEB 3K0FB 3TVDA 5AW2A 3BSYA 3FPEA 3GW8A 3F46A 3AQ4A 3ZLVA 1P9OA 2WAAA 5C5EA 1XCGB 2HWXA 3H7IA 2X7XA 4HEQA 2ORIA 4YECA 4LHZA 3VYWA 4JEUA 1W0KD 1W4AA 5LXTF 1ORRA 3TIXB 4EFDA 4REOA 1ZUNB 3PFFA 4YQZA 3HU1A 1JXQA 5EJ4A 4FZ5A 2WVJA 4JLUA 4EEZA 2H2AA 2V0NA 2V7XA 3R0XA 2WUEA 1Z28A 2BGIA 3GFFA 2X9VA 4XSHA 1OLXB 1SHJA 4BO8A 3MOGA 3MLEA 4XJVA 2X0JA 5C32A 5AQ1A 2VRCD 3OTQA 3VR2D 4QSMA 3OCXA 4F86A 1Q0QA 5CAEB 3IVAA 2IHUA 3LS2A 2GAFA 1JECA 2Q5QA 3KKZA 1FJ2A 3HADA 3D54D 2GF0A 2AK2A 3FOWA 1Y7IA 3BHJA 2JFUA 2XDAA 4D41A 2OFXA 4QAQA 3GJZA 4MIYA 2UYGA 2GHIA 1XZ8A 2PIEA 3OAAA 2GVDC 3STVA 2CVFA 2WINI 4EKIA 5CBKA 2ZIXA 1ADGA 2EL9A 3ZHUA 2PKWA 1ZMBA 3LOQA 3R7BA 3B89A 2VT6A 3ENWA 2PZKA 4E1VA 1BRMA 3GLQA 1H1DA 4FXPA 4HUQA 2ILTA 4BEJA 1N2EA 5HMMA 2KS6A 1C0LA 2HCRA 4RTMA 3KLOA 5CFLA 2F3RA 3LU1A 1WMFA 2WAYA 5REQA 1R6VA 2OEPA 2HSDA 4RMIA 4TT3D 4XA8A 2YWHA 2FPUA 2H48A 4GZ3A 4W9MC 1QX3A 1LF5A 1RW4A 1VCOA 1WTAA 2FPPB 1MIOB 2AR7A 3KR1A 3LF2A 3RYHA 3JQAB 3GVCA 4DIMA 1C9NA 1XX6A 2VCHA 4L74A 1CUIA 4O8ZA 4YWHA 5C7LO 4OGGA 5TJ9A 2G1PA 2XIQA 3ZJUA 1O1YA 3WK5A 4AK9A 1PQ4A 5CXUA 4ZZ3A 2VDKB 1GZVA 3C0KA 4OJTA 5G4KB 1U94A 3ETGA 1PWZA 2JDID 1M6EX 2ZJ1A 2CXSA 3MD0A 4CQLB 5K8CA 3E2IA 3BMCA 3DMTC 3JQBC 3NRJA 4S2UA 4TQAA 4M0PA 4D8WA 4LF8B 2NN3C 2WHYA 1J8FA 2TMGA 2ZANA 2Z08A 1FFXA 1IEQA 2J9FA 4ZT3A 4Y6RA 3RYCA 1TCAA 3H5AA 1NNEA 3U4GA 3DE3X 1E2PA 4ENWA 3HNRA 2AEEA 3VR5H 3ZI7A 4A10A 3LJKA 3VDQA 3ZVRA 4FNMA 5TF4A 2WHEA 1PZMA 4Q9HA 4MULA 2DXIA 5KCZA 4M1WA 3AR8A 3AEKB 4AN1A 5KBYA 3OQNA 4G8BA 2ZJ0A 3HDGA 3NTRA 3Q7PA 3BFKA 4M99A 4F06A 4X1KA 3VKHA 3E3OA 2QZ4A 1NVTA 1Y3FE 2FDXA 3LUDA 4O1HA 1K66A 4LYEA 3DNPA 3L0SA 1V5WA 2VPWA 4JYCA 2Q5IA 5I8ZA 4C4PA 1AT1A 2WTEA 3W4IA 3TQIA 1ZOLA 1SHKA 2R65A 5CFOA 2UYHA 3BFJA 2QVGA 4D1YA 4B81A 4EFLA 5KTRA 4ITRC 4N5DA 4EO7A 3PC6A 1EK0A 3EVDA 4OMDA 3ND9A 5AXAA 5H0IA 4BVJA 5KOHA 2P68A 3IHKA 1QIHA 1JEOA 1N9GA 1RSZA 2XQVA 1JLHA 3K35A 4GEGA 2GCGA 1XXLA 4YFYA 1B2LA 3I62A 2F59A 4URYR 5KNDA 4RHUA 3HEMA 3E7XA 3PQ3A 3VU9B 4ADSG 5K6AA 2HLDD 2RB5A 5FXMA 4EBFA 3W5BA 4AZSA 5EZYF 5KOIA 1MW9X 3PLRA 2UAGA 2AYYA 2IZZA 3AR7A 4WL0A 2HT6A 2R8PA 5F76A 3NQ41 2Y3IA 1J2RA 1R4MA 2FSSA 2JCXA 5IEJA 1RI3A 4URUR 5K99A 5KTTA 3RAGA 3RFUA 4CMIA 3NOVA 4J6FA 3AEQA 4OAPA 4YJFA 5EXTA 1X0XA 4TVSA 1BCRB 2R1VB 2CLOB 3KUKA 1KQNA 2ZSJA 3EUWA 2H00A 3RC8A 2NGRA 1JBEA 1L7QA 3PL5A 3T9BA 3VBEA 3VUFA 1CEXA 1BJTA 3Q72A 4B6SA 1P3Y1 5BRAA 5DGDA 4CODB 1VLVA 2ZPUA 4WECA 3DONA 1K3NA 1KE1A 1ECGA 2Y93A 2WQ7A 1WKBA 3THXB 3AB7A 3DGEC 1KFBB 3MM4A 4G24A 3W2FA 2I4IA 3H42B 2PVSA 2IPNA 1NTOA 5CDHA 1P1CA 1LDYA 2ZR7A 5ALWA 1EFUA 1LXCA 2A0UA 2XQIA 2O2EA 3GMJA 3UA3A 5IHXA 4W8GA 1GZSA 1LLCA 2Q6VA 1IQPA 3WQRA 3A6FA 3ELVA 2I62A 3ER9A 3JYHA 3V00A 2YYZA 4M7PA 1WW3A 2ZWVA 2OXIA 3CB4A 1NOKA 1JQJC 4KFUA 