5EJGA

Crystal structure of nad kinase p252d mutant from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
262
structure length
253
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKKEATYLALNESTVKSPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFDFWRRVHDSFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title Crystal structure of NAD kinase 1 from Listeria monocytogenes: P252D mutant
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 62
structure length 253
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5ejgA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5ejgA01
1Z0UA 2I2FA 2Q5FA 3V8NA 2BONA 2JGRA 3VZDA 5EJGA 4L02A 3V7WA 1Y3IA 5DHPA 5DHUA 2I2BA 4DY6A 5EJFA 3T5PA 4HAOA 1YT5A 1Z0SA 2I2CA 3V8MA 1Y3HA 1Z0ZA 2AN1A 3V8RA 5DHQA 5DHTA 1U0RA 2I29A 3V7YA 5DHRA 2I2DA 2I2AA 3VZCA 5EJIA 2QVLA 1SUWA 3PFNA 3V80A 3V7UA 2QV7A 3S40A 2P1RA 5EJHA 4WRRA 5DHSA 3AFOA 4V24A 3VZBA 3V8PA 1U0TA 3V8QA 4WERA 2I1WA
chains in the Genus database with same CATH superfamily
3PB3A 1I30A 2QPTA 4KH0A 5JU6A 2Q3FA 3HSKA 4DCCA 4HAWA 4NBRA 3S6JA 1SBZA 5HZHA 2CF6A 1OZAA 1L7MA 3PT5A 4HLUC 2OFFA 1G8HA 4OA5A 2K2QB 4IDAA 1GXCA 2JVIA 3EVEA 4ZVMA 4BQNA 4YQFA 2W71A 4NNOA 3D0KA 2B4QA 2X6QA 4O1HA 4BLVA 1OJLA 4NONA 4BWFB 5C37A 1R27A 5JEJA 2ZJ1A 2ZSKA 3T1OA 4HS9A 4ETIA 1HZJA 2JHGA 1Q0LA 5L95A 3FPBA 1Z6PA 4Q12A 4CYMA 3UZUA 4DIFA 1E1KA 4O4IF 2Q6LA 3LUGA 4LJRA 3LZCA 1QS0B 2QJFA 1SCUB 3WJAA 5GQSA 1TVKA 4I0WB 4NBWA 1V39A 3FWKA 4KI0A 2FW1A 2G5TA 3FLMA 4CTJA 3L7LA 4D3SA 3NM4A 1CR0A 2V4UA 3ZDCA 3BGDA 1W85B 3WL8A 2OLJA 2VDWA 3O84A 1E6MA 4AC9A 1ZH8A 2ZKLA 2VPYA 1LZLA 1PK8A 3SF0A 3KJIA 4MINA 1XLTC 5EP4A 4AJEA 2PFKA 4GX0A 2R00C 1VIYA 4H4EA 1A9PA 3SXUA 1V8FA 3N0XA 5J3JA 4G0MA 3G2HA 1KE1A 1NPDA 1VKOA 1SULA 2JLAA 3LF2A 5C1OA 3EZFA 4GOKA 1YOVA 2HU8A 4ZCMA 4WINA 1R16A 4CHGA 3W5IA 1T34A 3RIXA 2Q1SA 4DC0A 3PDCA 2M6SA 5IHXA 2W6IA 5H3CA 4FC7A 4AWBA 2QU8A 4B5KA 5HSGA 3PXAA 3WP0A 5BWOA 5AT1A 3IULA 4DUGA 1DARA 4FGZA 1YASA 3CPSA 3OIGA 4KYUA 2WILA 3GRYA 1UPUA 1QQBA 1SXJD 2FVXA 3VOAA 3ECAA 3G2MA 3QEMA 3UY4A 1ZJ6A 2PMDA 4HGZA 2WFZA 4U63A 1JAHA 4L7QA 2GFIA 2PS9A 1OYVA 2COUA 4JASB 3GFRA 3IDAA 3VNVA 1H3EA 5BR8B 1DBSA 1B4DA 1E0JA 3MPUA 4RMGA 1K8XB 4KFUA 4X24A 521PA 1U11A 1X7HA 4TZTA 2GKOA 1N6LA 5IDVA 1U0TA 4I2NA 4RLQA 3E27A 2M1XA 3P5BA 2AVDA 2IJGX 2G1JA 4RF2A 5JE8A 4EA6A 4WFKA 4C03A 4L8WB 4L22A 1R10A 1NDHA 3IPRA 2DTDA 3OLWA 3QXHA 4NY1A 2Y0EA 3K32A 4QSHA 3VC7A 1EKXA 1BVHA 3FFTA 1SXJC 3HUTA 3I2KA 1PFVA 1NLZA 3IQXA 3EDQA 3PC8C 4NOKA 621PA 1NN0A 2JVKA 5KVCA 5AI9A 5D3MB 3KJFA 1N4AA 1KKUA 3I6YA 3PXXA 3MINB 4JXJA 4H7DA 1XPUA 1RQ2A 3ZLVA 3W5JA 4AMZA 1E1LA 