4A0EA 3VOBA 1A9YA 1G55A 1P6QA 2DU8A 4QDJA 4AZTA 1ABBA 4BMSA 3AR3A 1RQ2A 1SCNE 4D0LB 2ZUBA 2OSVA 4IVNA 3SJBA 1VSBA 1ZVQA 3BCRA 1GPUA 4N18A 1ZGBA 2R6GA 3FTFA 5EHNA 4W7HA 1HDZA 2EWWA 4IJKA 3TLGB 3WKCA 1MFZA 5DWDA 1ZRMA 2PS0A 1Y8RB 2OV4A 4H35A 3QX9A 2QE7D 1SKAA 4TMWA 3KK0A 5KEIA 2AF3C 1E1YA 4RKWA 2BHRA 5KU7A 1PIWA 1YNSA 1YUBA 5ALTA 5EY5B 3GJ3A 3OZCA 3R3ZA 1IG0A 5ELXA 1NVAA 2ZJ6A 2R62A 1TJ3A 1MJGM 2I6XA 8LDHA 2JI4A 1EE1A 4A82A 3L4KA 4DNOA 1SK9A 1KOFA 3E6AA 1YB5A 4ZMBA 5E0KB 1JEYA 4K3VA 4XIJA 2DBQA 3ZQ4A 3PXBA 2Q5HA 5TQ2A 2IYWA 3I12A 3WHKA 4NARA 1TRHA 5AUQA 4GC5A 4PCUA 4EO4A 2VBCA 5DEIA 2AFRA 4BVBA 4CQMA 5A4MS 5BOSA 2GZ3A 1FNSA 1XP8A 1GUYA 1OGJA 5LXTA 4DM4A 2V55B 5B1EA 2GAAA 4CTNA 1JIUA 2ZK7A 3TXXA 4B4DA 4COKA 4H31A 1YMVA 2OHOA 3OIYA 4IZIA 1CHNA 4O3FA 2OFFA 4LJAA 3T5DA 1G17A 4QM6A 1W96A 3AW9A 2G1JA 5FUVA 2WWIA 3OFND 4MKFA 2FPIB 2MSWA 3D1JA 4R5HA 5CX4A 4NDNE 2GUWA 4LMRA 3ZQKA 4DCGA 2ALJA 2YMMA 2O3UA 3O94A 3ZQ6A 4CPDA 1QO9A 1JEQB 2RONA 3PKZA 1P33A 4Z7OB 3MW8A 3A27A 3WRYA 4ESOA 4G01B 4TMVA 4ALNA 2G70A 2PQ2A 3SCZA 5E6RA 1LBTA 4ZEVA 3GEMA 3KZ1E 4RVDA 2G71A 3UHPA 1QFSA 4DQDA 1QZ3A 3I5XA 5BW6B 4LE1A 4P84A 4PLHA 1SVOA 2GF2A 5IJ9B 3L0PA 4N82A 4HAUA 4NZNA 2PRIA 4UASA 5JFOA 2DBZA 3U5ZB 2G04A 2JLRA 3BGSA 1S2IA 5B6IA 2XBLA 1FB5A 3BJEA 1C1XB 3FTPA 3WFZA 1J2EA 2G88A 1N6RA 2B7BA 2B4TO 2VP2A 3EYAA 5HF8A 1U02A 4DBVO 1C5KA 4G5GA 2PKXA 4WASA 3SXUA 1R0CA 2WW8A 2RHBA 1H3EA 1DU4A 5EE0A 1GGEA 4BMPB 4RHFA 3IEIA 2ODPA 2ZRAA 5KNBH 1SUBA 1NBHA 1HQDA 1UP7A 2Q9AA 3MF4A 5C80A 1JILA 1CT9A 5TT1A 2NT3A 5ALRA 3ZKAA 4CCWA 1Y3CE 1I80A 3RS2A 3LKVA 1L5WA 2P75A 4LYHA 2J3KA 3JWIA 1PV2A 4GP9A 1VFPA 4RKYA 3VYTB 1EFVB 4XVCA 2FQ1A 3PGVA 5JDIA 4XQCA 2OL4A 3PPVA 5CM2Z 2C4NA 1G6KA 3DJFA 3IBCA 3Q3CA 4P7FA 2XF2A 3GMDA 3HP7A 3VYUB 3ZGNA 1H1TA 1P7VA 2IY8A 521PA 4DLUA 3ZZUA 4RTJA 4NDAA 4FE3A 4AD8A 4XGKA 4TV9F 3TK1A 5FORA 2VJDA 3MTQA 4MVYA 5JI2E 5KKCA 2UVDA 2QZZA 4L0CA 2OBYA 1N6HA 4TN5A 5EG5A 3N1UA 1I4EB 2OY0A 5EERA 1BX0A 2YFQA 4JLWA 3B1ZA 4M0UA 1MO4A 2QDKA 2Q7DA 7YASA 2P4UA 3GU3A 3BDIA 1NW3A 3CSDA 4GI1A 2A9RA 2O6HA 3AKEA 4ON9A 4U00A 5KI6A 3ZIDA 4EQZA 3K32A 1YXMA 3RYFA 3IE1A 3VM6A 4UBJA 4D4GA 3AM1A 4TTPA 3TLCA 2JG3A 4WACA 4OHXA 4QYWA 1HQCA 3KV3O 4Q15A 4B8WA 1M8FA 1BTOA 3TUZC 3EFHA 4UVGA 4WKCA 4EG3A 5LMNB 2CF5A 2EG5A 4KO3S 5DGTA 1OB2A 2O19A 1TECE 4JODA 5DEOA 3OT1B 5FUQA 1ZJWA 1FUUA 1OIXA 1VJDA 2I4MA 3EY4A 3K30A 2NXEA 3MOIA 3GDOA 4NMHA 4KSBA 4U2BA 3LDFA 3Q6IA 5DW3A 3SZ3A 3UG7A 3ORQA 4MA4A 3ZTTA 1PVOA 5JJIA 3RR2A 5E9QA 1O95A 1OVGA 1V71A 1W8IA 2EX1A 3SYNA 1MA0A 5EZYA 4HSEA 1JQDA 1L4BA 1KPHA 4L5JA 5B4VA 1PL6A 3C4VA 4K6GA 2BI7A 1NAIA 2VH2A 3ROGA 4FE7A 5BN4A 1W9HA 3HO6A 3CRZA 4UBNA 1AQ6A 4A4DA 2C5LA 4INAA 2ATIA 4GP6A 3SGLA 1NJFA 2C7BA 3QXSA 4NYMR 2FW9A 2Q27A 3DCNA 3KEMA 3BXFA 5ALLA 4N5HX 5HQ3A 1Z35A 4E1AA 2IEBA 1LEHA 5HNKA 1M34E 1EVEA 4KE7A 3NC4A 4DLKA 4YUWA 4LX0A 2PMFA 4MIKA 2CKMA 2G0NA 2QLNA 1NJ1A 4UCXA 4PLTA 2IYAA 3KQPA 4LVUA 2OB2A 2ZETA 3B6EA 1E5XA 2P6UA 3OKAA 3RVQA 3UXEA 5KWIA 3CSUA 3ML1A 4IUDS 3FPHA 3WX0A 3EF0A 1IWBB 2IA5A 1OKKA 1LBHA 2EKBA 3RSQA 1JFFB 1B2RA 3H0EA 7AT1A 1G63A 2RJ3A 3IT0A 5K6RA 1TE2A 4X3PA 1P1KA 2XDQA 1RAFA 1RJ9B 3HYRA 4M46A 1P0PA 4OSEA 1WF3A 2A57A 4NI5A 4BCCA 4MV8A 4JI0B 2O0JA 3U7QA 3PTZA 4PNZA 2YY6A 4FCCA 4Q7JB 5FPKA 4L6IA 3SVTA 2P9GA 2VJAA 2IX9A 2RD2A 4XARA 1QGYA 3CF2A 3I32A 2VYVA 2RI6A 1RBQA 2K5UA 4WVFA 1SWVA 2NQ8A 4YBZA 4KDRA 5EZ5A 5F5NA 2C59A 4H7PA 4B87A 2E5LB 1CSEE 2NTJA 3KAJA 2DGDA 1JKIA 3K4HA 4PYIA 1DBSA 1V95A 3RC2A 3U6BA 3V7FA 5EIBD 2OXFA 2IPLA 1F3OA 3HVJA 2JGFA 3OF2A 1CLUA 2O0KA 4UNQA 4HVTA 4C7OA 1TW2A 2ERCA 4DTCA 1GTG1 2JHPA 1D6MA 4MGEA 3LCMA 4BLSA 3FRHA 3RBXA 4HMQA 4QWMA 1HYGA 1KBQA 1N5RA 1YJQA 2W71A 1XWIA 4RPLA 2DQZA 3ZU3A 5CX1A 3GP8A 3CZCA 4HNTA 4OKNA 4PAQA 4MW9A 1HZZA 5FFFA 2EDAA 4G5FA 2ZJ2A 3DBIA 5AJZA 4QXQA 2J5QA 3GBSA 5FX2A 1PP4A 5IDWA 3PNVA 4EGFA 1C7EA 1ZLYA 4GH5A 2Q2WA 4FMCF 2H2HA 3IPAA 2F9LA 2PKQP 4OHWA 1ZESA 1PO7A 2NM0A 1F12A 3OSZA 2OR3A 2H1OA 1EE2A 2V7EA 3PGLA 4DSUA 1J70A 1E66A 1MIHA 3KUXA 1I3CA 1G8JA 1OAKA 5EQFA 4MB2A 3BPSA 3JZMA 3KZKA 4R1UA 3SR3A 1QGED 2ZTHA 3NTXA 2VJPA 2X1LA 2ZJ7A 2NUTA 2Z9DA 3QUSA 3JQPA 1V96A 2I6UA 1RRVA 3BCHA 3NTQA 4NOJA 4CDMA 4Z6KA 1JG1A 3HCNA 4AJLA 2GN0A 3IVCA 4QQ8A 3H1AA 1DTSA 1L7RA 2PEYA 1LNZA 4D3YA 4K28A 4EGJA 3WSWA 2V6FA 5ESDA 1HFKA 3BD8A 3PI6A 2WG1A 4MWGA 4Y2UA 4DG9A 1VP3A 1WSDA 2BFAA 3MIZA 2PZEA 1PZHA 2GCNA 2XZLA 4DLAA 1CNFA 1ZYUA 3ZZTA 3I0MA 2JKDA 4M8KA 2PBFA 1T3TA 1GG8A 3LH5A 4G0NA 3DVAA 1PYGA 5FIUA 5JCPA 2VF4X 1VPLA 4ZOLF 4RESA 5CNKA 2XHZA 4BPBA 4NMXB 2GLXA 3JZFA 5B6JA 4NHOA 1A82A 2PG3A 4H0FA 2OCIA 2BBTA 5DULA 1ES9A 1F2UB 4BFUA 2R11A 3KBBA 1CUYA 1X74A 4Y8VA 3OTGA 8GPBA 1ZVVA 1KI7A 4URVR 2EATA 2F90A 2NYVA 1G7RA 1J90A 3JR7A 4FGKA 1T9GR 1R0YA 1SA0A 3V8VA 1JI3A 3AKYA 1Z6AA 2R68A 4O33A 1ZAYA 1RYFA 1HBJA 2AJBA 2GCOB 3QLUC 4YCBA 3UJCA 2H54A 3DTTA 3SXJA 5IBPA 3AUFA 1DARA 3GGDA 4G4GA 4DY6A 2FNAA 2OXTA 3KWFA 3NT4A 4UPDA 3V2GA 3GBPA 1NL3A 1R5JA 3G88A 2Z8YA 3ZH2A 3TSYA 3NPAA 1WUKS 3RS5A 2ZTVA 3FZNA 3QOXA 3TNJA 3IUJA 4DCSA 2QMYA 4ZEMA 2HXSA 3EC2A 3WYAA 4BP9A 1LPAB 3W8DA 4DLVA 1OWPA 3FSRA 4Q3AA 1ULTA 2IQIA 2Q9UA 4TV9A 5FBHA 3TJRA 5FLXA 2CHFA 2PS9A 1UKYA 4E08A 1ZGZA 1X9HA 3DKPA 4CF4A 1GZ7A 1H0RA 4NYJQ 4XCXA 3TW8B 4EKYA 4EW3A 4BXOB 1RQRA 4PZDA 5D5PA 2RK6A 1NI3A 4BV9A 2Q1YA 1KP9A 2MINB 3ZS9A 5AVZA 4JSYA 3HSYA 4KTTE 2WIJA 2QYSA 2A7XA 2GTHA 2WZQA 2ZCUA 3B6JA 3EIUA 4C5AA 1IEXA 2FE4A 3BF7A 5EP2A 2XB4A 3AF3A 3JATA 3K0HA 1CDZA 2IGTA 3K8YA 3CUTA 5DLPA 3SD7A 5LU8A 3JTEA 2BFMA 2IHBA 4ZI7A 5DF1A 3LD9A 3U17A 