4HI0E 5T4HA 2F3RA 8ADHA 4B3GA 2WYWA 3D3QA 5D86A 3CLRD 3SHWA 3JD0A 4QE3A 1MB9A 3QFTA 4G2SA 1CNMA 2CXNA 2X15A 1VKHA 2P6NA 1X7ZA 2PL9A 3EXIB 4PQEA 2D2XA 3GELA 4U5QA 2OXTA 4YRLA 3TR6A 3AC0A 1QX3A 2PH3A 1R0WA 1VE6A 3CEPB 3NT5A 4FFBA 4Z3KA 2PZKA 2W98A 2H54A 2JCVA 1ZG3A 4IMJB 1HRKA 5H82A 5IZCC 5FWAA 1G9XA 5HW0A 2XNDA 3ROGA 3MA0A 1DAPA 4J16A 2FN9A 2HCBA 3FI9A 4KU0D 4NYJR 4WZZA 3HY4A 4OI1A 1BDBA 4E31A 3STHA 4B45A 1QQ6A 5JR3A 1H69A 5K6RA 4RMJA 4H87A 4DG5A 3ZWMA 2XDAA 4FFDA 3WISA 2FLVA 4I9UA 4LQDA 1E1CA 2AIRA 3OJLA 3QKWA 3CLRC 3X43A 3KSZO 4GP9A 3DEAA 5KTRA 1R5NA 3ZNPA 3JQEA 3AERB 4C6RA 2PL1A 3AFMA 3PFNA 5KOHA 2VQ6A 2OE2A 2WSYB 2QGZA 4WRRA 1TM4E 4JBYA 1JSLA 1P1HA 4DC1A 1E1RD 2V5AA 3MWDA 1OR8A 2WT9A 1J4AA 1LBHA 1UBNA 1SPXA 1VJ0A 3A37A 3CTPA 4U6NA 4BX8A 1OFUX 1E7WA 1UJ6A 4MUJA 1WB6A 4UNIA 5TMBA 4D45A 5AXBA 3L8GA 4P54A 3CVWA 3BTOA 3N59A 3Q8WA 3PSAA 3N8DA 3QPCA 5TX7A 1FFAA 4EEXA 4ERXA 1VMDA 5AJXA 2I2XB 3JQGA 4JUIA 2XXJA 4OHRA 5E95A 1RJFA 4EGSA 2HYDA 2WP0A 2PWBA 3BSFA 4QJIA 1NF8A 2PPVA 2YFKA 1Z4QA 1Z8HA 5EHGA 3BBLA 3MB5A 4U2FA 4WEQA 3CRQA 3LTNC 3NWOA 4WDRA 1NWCA 3WQBA 3D7SA 2PSDA 1CEXA 1ARZA 1KDVA 2ST1A 4DNXA 4ENTA 1NQTA 3C5HA 3WMEA 5JHHB 3K1JA 2HJVA 3FX2A 2Q1UA 4D9KA 3ELVA 2E89A 4HRXA 3C39A 4U6QA 4I5EA 4N9WA 2X4DA 1OX4B 3U1TA 3EARA 4X8LA 1G20A 4PGFA 3TIIA 3UOAB 2PIEA 3LIIA 2D1FA 4QYIB 3FUVA 2XUAA 4DCUA 3LT4A 2QL9A 2IA5A 3DDUA 4Y8VA 4YY3B 4M9RA 5A3JA 3GLGE 4FN4A 3FCSB 1BWRA 1DJOA 4YJGB 5C8YA 3SC2B 2QG9A 1DQZA 2GKGA 2RCYA 5A71A 3PVCA 1OFIA 5D6NA 2PYZA 2REQB 2RKBA 3B51X 3V46A 1KBOA 1M2KA 2WEKA 3K5HA 3O8QB 4LZZA 4P4SB 4B44A 3LXXA 3TVYA 1H0KA 3GLQA 2FR8A 2PPLA 5ALEA 1H9AA 2FP4B 2JJQA 3DS8A 3FPEA 4L8LA 5SICE 3WKAA 3ZCQA 4BVAA 3I2IA 1CIJA 3OF2A 4MV5A 3O4IA 1WKVA 4WDQA 1MRNA 2YINC 2FRDA 4KIFA 1F0PA 5KO2A 2HK8A 3KV1A 1JT2A 5D5PA 1N2GA 4ZDJA 4WKBA 1H0RA 2YV3A 3BMXA 4H2DA 1J4KA 3QUTA 4GYKA 2C8JA 4NMXB 4TQGA 4G1MB 3NKVA 4FYMA 4K9NA 3N9IA 4EW1A 4M7RA 1BHQ1 1UC8A 4EHDA 4EQ6B 4ZIRA 1H6AA 4C20A 2SECE 5J4YA 2HX1A 1O08A 4MS3B 1A7AA 1G21A 2XUJA 4Z9AA 4GPEA 2NSLA 1QK4A 3VDNB 1NUSA 5C2JB 2C2YA 5CFZA 1N6NA 1ZPDA 1NDUA 2JH3A 3H1BA 2XUDA 4G6ZA 1RQRA 2Y76A 2H5EA 3TMKA 1U5BA 2D1QA 2FX5A 3Q3VA 3SZUA 4Z9BA 4Y2HA 1A5AB 3W9BA 1OHHD 4TUYF 2GN8A 2XQIA 2FQYA 4JHXA 3UKOA 1WXFA 3K0BA 5BMVF 3ZXYA 4N5LA 4IG9A 1ZNQO 4O02B 5FBZA 2O7VA 4B73A 5A7FA 4Y6GB 3PRHA 4U3JA 2KYRA 3C3WA 4GX2A 2CHVA 5DEOA 2B82A 1XHFA 3MQ4A 2A9JA 2P1ZA 4WACA 3BT7A 1B8PA 3BAZA 3FN4A 3R75A 3VSCA 4G3XA 1QK3A 2ZYUX 2FMHA 2J4CA 1KFKB 4A0HA 4GDMA 4BVFA 1V25A 3OZFA 1FNDA 1YCFA 3CE6A 4NFLA 4ZOQI 2OC4A 2F1HA 2J3EA 2PMCA 2G06A 5C8DA 2GEDA 2VHCA 4MCIA 3DE4X 1XQ1A 2W6JD 2ZSUA 3BRWA 3DL2A 