4GLLA 4PR0A 3R5SA 1KO7A 3NHBA 3OLWA 3PXUA 4ID9A 4RH1A 4TKZA 3GK3A 4YROA 3OQOA 2CBXA 3GLGA 1NV9A 2P3OA 1BE0A 4EI7A 3MS4A 3RB8A 2QVCA 4YMHA 1D7AA 3N5CA 3TVYA 3MTJA 3IQGX 2H1IA 3GZJA 3TZKA 4WNAB 2IZ6A 4I9GA 1Z45A 4N01A 3EVFA 2VZEA 4HBGA 4IGIA 1WD5A 2P7HA 3E9ZA 3PIRA 4RYLA 1X9GA 5B12A 1IN8A 4CMJA 2EF0A 2IYNA 3BE8A 3DF9A 3OURA 4J03A 4WNIA 4ALKA 4W63A 1GYPA 3TFQA 4MLPA 1HE2A 3AF5A 5G2OA 5B3JA 1BJKA 2OKGA 4MWSA 4CV1A 1QRAA 3E0QA 3F49S 3WGOA 1RXWA 3VHLB 2OESA 3NTUA 3F5FA 2EC5A 3E61A 4KQKA 2ZVJA 4PBTA 4AJIA 8ABPA 5FPPA 3FDZA 2AQIA 1SC4A 5KSOA 3ANNA 2KPOA 3O4RA 2VYND 2VWPA 3UT6A 1WJGA 3DE0X 3LYLA 5EI5A 4BQFA 2HYIC 4HO1X 3GGCA 2VAWA 4ETMA 2YWRA 3LT2A 4KDFA 3UN0A 4PYLA 1XCPA 4UD2A 1CPYA 3HHPA 4UTOA 1SULA 4AJ1A 1SH7A 1HEYA 2PWZA 3CLKA 4TRRA 3BKWA 2NXJA 1XYVA 3DTYA 4OOFA 2FG6C 2FF7A 1YL5A 1JT2A 1RJEA 3JQGA 1BFUA 1MQ9A 4QODA 4I14A 1B93A 4D56A 1NW4A 3CH7A 5C9ZA 3YASA 1J20A 3KXPA 1NBMD 1EFKA 1TKRA 1GG2A 4JLSA 1CZHA 1FFHA 1JAZA 4HNRA 1JFTA 3DE5X 1US8B 4UHBA 4Z4CA 2VTBA 1BCSA 3DG9A 1FDVA 1EJBA 4D9VA 2J46A 1HF3A 2XNJA 3K16A 3QKRB 2RG7A 2OORA 1KY3A 5B3AA 3VHXA 1O0CA 2X4LA 4B4OA 5KVVA 1GFZA 4MHTA 3OZUA 1XZHA 2EF1A 1R6TA 4IWXA 1U8FO 1U7FB 2G1KA 5G1NA 4P2BA 3ZVNA 4HB2A 5F1OA 3G2IA 2QKYA 3GVXA 1RRCA 2X7JA 3FLEA 4QFCA 1PFKA 4BLPA 1J39A 5LYJB 4MGYR 1JHOA 4BV8A 3GZNB 5JEMA 3BCUA 2CB9A 5CFRA 1UT6A 5DBFA 2K7ZA 1A1SA 4A8TA 5IP5A 4U02A 1C3OA 1TZCA 4BAZA 5M2QA 4ZPJA 1ZJ5A 4QLOA 5SYAA 2GLUA 4ZIRB 1LK7A 5LKAA 3FFBA 5AVTA 4TLCA 3GJ7A 2AWOA 3HM2A 4LMAA 3ZDCA 5HSGA 1QRRA 3ZV5A 1ZO8A 1JFVA 3FSJX 3QEMB 1YR3A 2H5LA 1JHQA 1XNQB 3G8DA 3RUIA 3PEWA 3W7BA 1XEXA 2R00C 3AEYA 1JIXA 5A0FA 1I6WA 2GKGA 3UGTA 1GVHA 1CUBA 4JXKA 3S2SA 4R2IA 4KQGA 5EQJB 4QT4A 3LL4A 1D2CA 3GUZA 5KCMA 3ZY3A 2POQX 2YWCA 2AKEA 2IZ1A 3FUWA 3Q5EA 4ZDWA 1QH0A 1V8BA 3NAZA 2DSNA 1Z4KA 4MLZA 3CKKA 3FPLA 3GT3A 4G8DA 2IH4A 3D0KA 1Z8FA 4OLJA 1L5YA 3NYRA 4NAHA 3UWPA 4KRYA 4CE6A 4HNUA 3FUXA 2NIPA 1TW3A 4INOA 5AK0A 2YASA 3WADA 5JD4A 4JYZA 2W2TA 5KU1A 2HJHA 1CE8A 2IT1A 3B48A 3F97A 3A04A 1G0OA 4OH7A 1G4UR 3LW8A 2CW5A 3PLNA 1Y1TA 4DKJA 2HU7A 3P9PA 1L6IA 3O2NA 4JB0A 1F4PA 3EPPA 2L69A 2H06A 3TQOA 3B7PA 3JQDA 4NU8X 1T24A 2E4VA 1H0KA 4EFKA 3DAGA 4E31A 2BEVB 5ALJA 3VC2A 2RHLA 2Y1LA 2C97A 2FW8A 1TIBA 1ZBQA 3QOFA 3R5XA 3FHOA 1RXVA 3RRMA 2VUHB 3Q11A 1K86A 3I58A 2PIAA 4O4JF 4YJHB 1X7ZB 1QU5A 2YIDA 3P2KA 4HNQA 5E1BA 4IICA 3CTMA 4HUJA 5KKAA 3TLYA 3U5TA 2A9VA 4XUCA 5BN5A 1F8GA 1IPEA 4H0NA 1OAOC 3SBOA 2H2IA 3RIXA 5JCXA 2G9ZA 1G2IA 4XUDA 1TF2A 1JSRA 3NBYC 4O2AB 1JVBA 2LCFA 1Y6FA 1I1OA 1XUOA 2M6KA 1PVDA 1UDWA 2H4YA 4C0JA 3EPJA 4K9OA 5KO2A 2N0SA 1D2MA 3D4OA 3NAMA 4FLEA 4ZVRA 5EWLA 1TOAA 1OU0A 3X1MA 1D9ZA 3MCWA 3AESB 4ZT4A 3F7NA 1AKQA 4BZWA 5JXJA 1XRLA 4BU0A 4WFJA 3UFXB 2PGOA 1QIGA 3MTAA 3A3NA 1N4DA 2OYRA 