3NHKA 3OI7A 4FONA 5E2BA 2M6LA 2P6MA 1U0JA 2P77A 3COZA 3WRWA 4BGVA 2W6NA 3I9V6 2IW3A 1T26A 2FCAA 2Q0HA 3H9BA 3V33A 4XWKA 2WQ6A 4RPGA 1VI2A 1ODKA 4L3WA 1N5RA 1IRXA 5TJ9A 4C6HA 4CKEB 2JHFA 3OZ7A 3EIEA 4RPLA 4BMNA 4PG8A 5BPHA 3THXA 2O8NA 2CEAA 2Z1DA 2C1ZA 3QG5A 2II6A 1MRSA 5ELLA 1LS1A 4TL8A 5J2UF 1OA0A 4XYLA 4JWKA 2D3TA 3WGVA 1HSOA 3KBBA 4D3XA 2FSVC 2WKSA 5EE1A 4PWYA 3FAKA 1TC1A 3WLRA 3MJRA 3U4QA 2Z57A 2EQAA 3DVLA 1PGOA 2YW2A 3I4CA 4HDNB 4AY3A 2KS6A 4F96A 2YNMD 5BSGA 9MHTA 1ZGHA 3NI2A 4BRZA 5BUSA 4DMLA 5CA1A 5B4UA 1TAGA 3ABRB 2Q28A 1WUJS 1A9OA 2QJRA 2YN4A 3AUFA 2NXNA 1D1QA 3LCCA 2FETA 2GN4A 1J2FA 5EMMA 4E2YA 3DNFA 1AN9A 1U81A 2R62A 4U2GA 5EYPB 2C9BA 5J63A 3SHFA 2XYVA 1ZVMA 5IF3A 4AULA 4ETNA 2A0UA 2PMBA 1GADO 2QORA 2WSSA 5LDDC 1DBVO 1XJ0A 2GCOB 2W37A 5IUNC 1WO8A 2FXIA 1RADA 4GO1A 5LUBA 2HQSA 1FDVA 4PU0A 4GBJA 2DHEA 3E1GA 4FT4A 1H2XA 1W2WB 1RM4A 4NV1A 2V7QA 1XXLA 4F3TA 3GGSA 1O9HA 1FRQA 3IKVA 2YNMC 2C4UA 3SQDA 4GRDA 1GSIA 3FYHA 5C51B 1C4KA 1D9ZA 4B7UA 4CMEC 3AZPA 1VHTA 1J9ZA 1TTQB 1A77A 3EEFA 1EGQA 6REQB 2JCSA 1WW8A 5LNK1 3I61A 3T5DA 4HQRA 2PZLA 1DZIA 1PJZA 5IYZB 4O4HB 2AN4A 3E81A 1L8AA 2YHAA 2V8BA 3A27A 3L8FA 4FZJA 1GN9A 3INYA 3H2IA 3WLAA 5GPBA 4C6SA 1JEAA 4PHHA 2OZEA 2A5YB 4ALNA 2JQJA 2JDID 2PBLA 1JHQA 4YRGA 1JN0A 4FFMA 4XWWA 1RPNA 3GQBA 1S89A 1B8NA 3RS8A 1A2KC 2DKOA 4W4TA 4B6FA 3GZJA 1NVUQ 1HQCA 3PPIA 4BNYA 4ZJPA 2CL6X 3L49A 5DI9A 1TTPB 1UBLS 1GRRA 2B8EA 2HA3A 2WIGA 3G5LA 1QYIA 4J0EA 5EQFA 4BNJA 3OFJA 4O2LA 1QS0A 1F0KA 3E5NA 1IFXA 4PCAA 3T7IA 2QUIA 3OIVA 1SCUA 3AHJA 1X9IA 4XRRA 2HAEA 1QAOA 1J7JA 4Y2PA 3WB9A 3D6FA 2XRFA 2HF7A 2FGKA 3FHLA 2XOKD 1I14A 3DEIA 2PHZA 4LGVA 3NO4A 2B6NA 4D8UA 4PX2A 5JS8A 4RY8A 1TB4A 1W85A 3FGZA 1CNEA 2R87A 2VKTA 3BDIA 3IJPA 3PX3A 2FVYA 1CDEA 3LU1A 3PE6A 1H93A 2CYCA 3WAGA 1JPVA 1YAHA 1MFZA 1XZAA 2B35A 2GAIA 1QF7A 1GRCA 3THWB 3QJ5A 4RLSA 4AYXA 1V1MB 3AOEC 2GXAA 5KC8A 3MQ2A 1W4LA 1N5JA 2DWOA 2MSDB 3DB1A 3L0SA 3O73A 4FOLA 2Y27A 3EMKA 2HNAA 4G63A 1FXSA 1XPJA 3LDFA 3UJ8A 3U61B 2O5EA 1DAIA 1UOPA 3OOWA 1KYXA 1U7PA 1ND6A 2GEVA 2P40A 1SEPA 3ZGXA 2IIVA 1P1IA 3KOWA 4MW6A 4CKWB 1YE8A 3IAEA 2VIIA 1SBTA 1E1QA 1RWKA 2VNAA 1HDOA 2VQEB 3NIDB 4QRDA 5CDFA 3UT0A 3ZK7A 1F8GA 3VPDA 3ELDA 4KN8A 3IQFA 4E3WA 1A8IA 4LOKA 1ACLA 1T8SA 3G8BA 3HJUA 5JPCA 5LLTA 1KU6A 1IHXA 1N9ZA 2V7GA 4ZT5A 4OLHA 1TD9A 5IC4A 5K5EA 2A3NA 3ZLUA 1QZXA 3PF9A 4IHJF 1L7EA 4I4NA 4R5HA 2VQSA 4ARCA 4N3AA 3IV6A 4KMMA 3QHAA 4RGYA 3MTAA 2JGKA 4PSDA 5FDFA 4B3IA 3RBVA 3AYXB 4WV3A 1OCEA 5AM1A 5JO9A 1Q2XA 1GP2A 5EXSA 4J90A 4CFYA 4O59O 4FDUA 4E11A 3DCJA 2FRDC 2VDUE 3VXKA 3TNLA 4E6PA 3C6MA 1UZAA 4N7MA 1AQJA 2I0FA 1Y34E 3C5WP 1FP7A 3D2CA 