3T15A 2LW7A 1CDEA 3RREA 1Y5IA 3UJHA 3QXXA 5K8LA 4CEIB 1EI9A 3B60A 2GPSA 1ODSA 2X58A 3NAGA 4L5IA 1YDWA 4OJYA 4KBFA 2J3EA 4FOLA 3HABA 4HEJA 3HJHA 1NI4B 1EBUA 1W93A 2IPMA 1WB5A 2P6MA 3PHJA 3AHIA 4L27A 2AUNA 1PJBA 1ZGCA 1SD5A 1SXJB 1VPTA 1XZQA 1DWOA 2IUSA 1AKNA 1SVSA 1WCIB 4GOMD 4Q66C 3R5JA 3DVQX 3BGWA 3F67A 3FNQA 4K8OA 5FHRA 4EKNB 2IP4A 2RGRA 3GZ4A 3S6JA 3WGHA 2HWYA 1SBZA 1T4CA 5TPZA 1U7HA 3T8YA 1IB6A 3O9MA 1XHEA 1CC1S 2HA2A 2HZ7A 3FLMA 3QKUA 3R7DA 5CDFA 5L6LB 5KTOA 1IULA 2XWJI 3KQNA 3ZWBA 3JWGA 4TSKA 4RQBA 5DCWA 1KORA 4R8VA 2ZWMA 3FCOA 4PG8A 1FJHA 4B3JA 4RBNA 4NATA 2QD2A 3AHDA 3OZGA 1M66A 1W0KA 3UEOA 1Z4QA 3AP1A 2XODA 3ICWA 4OJMX 4CM7A 4QG3A 2EBHX 1KI9A 4Z1MA 1QX4A 2W43A 3DYVA 5ELLA 3VH1A 2C0QA 1C9MA 2AI3A 1WOYA 1R12A 3OJFA 3X44A 2DPGA 1F48A 3FJ1A 3K9GA 3EODA 3RVMA 4IIUA 4XAQA 4XWWA 2IBSA 1MB9A 1QFXA 2QUBA 3RADC 1G88A 1KETA 3KT6A 4LHYA 1FSFA 1E2GA 3E4DA 3I6ZA 3OC0A 2YWDA 1AGPA 2C0CA 4K9DA 4NULA 2A0XA 4OLHA 3RFFA 3CEHA 2VRCA 3MBOA 4Y2YA 5TS2A 2Q2NA 5KQGA 5KNDH 3P2MA 4FILA 1V8DA 4RPJA 4U2DA 3IX7A 1XZCA 2CWWA 2H4XA 4GAEA 3A4TA 4NBUA 5ILOA 5HIMA 4RU1A 2YYYA 1V1MB 1F7VA 1U8EA 2G83A 3TPCA 5AP9A 13PKA 1LNSA 4GIBA 2I4RA 3DLTA 3U49A 2IH5A 1JRLA 4LXHA 4RPKA 3D8HA 3T9DA 4LA4A 3UZUA 2X86A 5J43A 1I14A 3RU9A 3RNLA 5K45A 2FUG1 3ADDA 2E7ZA 3VYSB 1PTKA 2IVFA 2CJWA 3KYDB 2O8BA 2CY0A 3G9TA 1NNI1 2VYCA 1ONNA 4TT3A 5FOSA 2C1XA 1MJGA 1G64A 1NX6A 2RHMA 3MNFA 3NIFB 4M76B 3ACDA 4QARA 1OC2A 4KBGA 2Q6OA 3J7TA 2P11A 1FMLA 2AG8A 2HMVA 5AKIA 1L4EA 3D2LA 3ZY6A 1Q77A 1RPNA 2NW6A 4HGNA 2FMUA 1I7LA 3O4JA 5K3AA 4F45A 3PXXA 2BIFA 1XAIA 2JDIA 3U6KA 5HA5A 2MSCB 4XIIA 1R0BA 2JIOA 2WJGA 1X7XB 3PENA 4HDNA 4M1MA 1J7KA 3L4EA 2DH6A 4RK6A 5LQSA 1K6MA 2HT1A 3K9LA 3QE9Y 2XVMA 3JQ7B 4JVMA 1EXVA 1O8BA 1OFHA 4NFYA 1XEWY 3MUOA 2PD3A 3IBYA 1IMJA 5JZBA 2HHJA 3ZWAA 2HGSA 1AUPA 2IE0A 4BNTA 4D9JA 1KIFA 3MWEA 1P44A 4LDAA 1ZCAA 4TLEA 1I36A 3C3BA 1LBSA 4ARZB 1G7SA 4OEHA 5FOQA 1DBRA 5TR9A 1GUBA 5JY6A 5J2TB 5KYVA 4HSGA 4RXUA 3TR0A 3CZRA 3OQBA 1NM5C 5DYTA 1PV4A 1HRKA 4MI6A 3UJBA 3VI3B 5J58A 1LGYA 5EJ9A 4UPVA 4DQLA 4JBIA 2G3YA 2ZZKA 4FNOA 1WG8A 1PLKA 4ANFA 4BN5A 2A6PA 3HS3A 1O4WA 2QUIA 4PLYA 3KAQA 5IVKA 3Q3JB 1CXZA 1U0EA 2HBRA 3BWBA 4IGKA 3TSAA 4DLXA 3EPRA 1MRNA 3GGJA 4D74A 3TDMA 5GPBA 3BKXA 3W5UA 3OE7D 4Q82A 1N77A 4YCMA 2XQFA 1MXHA 4MZXA 1NXTA 4BN0A 4X8LA 5A02A 4OLAA 3WY9A 3AF1A 2WNHA 4YGYA 4Y2HA 4PWYA 1DKRA 1H4TA 4CM6A 3PE3A 5EMJA 4I3HA 2YKGA 1JQBA 4KDCA 4B85A 1B6SA 1TMKA 4AIIA 1RC8A 1XVUA 1QFZA 1ZUHA 5JS1A 3AM5A 3JTMA 4XZ3A 1VOTA 3I9FA 1TRKA 4HWPA 3WB1A 4O4JA 2QUKA 2VP5A 4RD3A 1WXWA 2J6IA 1OYVA 1YJ5A 1Z0SA 3N7UA 4Y0VA 1EWRA 5I8WA 4C89A 4E94A 2Z2YA 1N6OA 3E8SA 5IZCA 1EWQA 3KZMA 1QIMA 3VV3A 4F2DA 1Y8QB 1WEHA 4I9NA 4HOYA 2F43B 5HK9A 1ZD1A 3TWOA 1GZDA 4HWTA 5THXA 4QRIA 4CKWB 4G4IA 4QVIA 1QK3A 3TUJC 2CXNA 1ELOA 1TEVA 4P1ZA 4Y2RA 3U7HB 1H5QA 2Q4TA 4X3OA 3E03A 4V24A 4J1TC 2CJPA 3LVFO 4TXNA 4EQ6B 1YVUA 4RCVA 3WV4A 2BFWA 1L5HB 4XGNA 2OGZA 3STYA 4YT8A 2E0IA 2JIDA 2A5JA 5ADUS 3QWHA 4AYTA 4LZWA 2JGNA 1QQ7A 1U6IA 1MMFB 3DCJA 2GEDA 3B3GA 1JVNA 1ZIXA 3GWZA 4NENA 4UDOA 3PFBA 2DWUA 4Z86A 3V4PB 1QNFA 5LNK1 1RXIA 4D42A 2EX4A 3ZDQA 4CLHA 3R77A 4UD6A 1LSOA 4YASA 3BIFA 5CT9A 2BFDB 5AKLA 4EHHA 1TL7C 3IESA 5JVDF 3EMKA 2GPBA 5JJKA 1NOJA 2GEUA 3VAAA 2QE7A 1ORHA 4B73A 5CA0F 2GK4A 1ARZA 3OCWA 4DB4A 2BSQA 3RS8A 1GQOA 1PWHA 2GWHA 1E5VA 3BXGA 3VR3D 2PUDA 4JOCA 4BGVA 3UJ6A 5EXDA 1T1SA 3I23A 1KK3A 3BS4A 4FOSA 5A5EA 2A5GA 1A5TA 1K2VN 3VAZA 1JYEA 4XIFA 2KYRA 4LF6B 3AU8A 2HK6A 1NBWB 4JBNA 2XE8A 2PGLA 2DR3A 3EARA 2Q4DA 3OIGA 2CCJA 4JOSA 4OX9Y 5K3FB 4WKNA 3BVPA 4MUYA 4L3OA 1SR8A 2W8BB 2CV0A 4JVOA 2UZIR 1FOEB 2AFHA 2EJCA 1M0TA 3IAEA 1B6RA 2R79A 2XZOA 4D02A 5B64A 2DY0A 2XT6A 2FZGA 4WFKA 3TQCA 3UC9A 3DPSA 2JVJA 4AKEA 3H8JA 5AHKA 1QIDA 2FOXA 3WMFA 5HKKD 1OREA 2F67A 1DCMA 1LRLA 3D1LA 4HNHA 5ENZA 2XLCA 2XUQA 4RTSA 4EP1A 2IEAA 4CT0A 4MA5A 4C2TA 1HDRA 2GN4A 2ZJOA 1VL6A 3D02A 2GA8A 4EF6A 2ATVA 4LKOA 4XW2A 4YLYA 3U09A 4PS0A 3FMOB 2ASEA 1D1QA 3U31A 1VJTA 2CCGA 3TMKA 1OXXK 2GPJA 2WTAA 3JAMA 2ABWA 1CZNA 4UW9A 4DNFA 2ZR0A 3LVBA 4I3GA 2C00A 1Q1EA 2QSZA 3PS9A 4KX5A 3KSUA 2O0LA 3ZEIA 4ERNA 2AOUA 1XTJA 4JWTA 4CM1A 3WFJA 1DC6A 2H1SA 3OCVA 4Y6GB 5EXPA 1AA6A 4BMYA 1R4NA 1NE7A 1PT7A 3PNYA 5LZ5A 2GN6A 2NUPB 2J41A 1UBEA 4G0PA 1MO6A 4K5QA 5DASA 3TOCA 2EG9A 4K9NA 3FYCA 3K9WA 2EKDA 2DECA 3TIVA 4J7XA 2CSWA 4HPWA 4GBED 2P2SA 1RYHA 4Y6PA 2NV6A 3FBGA 1IMOA 1CR6A 2XVXA 4KLCA 2W6ID 1MAAA 4GEKA 4PZCA 1MOSA 1SJ9A 3RHSA 1QNLA 4BB9A 3DEKA 4GWKA 2QDXA 3RAFC 3F3KA 4M0DA 3MPOA 4N3GA 1HLFA 1YBVA 1QHFA 4Y9UA 3VI4B 4BNGA 4RTQA 1F6BA 1YB1A 5JMTA 4R8SA 3F1LA 4O1MA 1XMOB 2VTDA 3AFNA 5ITVA 3MJEA 4M1TA 2YY5A 4EF4A 3D8NA 3R4CA 3K96A 1OF1A 2XE6A 1PJSA 4HQLA 4Y98A 1Y5NA 4ZAWA 4J7UA 1W5FA 5FTMA 5DHFA 3O21A 1GU1A 2R2GA 1RTKA 4HZUB 2CVHA 3A6DA 1TADA 3ZV4A 1NMZA 2R60A 3VA7A 3EUEA 3R24A 3B7GA 3E82A 3NHKA 4IDOA 3ZV7A 1P0IA 1DHRA 2ZQZA 5SICE 1QF6A 2OWEA 2AR9A 3QU7A 4L2IA 4ARVA 1HH4A 4C07A 3WIVA 5AVXA 3ZGOA 4EJ6A 1EB8A 4ZHSA 3T5GA 4QL3A 1X13A 4KO8A 1ND5A 1O94D 4AIRA 4TLLB 1D4ZA 4I1SA 4AZ0A 5J23A 4KOEC 2WIDA 4LYJA 3CO0S 1TZJA 4TWRA 2CVQA 4CYMA 2XCRB 2X8BA 4LZJA 1G2QA 2AHOA 2XUZA 1BGWA 1E5QA 1GUDA 4H27A 1EGVB 4IYRA 4RK0A 4DPLA 5IVPA 4PN7A 3QKSA 2Q41A 1H65A 2GN1A 1UKEA 3G17A 4M6WA 4G4SP 2BONA 4KFSA 4DMLA 4F7WA 1SZPA 1Z63A 3GGGA 4U7GA 4N8DA 4Q37A 2C5HA 1D2RA 1TTPB 2AMJA 2ZJAA 2CLFB 3ZWPA 3QVGB 1QG0A 2YCBA 3SZMA 5IM5A 2BTQA 2ENUA 1M0EA 4GVLA 3R7FA 2UYYA 1MEJA 2ZXFA 2Q1TA 3TRFA 1N2BA 2G8LA 1R0LA 2JF0A 5FA8A 3I6UA 1BX1A 1ETHA 5JUWA 1L4KA 2BZGA 1N1GA 3SJZA 