5FUBA 2XUKA 4G0NA 1G3MA 4BZZA 4ZI7B 3JD3A 1A2QA 1ZWLA 4ZO4A 3TSAA 2YVAA 4MQLA 1KFJB 2VWHA 4CM4B 1HL7A 4PHTA 1GNSA 3MINA 1U0EA 2RHOA 3ETEA 3UEOA 4H7HA 4DLTA 2CXQA 4A6DA 2GWRA 1BGXT 1TAQA 1RXEA 5BUQA 4WOKA 4MAMA 3E53A 1I33A 1IHYA 2QROA 3KSRA 4JIMA 4MVWA 3KAQA 5DX1A 3AHFA 3DHVA 3EY9A 4TT8A 1GKKA 2IY8A 2J5KA 4YRTA 4NXMB 4BC0A 4M98A 4OYRA 4V0SA 3U13A 3EXIA 1UBMS 2OFXA 5B6IA 3RO7A 4HEQA 5AK5A 3SFZA 4DQVA 1V8PA 1DAGA 1KAHA 3FDXA 4B83A 5H83A 4CQJA 1UKAA 3FWZA 3OA0A 4JYCA 3K30A 3RVQA 4N0QA 5CB4A 4PC7A 3L6DA 1XKLA 1DP4A 1ZISA 1CIVA 2WM2A 3IALA 2KWIA 3B1XA 2VRWA 2YRWA 1CX9B 3CFYA 2XEXA 3BMCB 3IEUA 4OQEA 3ROPA 1O6GA 4CL3A 3MTQA 3FBWA 3QGMA 4IEFB 3TTXA 2VWPA 3EJWA 1GU1A 3R8CA 3RT7A 3GMDA 1X7GA 3JX9A 1H5QA 3FNHA 3GZ4A 4JBHA 4YIKA 1O5OA 1GZ6A 1IEQA 4DLUA 4BFYA 4I81A 3K0KA 4OLJA 3UMGA 4EZBA 4K9KA 4YTEA 3CNEA 2FTKE 4KO8A 1RFGE 1IQ0A 1MJ5A 1SXHA 3O0DA 3OJWA 4LX8A 4JJFA 1E2QA 1OAOC 4IINA 4DCJA 2I2AA 1K9VF 4R1NA 3HDQA 3SOPA 3PUZA 1D5WA 3RSHA 1XN4A 1X9GA 3WY9A 1JH9A 1TEVA 2HNBA 2MR6A 3EAFA 3ICOA 2IUTA 4V0QA 1IZZA 4MKGA 5B55A 1Z2DA 2XD4A 3OCYA 4QO7A 3GEEA 3UANA 1Z38A 1PNVA 5B1SA 3JTMA 3OX4A 5HM8A 1GCGA 1AZLA 1SGWA 1W6UA 1L4KA 1L4YA 2PT6A 1MG0A 1ZH4A 2QVBA 2VH2A 3GUCA 3U7QA 5BR4A 1GT91 4BFVA 1H6BA 4BO2A 2DFTA 4L76A 2NU8B 4JVSB 2QQGA 4RA6B 4GL2A 4GSYA 4HJXA 5FUMA 2QD4A 1KEZA 1KOGA 1NBEA 3C15C 3O8RA 3G2PA 3CT4A 2HWWA 5JERA 1R1DA 2ZI5A 3L01A 3OJCA 3F4KA 4RD2A 5ALRA 2UXDB 4KQXA 3BFKA 4UNSA 2VTKA 4FNMA 5K0SA 1OX4A 3R8FA 1MIHA 4JEUA 2EZTA 4EKNB 1H2FA 4GEKA 3WMXA 2W58A 1BYIA 1ZD5A 4QYIA 3S2SA 3CRVA 4QOJA 4IGAA 2HA7A 3WG9A 3GRFA 1RXCA 4EL5A 3V3KA 1KP9A 1PR4A 1M1ZA 3CIFA 3TLGA 2IGBA 3AJRA 2CXOA 3SC2A 4C4XA 2FA9A 1TPYA 3HDTA 3FPLA 4RPIA 1YVRA 1KXZA 5G4LA 3WGHA 2CMHA 3QKSA 4QZVA 3N7TA 1C9DB 4X95A 1CUHA 5GM1A 1AZTA 3GK3A 4D6YA 1BQ4A 3EVZA 1NKVA 3A9WA 1RAAA 3ZWWA 1YB6A 1PL8A 1CVLA 3D8HA 3VZCA 1Q1GA 3EQ7A 3ORYA 5AW8A 1GM5A 3FOBA 1FFSA 2J31A 3ILSA 2NZUG 3RJMA 3T94A 4P5EA 1B00A 1P77A 4BN0A 4C0HA 1KK0A 2HY7A 4NNJA 5CM9C 2JFZA 3GD7A 4WA7A 1UANA 1YZFA 1EXMA 3AP3A 2HRBA 1OTXA 4BX0A 2G77B 5D3ZA 3ZHCA 2B3DA 4YK7A 1E4EA 1TKCA 3X1XA 4IEEA 1NI3A 4EQ6A 2G9RA 5CFNA 1EXVA 1I1NA 2VHQA 2CJYA 4HAXA 4ZQCB 5IEBA 3QWBA 2ZSJA 4JLWA 4MA5A 1MABB 2C7VA 4NTZA 2WE8A 3LFHA 1DC7A 1KSJA 3K0CC 2D06A 2PT7A 3IHTA 3UK2A 3SDZA 4BNKA 4YI5A 2EGGA 4JA2A 1K66A 4J0DA 1QLHA 3IDQA 3ZIUA 1QSGA 4HK4A 4FNOA 5EXDA 4NV0A 4O3FA 4WOBA 4XX0B 5FBLB 3UK1A 3DFUA 1FLAA 1YB2A 3T0GA 1GAJA 1Q1NA 1UJNA 1VBFA 1RC1A 1WHTB 4CM6A 2I6QA 4GWLA 4PW0A 3ZYZA 3N0TA 2IEGA 5CPBA 4YCAA 5JO0A 3NTVA 1P45A 1DIGA 3JVDA 3WK8A 3FUXA 5FWYB 2DBQA 4RHFA 1JDZA 1EK1A 3PUVA 1N2ZA 2BDUA 3R20A 5DSXA 3ET5A 1P2VA 