4AJOA 2E18A 3L4JA 4KIUA 3ZJYA 5LA6A 4YJDA 2AJCA 5JAHA 2YNMC 5TX7A 4NCJA 5H80A 3VR6D 4EAAA 4JI2B 2ZZNA 2QZPA 3TQFA 3IL2A 2XUFA 1ZOSA 2O3SA 4Y2XA 5CNIA 2XHEA 1BN6A 1Q1NA 2XMPA 1GLVA 3AJEA 3MB8A 3LY5A 4Q9AA 3JAKA 4YRCA 4RPCA 4R8KA 4TZTA 5HXAA 1P4GA 2PZAA 1V3TA 3MIIA 3ROMA 5CDFE 1HDXA 2VQSA 1Q50A 4BASA 4A8JA 1T6XA 1C9KA 4E15A 1SVWA 1UKBA 1V6SA 2V6JA 3LP5A 4H0CA 1T4MA 2I03A 3P2YA 2R8EA 3V1MA 4E6PA 5FAXA 1HEIA 1CD5A 1Y4ZA 1B76A 2WWHA 1BJRE 1DWQA 1JZSA 4UEOA 1IN1A 2ZUWA 1JMVA 1TX4B 3G5LA 4RIIA 1SQ5A 4HGPA 4U9HS 2WF8A 2Z56A 3KXDA 2CYBA 4R1TA 1VXRA 4N39A 4ZJUA 3JWEA 3CRRA 3HN7A 3EASA 3VX3A 4LV5B 4DIDA 3ZIAA 2OPHA 3RYHB 4MWBA 1Z18A 1T3LA 1EGAA 2BBSA 3NM4A 2NZYA 4RLSA 5DVZA 3IR6A 5HUQA 3P9XA 3HKBA 3K9HA 3MT7A 4ZVOA 5IDVA 1M1NB 1KMNA 3RFCA 5L45A 2GAIA 1Q6ZA 4A23A 2PM8A 3MSXA 4KH0A 1E64A 3BMCB 1ZJJA 3FYDA 3QEAZ 4PIVA 1SEPA 3IAM1 1FFXB 3H3XA 4ZAGA 5FOVA 1T10A 4A2WA 4II7A 3EZFA 5FWDA 4KR9A 1RZ3A 5G41A 2FLKA 4C4YA 3VNBA 1RBMA 5D5QA 4YV7A 1UBNA 2ZWOA 3R5TA 4GYYA 1RPAA 1B00A 1UUFA 1YDMA 2FWBA 3I0ZA 3LVRE 4Y7CA 1OH8A 3M82A 3GRFA 1EAYA 4OKSA 1W4BA 4DDMA 3QW2A 3DCYA 1BU5A 4X1KB 4YUVA 4GOJA 4CI9A 3O8RA 2FWAA 3HXQA 3B78A 1RP7A 3CIOA 2XPCA 4MW0A 2IIPA 1EFRA 1Y34E 1DOAA 3TXYA 3VU8A 1L5MA 2AJDA 3A3OA 4J29A 1TM4E 4RE6A 1A9PA 1BA3A 4Q4LA 4TTRA 4W4TA 5G40A 2I78A 3H5VA 4I1VA 4XQGA 1PGPA 1YI8A 2JFPA 2WWRA 3HH8A 1EX7A 1JH8A 2PZJA 3PFIA 4RW0A 2XRYA 3OJWA 4RVGA 4BLWA 5ABPA 3DR3A 2XJ4A 5KOHB 3R20A 4ZO8A 3RRNA 1N9GB 3BULA 2GA9A 1C1DA 4ZZ2A 5T4FA 3HNOA 3KOOA 3N8KA 1E2NA 3UK0A 1FHRA 1GPNA 4C1BA 2FYTA 3DB1A 2YZ7A 3N2IA 1T9AA 5B7PA 2B1IA 2PT7A 3MTGA 3ED5A 3A6GA 4YDRA 2DWQA 5CR9A 1R4MB 3O1HB 2C54A 2W6QA 2CDAA 3NWOA 1P18A 4CMIB 4AI6A 4UMVA 3PEYA 4NCKA 2AX4A 3AEQB 4AZ3A 1X7DA 3S70A 4ZU6X 3ZWMA 1JBKA 4YO7A 3ZU6A 5DN6D 3BBLA 1QTIA 2F3SA 4IHAA 4ND6A 1FUIA 3ER8A 4ND7A 1D0IA 4EG0A 2J3JA 2W2XA 3C3XA 4D0NA 4D4HA 2AMLA 4XJTA 5EJ7A 1PJ4A 1LC0A 4RQUA 1Z2NX 2FN9A 4Q9IA 4NV3A 5JAPA 1ODTC 3J81k 3QKIA 2H57A 4RPGA 5ECDA 1LPBB 4YRAA 4GOOD 3ELWA 3KKNA 2FG7C 1L5ZA 2R7MA 4G0VA 2CFCA 2YVUA 4YPVA 4GECA 5BUSA 4DDUA 4MUNA 3LP8A 5GONF 4GOKA 3ONEA 4MMYB 4TOIA 5C4GB 3BGIA 3H87A 4TSRA 3NHAA 1THTA 4KFTA 3DD5A 1ZGGA 2EKZA 1A7KA 1GAQA 3QIVA 3LO5A 3NI2A 2I7DA 2VHEA 2X0RA 3DUWA 3IQFA 4OV6B 5LBIA 3CZMA 2GVZC 5AJTA 1LV7A 2ECOA 2ZSFA 1SBQA 2BFFB 3G82C 4N12A 2O7RA 4F4UA 1NSFA 4AS1A 1RPTA 3PTLA 3TMAA 1OYWA 1B42A 1U5BA 3BUSA 1JTVA 4EPRA 3ICEA 2JCVA 1YULA 2VSYA 1OFGA 3LC2O 3L6DA 3NDRA 4YCNA 2RGNC 4DRYA 2JGKA 4ZI3A 1W46A 3K70D 5A9SB 4U5XA 5AKEA 3W7AA 3PUVA 3VHRA 1IEVA 5I9BA 5K2OA 1HDOA 3C3AA 1VKJA 1YR7A 3DAHA 5EWJA 5BWMA 3FIJA 1SC1A 4MQMA 1THZA 4IMRA 3TKYA 1J21A 2Y4OA 3VR0A 3DE2X 4EX6A 2QR3A 2FUKA 2XRZA 5JZMA 4DQVA 3POAA 3LQ1A 3KAKA 2ZB4A 1JEYB 1J33A 2ARKA 2NSLA 4DL9A 2GZDA 1C29B 