1I3KA 4WNAB 3PEUA 5EJAA 1Y0BA 3T4EA 3OPQA 3VA7A 1CLEA 1XXHE 3KQUA 2G6BA 3ZD8A 3D7LA 3VX4A 1BE6A 4J1TA 4JDPA 1FJGB 1G17A 3E18A 2W6CX 3SM9A 3T7CA 3KZVA 4AO6A 3ZTYA 1DHRA 2CLOB 1AG9A 2YHIB 3E3OA 3PEFA 2XVMA 3IC5A 2PGIA 4L27A 4RM3A 1CUFA 4CMGA 2C7OA 3Q87B 1L8LA 4RF5A 3DBOB 3C7CB 3MT9A 1ADFA 4CF5A 1N9GB 3TIVA 1HV8A 3P71T 2ADMA 1EM6A 1E3WA 3AVQA 3C5CA 4ZYLA 1NNLA 4N5HX 5KU7A 1L3CA 2H0AA 2AJBA 1E60A 2QJOA 3H9CA 3TRFA 2DQKA 5CNKA 2FJ0A 3MJFA 4Q05A 4C4RA 4CKEA 1H22A 4U7FA 5KWSA 1S4MA 2OEPA 2MCFA 4JC5A 3WSVA 1M74A 1YGSA 3PD7A 4ZRDA 3ICPA 1Z4LA 3W9UA 4ZMRA 1BNCA 2C4VA 3LECA 1RC8A 1AQ6A 5F77A 1Y6GA 4EAQA 1C1DB 1W5EA 2O07A 3E23A 3T3GA 4ED9A 1KFCB 2FN3A 3IP8A 4FC6A 1NPYA 4IH4A 1O6BA 2AEMA 3QKTA 4HXFB 1L5OA 4Q47A 1PK7A 2ZB7A 5G0WA 3T3OA 3PQ2A 3UENA 2NT4A 2H9AA 3F5SA 4WBNB 2GK4A 1LLFA 3TRHA 4XH9B 5BORA 3C8UA 4YNBA 3L06A 4YN3A 5JFTA 1WRBA 3OMWA 1CUCA 4MEAA 1RYYA 1ECLA 2Z56A 3LYHA 3P0RA 4Q01A 3TQHA 4BRWA 1NKTA 4EFDA 1EK6A 4YCJA 5KYXB 1VLLA 3DWEX 4ZICA 4I6EA 1U9CA 2DERA 3IPAA 4IEIA 1IQUA 1N9KA 2BJVA 4GMGA 4JI2B 1YXMA 1RU3A 2GCOA 1YS6A 2AFIE 5AW9A 2PT5A 3JQRA 2EFCB 1GDHA 4TVSA 2HTFA 1KI6B 1PBNA 3JVVA 3WAJA 1N7JA 3MGGA 5A3SA 1PEAA 1RKUA 3KXDA 1ZESA 3WB0A 4Q1CA 2HSDA 2NO1A 4OEHA 1QORA 1IC6A 1PG0A 4GVLA 3ZI7A 4M60A 1V96A 2O5CA 4XTRA 1XZHA 3WZ2A 5A4FS 3COPA 4A4DA 4KK4A 2AXEA 3ROMA 2C9DA 1OV4A 2PWPA 1Q91A 3A1WA 4XKJA 4HVLA 1NSYA 2CGEA 2B94A 3EVDA 1A7JA 4EF6A 1GYPA 2JIQA 4AJOA 5H5JA 4YBRA 4QOHA 1V5IA 3KZMA 2XJ4A 1VDMA 4XM2A 4ZD6A 4MW9A 4F4HA 6CHYA 1SXQA 1ZRHA 3IT3A 3FBGA 3PK0A 4QLAA 1JZSA 3ANSA 3EZXA 3IHLA 3OCUA 4K7JA 5KBYA 1KZ6A 3DBHB 3QY9A 4I9NA 1I7QB 2CUNA 2JFWA 3TOCA 1Q1ZA 4KN6A 3B9BA 1PW5A 4JONA 4YDSA 2VRNA 3Q85A 4DADA 1FTGA 2Z2ZA 3JQDA 3T5GA 2A5DA 2ONJA 3LP5A 3RH0A 3IR7A 1B14A 2IYRA 4IIUA 3K70D 3ZJYA 3OLCX 2ZSHA 1ISHA 4QDJA 5SZHB 1QUEA 1DQPA 3WLJA 1LDNA 1TVMA 3F46A 3WA6A 1WSBA 4FZVA 1HYGA 3F98A 2J9FA 3VZSA 3STTA 5T57A 5U4XA 1ZONA 3A25A 5EMNA 1U5CA 2PV0A 3EOBI 3FF4A 5FBQB 3L9XA 5DNDA 4BZPA 4L8GA 1L8OA 2VKQA 3I32A 3MOSA 1UXGA 4ISCA 4B7XA 1M6YA 3Q88A 2QTFA 3THWA 2BBSA 1RKXA 1IJEA 1V1MA 3WKDA 3K70C 5CU7A 4II2A 3V4SA 5C8XA 3B9QA 3BZWA 3JYQA 1E32A 2J45A 4IXWA 3HYSA 3V3TA 2NUPB 1JIJA 4Q19A 1QHHB 3V1MA 3GX1A 2A7XA 3ORSA 3DYVA 2P79A 3KKMA 2IPXA 2EFJA 2QD3A 3PA8A 5KKCA 2V3CC 4GMFA 3M6AA 4Q3DA 3M6VA 4NXNB 3H97A 2PTHA 3C3DA 1MJFA 3O1LA 1R9JA 1OPRA 2PN1A 4ICIA 1UZNA 2YJTD 1QHNA 4QARA 3F71A 1EBBA 1ZIXA 2OV4A 4G67A 3ESYA 2BEVA 2BF4A 2PV7A 1ML3A 4BXOA 3G5UA 4DHWA 1I3OA 2LIPA 2Z3WA 2M6RA 3DL0A 1ICEA 1L4GA 3KQNA 5EOVA 5DK4A 3GLIE 4DQXA 2FN7A 2V6MA 2VPPA 1GOTA 3K6JA 3L3BA 4ND2A 4Q3LA 1R6VA 1XFAA 2IXAA 4WZ6A 4H17A 4E21A 2C7PA 1UK8A 2J59A 4NV3A 5BV2P 5IJZA 4UCQA 4AO7A 2V7TA 1O96B 4V1CB 5EHZA 3HRKA 2ZB4A 3M4NA 2IYYA 2GRUA 1KDRA 1W73A 3IAAA 3BCHA 3N6XA 1QTRA 3FIUA 3UOGA 1LNQA 3H3FA 1M75A 4OQZA 3QPDA 3DVRX 1FFHA 3A36A 6ABPA 5KTNA 3T9DA 1NJ2A 2EARA 2X1VA 4W7SA 3A05A 2BMWA 2GN2A 1BEEA 4ASUA 1ZY2A 1DRKA 2PUVA 5IHPA 5CFPA 3K8OE 1Z37A 2WICA 1J25A 3MCVA 5A5GA 4B2YA 2B5VA 3ER6A 3T35A 1M3SA 3VISA 2GF0A 1IEXA 1MAVA 1NN1A 2CVHA 3I9KA 5I8WA 2E4WA 2ID7A 4V2IA 4AYWA 2YMQA 2XZTA 2BD0A 1E5DA 1SC3A 1BE8A 4I1PA 1QQ5A 3NJ8A 3D6NB 5G0SA 2W70A 2WHEA 1ZLXA 1S1MA 1QNFA 3I23A 2FWMX 4FUQA 4PYRA 4YP1A 1KDYA 5L8VA 5FYQA 3DZIA 1T10A 3T3DA 3D5TA 1UPBA 2QZJA 4ND5A 4R1SA 3NOXA 4E14A 4D4MA 4KP7A 5KNCH 1W88B 4M1QA 5K0NA 1H4VB 3P4XA 1P0QA 3LY7A 1RQLA 1MOSA 1IIBA 1HFKA 4RETA 5K3FA 3ZDBA 2PYIA 2NOAA 2VUSA 4RD4A 3K0AB 3O4HA 3UB4A 2QTTA 2VJOA 4EHBA 2WG0A 4KUHA 5JH7A 5F33A 5C7YA 1A96A 5FTLA 4BV3A 2WU3A 4IGKA 4HUQB 5BN3B 4M8IA 1VE5A 1MEEA 4YRSA 1UFQA 4BX9A 4YWHA 4J1TC 4MICA 4CU5A 4POAA 1B73A 2PRJA 4UHFA 3D02A 3SJUA 4B0PA 2P9JA 4Z4QA 2GUWA 4B3DA 3M1IA 1GN8A 1ATZA 2QLMA 4ZJZA 4ND7A 1IQRA 2WF7A 3DLIA 3OCJA 5C8YF 4KXLA 3ZWPA 3PGA1 5I4BA 4S1VA 1L5LA 2WWTA 4ZJYA 2BHLA 2IPNA 3AOGA 1R88A 3E8SA 3LT5A 4ZVQA 5H80A 4EG4A 5JRZA 4MCJA 3PXBA 1QIIA 3S3TA 5KSPA 1F8FA 4YUYA 1MV5A 1CKEA 1REQB 3RF6A 3BM5A 2O4UX 2HDHA 1XD9A 4KE6A 2NZWA 4DV4B 1JWBB 3DMNA 3JQ6A 2BUCA 3GNLA 1CUDA 4H9GA 2IE8A 2F2TA 4S24A 2YQ4A 5FPHA 4C78A 2PS0A 2Z3VA 2ZSDA 3PWSA 1L5FA 2GILA 4RA6A 4WCDA 3V4FA 1C80A 1XD2B 3B5EA 2QQ5A 3IUPA 3TG8A 3V1NA 3H5AA 2N1BA 5J1TB 5KVAA 2E18A 5JW6A 1BXGB 1IATA 2NU9B 2WJZB 3QFHA 4R71A 5JQGA 4ZTUB 1UFKA 3OWHA 5C34B 2CMFA 5AKEA 3B1JA 4UDOA 4X71A 5BWBA 5ESDA 1YE5A 1XLUA 5A5VA 4LSWA 1V4VA 4E30A 2F9LA 4ERNA 4PGAA 1QRDA 4ME6A 1KHTA 2Y93A 1ZUWA 3NHBA 3WGTA 4D25A 4CQNA 2OBMA 2CB9A 1NVMB 2DTEA 1JR3E 1CK4A 2FMKA 1H23A 2QNRA 2RIPA 3FYUB 4B43A 3W5BA 4DQDA 3OZEA 2H8GA 3FYSA 2FPMA 2D0DA 2F1IA 1T1IA 2I2BA 4IQGA 4N18A 1PR9A 3KTFA 4CLOB 1T8RA 1VE3A 3FVVA 3JAKB 2HCJB 4KXVA 1O95C 5FLYA 2VRCA 1UZUA 2P2LA 2GBLA 4MAAA 4U2CA 2GDZA 4GAEA 4IZIA 4G01B 2XT9B 1S2LA 2QW8A 3BFJA 4A2PA 4ZAXA 3PQ7A 4JQYA 5ESRA 3UMYA 4WE3A 1EA5A 1M7BA 4YJ2A 3KHKA 2DHCA 3BUSA 4JKOA 2PKXA 5T6MA 2MT9A 2BFDA 4JYZA 5MFZA 2HREA 2AYYA 4IPTA 4RZ3A 3AIIA 2J4FA 3UHFA 4LF4B 1J5PA 1F5NA 2VL7A 2ALJA 4FDAA 4QKQA 4GOND 3L18A 2HWUA 3LWDA 3DE7X 3R5FA 4G9BA 3IVAA 4YP5A 4BE9A 1MABA 5HGJA 3V8BA 5IFKA 2XECA 5GJWC 3DTVD 2JLZA 1V5GA 3V1UA 3H18A 4OMUA 3DFKA 4M9CA 3W8DA 1PV2A 5E1OA 1GLNA 1CRQA 1JKJB 1RLIA 2FPOA 3P2KA 2YBDA 4KTVE 4XGKA 1BROA 3U62A 3AVXA 1TYCA 5ALQA 2VH5R 4AU1A 3W7VA 1DC3A 4NHOA 2F4NA 1BDIA 2HL6A 1FF9A 1PJQA 4QTUB 1TXGA 3BKXA 4GSLA 3VVCA 2MJLA 