2EWMA 1UP6A 4H6PA 4P93A 5FRDA 5TQ2B 2V03A 1FFYA 1TO2E 2B7LA 4WLVA 3SPXA 3ECSA 4FZ3A 1YT5A 4CQMB 4XB1A 4C04A 2R84A 3EXG1 5BOSB 2JLVA 4LQ4A 2OG1A 3PUZA 1SC6A 2BR5A 1YS4A 1NWHA 2K4MA 3R3HA 5CXXA 3V8MA 1HT1E 3RVRA 1E0KA 1CWUA 1L4LA 2GO1A 4IG4A 2K7FA 3KSMA 5EA2A 1I9CA 5ITWA 1E6MA 3FNFA 2HK9A 1U0JA 3I2HA 4LJ5A 2NZWA 4D3FA 1GUAA 4EZEA 2GK3A 3KVRA 4MMZB 4YJGA 3SY8A 3HBLA 3NVAA 1FRQA 4O4LB 4R1LA 4ZCMA 5I6DA 2DR0A 2Y99A 2AT1A 3MJFA 4HX5A 3WXBA 4EA7A 4HZIA 2MJLA 2ZLBA 3W3AA 4KU4A 4XM0A 5FAKA 1N2CE 4JVSB 1C7RA 4WZBE 1CEYA 4R1SA 5HM8A 4MJ3A 2Q5LA 5E6RB 3L4SO 3EQ2A 2R6AA 4LNAA 2J08A 4NVRA 1L1EA 4ZK2A 3VMFA 3PNLA 4FFDA 5JPDA 4UBKA 3WHLA 4EPXA 1SBIA 2ZUUA 1Y33E 3WFIA 2IRWA 1FCJA 1H0HA 1OXTA 3K4PA 4MARA 4KGZA 3N86A 1QDEA 4JC4A 4Y6LA 1USKA 3UB4A 4CMGA 1GDDA 3ZBTA 2HO4A 4BGDA 2VYNA 1KS9A 3L6BA 4QUGA 5L4NA 1XI2A 3MJVA 4XRRA 1PW5A 5DHAA 2FPLA 1UQRA 3TZLA 4CVNA 2VK4A 2G1UA 2G5PA 2FEOA 2NO1A 2BDEA 2OGUA 4DV0B 4I66A 4X85A 2H6EA 3SXUB 1GCOA 1Q0HA 4Y6OA 4S1PA 5CEFA 4ZDKA 1MC1A 4AO8A 2QTHA 5BWLA 3R76A 1XPJA 1E0DA 1XFAA 5KYWA 4PHCA 3IQDB 5DHPA 3I6YA 1GR0A 2GDZA 3OU7A 1ESCA 3SLRA 3AL3A 4BUCA 2GJSA 1NBMA 3BH7A 3EGVA 3G6KA 4ZQCB 3FCCA 2JK1A 3GUVA 4R6XA 2JLCA 1A4RA 1SBNE 4BAUA 2DFTA 1AURA 3WR5A 1DDOA 1Z25A 4KQWA 3QFSA 5LBUA 2WYVA 1FP4A 2YHSA 1E2QA 1V4VA 4MVJH 2YCLA 3H9BA 1GTJ1 1EEXB 1NC3A 2HHCA 3PICA 2QRVB 5D00A 1KRWA 4F9GA 1I1QB 2ADMA 2WM3A 3ROEA 3T5TA 1O6GA 4B4UA 3IT3A 1U1EA 1ZKDA 5LQKA 1W52X 1FFSA 4D0RA 4C21A 4A15A 1Z0ZA 2CVZA 3GQBB 2WYHA 3ZUPA 1QYDA 1BYIA 3O31A 1PSZA 3SYMA 4ZALA 1W5AA 2FX2A 4OHCA 5KAMA 3A4NA 3UIEA 3AEZA 1BHJA 4BX2A 4DIEA 1MVLA 2JFXA 2W2MA 3RYFB 3ROTA 1DP4A 1IL0A 2VDJA 3LFTA 2ZYVX 3RS3A 2XBMA 1ZS9A 1Z68A 3G49A 1OR8A 1TIPA 3M1AA 2EYUA 2Y1EA 3FY4A 5JSUA 5TPWA 2C5EA 1R88A 3QMMA 3TINA 1B16A 2QX9A 1E4YA 3DMRA 1PJ2A 2IUUA 2P4HX 4UXHA 2WWVD 3WK6A 1CRZA 1D2HA 1GL3A 4PM4A 1XJWA 4P0QB 2I87A 2G9QA 2YV1A 4YVFA 1W87A 1XROA 2F8MA 1AN0A 3HZRA 1CJUC 3QITA 2FX3A 2RAVA 2ONJA 1OXSC 5KQSA 1HNWB 3QUQA 4FGSA 1ZICA 5BYKA 1EXMA 2QHXA 3QWFA 3BWDD 3DLPX 5FR2A 3WMXA 5IK2D 1MKYA 4WINA 5JHHB 3UWSA 4OXIA 4Q93A 2JCSA 1T3GA 2MHCA 3CLTC 2HLNA 2TS1A 5ALUA 4NDZA 2OILA 3W2EA 5EZSA 3WKDA 4DQ0A 2J0UB 5BN4B 3AP2A 3AJRA 4FDMA 3UKDA 2ZM6B 3CRMA 4B7AA 3COWA 4QHYA 2QQ0A 1CUEA 2JRCA 3W6ZA 4MV0A 3VJKA 1SIOA 1Y9DA 2JZCA 1MDFA 1V9SA 2RSLA 3I8SA 5JPIA 4BNWA 4Y6QA 5HQ3B 3RFXA 2YL2A 2VOJA 3HVUA 4P5DA 4P4GA 4OQ4A 3V1YA 2LWIA 2ZSKA 4CKZA 1YZHA 1OXKB 2XWQA 2PH5A 3TD6A 9MHTA 4LG1A 4X62B 1DIHA 2FUG6 4WH0A 4BNVA 2Q21A 4ZGGA 1VLMA 3O2JA 3IP1A 3HU2A 2VATA 2CXRA 1H9CA 1QHYA 4I5IA 1GTSA 1YJCA 4QC2A 1OBCA 1V8FA 1TQ2A 2QU7A 2DKFA 2XDQB 4EJSA 1MORA 5FADA 4C78A 1NUPA 3AIOA 3B6ZA 4ZXPA 1DJNA 3H18A 3BTVA 3CR7A 3IBFA 1ABEA 1PAUA 3V1LA 3T54A 2YTZA 4A73A 4I9FA 5LUBA 4CLXA 4HAZA