3DNPA 4D92A 1AB6A 2V9CA 1D03A 2Y1FA 3DAPA 1AA9A 2FEAA 2QY9A 4KGDA 1N8TA 3VSBA 2P75A 1L7OA 4RPJA 4I1UA 1S9DA 2O7QA 3GVHA 2ILVA 2WMNB 2WF6A 4M99A 3ZCTA 3ISJA 1R6DA 5AI8A 3WAKA 5JMTA 3VO9A 3ABQB 3KQTA 2BHRA 2H51A 5CA1F 1P91A 2BKLA 2I76A 3DHNA 2PGAA 2X8WA 5FEUA 4KN5A 3E7WA 3DR3A 1WDWB 5CLIA 1Z0FA 4AJNA 1XEAA 2PGOA 2UUPA 3P20A 3PDIB 3MT7A 4KXNA 3CS3A 4LMRA 4KFCA 2WYOA 5ERYA 5F7JA 3U09A 1M8JA 1FU7A 5JY6A 2ZI6A 4H31A 2WWIA 1ZSYA 1NATA 3GHHA 1ZM2A 4JIWD 5IWAB 1A95A 1A9RA 3P0EA 1Y1PA 4KFTA 3GXBA 1ODTC 4XX1A 3MXTA 4KQGA 3U9LA 1ZQ1A 4EI9A 1CUZA 1J56A 4YRJA 4DGSA 1NLUA 4FXOA 1A8QA 2J67A 4KNVA 4UASA 1TDJA 5BN4B 1MXHA 3P4YA 3WBJA 2L2QA 2AD1A 3SIXA 2NQ8A 2JGJA 2WVAA 2DC1A 5G1NA 1DKRA 2WM8A 3CEMA 3ZDYB 4BRSA 4D8WA 2ZUEA 1M2VB 1LH0A 2QSYA 3Q2KA 3MTIA 2VXOA 1ESZA 4DV2B 3ZGZA 2NP6A 4MKHA 4XYGA 2WJWA 3LOPA 1JX6A 3PQEA 3INRA 5DLQC 4UCWA 1MOPA 1V5FA 3P94A 3ZCUA 4WBNA 2ZI4A 1K5GA 2Y68A 4HQNA 3W6UA 5KQLA 5JS1A 2ZVJA 5EJEA 4DDTA 4FEAA 1QDEA 4OXXA 3GJTA 4A8JA 3AR9A 2B6HA 2ZYGA 3CKYA 3EJ6A 3U44B 3NUZA 4EG6A 1FP2A 4V24A 2FSFA 3PV0A 3D1LA 3BMOA 4IUDS 4B84A 4EPRA 5KYXA 4IOKA 4MWDA 1QIFA 1MORA 2GZDA 1D0SA 4NBVA 5LVAA 2I7DA 1XWWA 3O6VA 3KLMX 3N05A 4MI1A 5DFAA 3HKEB 1DWOA 1H8EA 3TQIA 3L4JA 3BIJA 3QOXA 1JR3D 4MUKA 3C3BA 2YZ2A 4XDYA 7GPBA 4CR7A 1MENA 1V1RA 2Q3CA 3H2YA 4KWHA 5JDCA 2QRZA 2V74B 3G02A 5KHLB 5B53A 5JPDA 1L4LA 1Q57A 4DMKA 3VI4B 2WWWA 2VT3A 2QYHA 4CV3A 2EKZA 2GTIA 2J32A 2RAUA 3DDNA 3CR3C 4HMOA 4EOGA 3UAZA 3CX3A 1L5YA 1R0ZA 3FUTA 5KJCA 3A4VA 3LUPA 1DJQA 4EBBA 4L4UA 5EFOA 1U7WA 1HFEL 3F8TA 3IV9A 3ELYA 2A67A 5EKUA 4ZEXA 3WWZA 4F97A 4FCTA 4UJ5A 3QRWA 2AV6A 4E46A 4XJTA 3DBHA 2QI9C 2XB8A 4EVIA 2I9KA 1GPKA 4TN5A 4UM9B 1IAQA 2ZBPA 4HATA 4C0LA 2ZZMA 4TSFD 4US0R 3WYEA 1W6RA 4ZVKA 1GPMA 3H4IA 4YUZA 3DP9A 4GI1A 1CUWA 1CY8A 2J46A 2ZWOA 1EIZA 2BKVA 4R9SA 1DLJA 3S2IA 2Z95A 4F86A 1ZOLA 5CEFA 4J6FA 3CWQA 3ZYCA 1WXXA 2G71A 3OZWA 4G8CA 3VOBA 3F47A 4HKTA 1NVVQ 5IW8A 5FBVB 1V8ZA 4NE9A 3A6FA 2E87A 1GNRA 2SHKA 3RUCA 3NNNA 4EPTA 3MZ0A 3WXBA 3L7BA 4CM7A 3DAYA 2DFNA 4Q1VA 2VAWA 1JB9A 2ZVDA 1BWSA 1H2EA 1X2EA 3JTEA 2CHEA 3KU4A 3MAAC 4ZOLA 4ALMA 3USZA 3ISTA 4PPNA 2GR9A 4ZKEA 3I83A 3G7NA 4TKVB 2FWBA 4NAVA 2JGEA 4TS4A 3GFQA 2ECKA 1P7WA 4FD2A 4C22A 3WR5A 3QVJA 3FHJA 4CDMA 1LBEA 2VOEA 3QIVA 3SBXA 1T9GR 4A0RA 1HT1E 1MC8A 1LF0A 5EXXA 2FEOA 1OQAA 1PWHA 3D4PA 4LN1A 1GPWB 5DLPA 4D1YA 2I3BA 1P31A 2I54A 4WZAA 5HJ7A 1CDDA 2D1YA 4YT5A 1U4NA 3L6CA 4FN5A 1TU3A 3W5SA 1O57A 5ENVA 2OKGA 3BF7A 3NVKI 4CEJB 4PPGA 3EN0A 3MIIA 1EQUA 1SU7A 2YBEA 1H9BA 1R6AA 3F73A 4J07A 2NACA 4RTLA 3UJ7A 3AEQA 3ABOB 5CJ2A 1YR6A 4W7IA 3WVNA 2F3PA 3QX9A 3KZOA 3SXPA 4Y9RA 3HKBB 3T1QA 1G5TA 1OKKD 1GZDA 1R50A 1U0LA 3G0BA 3HZOA 4XQGA 2XXAB 4K26A 2H7YA 1CETA 2IWRA 3W0LB 2PK3A 3K0SA 1RBMA 1Y7PA 5CB4F 1MX5A 3LPLA 3REFA 1SHZA 3QU4A 2OCIA 4WUVA 2UZ1B 1RYEA 2FMUA 4WXEA 3SZ3A 3RV3A 2A0FA 5YASA 3UGJA 1N36B 1K3QA 1UUFA 4TLMB 2CNBA 4BDTA 1FYWA 1UFVA 2GBLC 3DEZA 2HMUA 1E79A 3U9SA 1QZZA 1X42A 2Y99A 2CDNA 1C9YA 2XAUA 5EAIA 3BRQA 4B0OA 4EG0A 2O7RA 4RENA 4EJFA 3OPYB 5CK5A 1E2IA 2NZXA 2Z6VA 4YT2A 1QKIA 1EWKA 4J7AA 7MDHA 2HT6A 5KNCD 1XVLA 2LKDA 3TTSA 4EJSB 3CZPA 4LOIA 1YK0A 1ZN8A 1XJ5A 3KPJA 3T9FA 3A1FA 3JQPA 3MB8A 4FU0A 5EI5A 3TGWA 5FBWB 1UJXA 2OECA 1FHQA 1I7LA 5FTNA 2HFJA 4C9BA 1GGVA 5IJ0B 2V6BA 1L3BA 4L50A 2ZE8A 4EF4A 4MVJI 3CN7A 1AQYA 3TZCA 3G2QA 1POWA 3TEFA 2HJRA 1NYTA 1EK5A 3QFFA 1XMOB 4NH0A 3LRTA 3WFJA 2RGAA 3T3EA 3HA7A 4KAAA 3BE4A 1Q12A 3IXQA 2GD2A 2AQ8A 2KW5A 2Z58A 3IBGA 4HZGA 2XI4A 1VMIA 4G85A 2Y1OA 4Z0NA 1SCAA 1EFKA 1KJ9A 2E0IA 4I5DA 1JQDA 2YVUA 1HOTA 3SHOA 5CB8A 1RPJA 2Q5IA 5DHUA 3E2MA 3O7MA 2ZBRA 3X1WA 3K0AA 2Z4RA 4D9BA 4ETWA 3PJRA 1T5SA 4Z0HO 1M8GA 5GMOA 1BO6A 3FOEC 4EG1A 1GA6A 3RU7A 5BN3A 4AJ4A 3HFRA 4A0EA 1W4CA 3BIXA 4F8EA 3G9ZA 4EA8A 4IQ8A 4RVFA 5DNWA 5TB5A 2ZYVX 4PAQA 3ADBA 4M9XA 3EGOA 3ELUA 2BFCA 2FUNB 1Z5UA 2ILTA 1FQWA 5TS3A 1BX1A 4PCVA 5I4IA 2E4VA 3EC7A 4BFUA 1HZZA 1LPAB 1WQ3A 4J49A 3R0XA 2IXGA 5I9NA 1R37A 4G23A 1C3EA 4WK0B 1WXHA 4OHXA 3JZAA 4NSNA 5CDGA 4JI0B 1TAUA 3G82C 4JU9A 3C3KA 4M6WB 2IV7A 5A2GA 5T4EA 2IYEA 2X4IA 3I6BA 5AM5A 3LZ6A 3LSYA 3HFJA 4DMMA 3SKYA 3O38A 3U0BA 1ZOIA 2GHQA 3PHCA 3WHKA 4H77A 4D9NA 5FCDA 1REQA 3VSAA 4U2EA 3HB4X 3KXKA 3VHQA 4BB5A 2H4JA 3A9VA 1OXBB 4TMTA 5HIIA 3WBFA 3ZVLA 5JBNA 4HRVA 3GVXA 1WSAA 3WSTA 4URFA 2Z8XA 4ALLA 4EO7A 4E13A 3F1KA 1KK1A 2ENUA 2IYLD 1E92A 2GF2A 4LNHA 3RYIB 4TTRA 1E1RA 1YMVA 3E84A 1IOZA 5BOVA 1KZGB 3R6GA 2HIAA 3DD5A 4A0SA 3A28A 1P8AA 2VDLB 3CHYA 3WLIA 2CLIB 2VCEA 4UTRA 5IK2D 2EFGA 1BXGA 4LZOA 1Y1QA 4DV1B 1SBQA 3ZV3A 3FGNA 5DTRA 1CNFA 3IAXA 1TYBE 3RKUA 4N5IX 2HCFA 2XDYA 3BPSA 2I8LA 4OL0A 3REGA 4A0QA 1LW6E 1T91A 2O4CA 4WTOA 5C4GB 5LZ8A 2VVTA 3RKRA 3GLUA 1AGRA 5KTSA 1EP3B 1CEEA 1PHRA 3HVIA 3IOCA 4ZA2A 4H6VA 5IXYA 2AUMA 1ZC3A 1FTYA 3KE9A 5FBHA 2H1HA 2GXSA 3ETDA 1J0EA 1SELA 2R0QC 5JELA 2D0IA 4QBFA 3UPUA 5A9RA 2BUAA 3FYUA 3KT8A 2WV9A 1LPBB 3LJKA 5JDCC 2H08A 1S2GA 3B2NA 4XGIA 2XUIA 2G17A 5T3UA 2OYRA 3DMTA 2UVDA 3VZPA 2NTYC 1PV1A 3E2IA 1JEYB 1RJGA 2WT8A 1JVBA 4JCOA 4BX2A 1K7FB 4FZRA 4F1JA 1RWQA 1VBMA 2XQGA 4LYGA 1MR3F 5BSRA 5B36A 2XT9A 1Z4MA 4PLFA 1IJKA 3MK31 2HMTA 4LC9A 5HIAA 1E89A 1X19A 2FUG1 2PQMA 4Q9HA 1SBYA 3RVRA 2GZ1A 1LSUA 3KHUA 1NV8A 1M0TA 5SV2A 5ALVA 5BNWA 2J33A 2ZQYA 3R6TA 2ZUSA 3EUWA 1FSGA 2A1TR 4MYRA 4ML3A 1PTJC 4MDYA 1JDVA 2PKCA 4IJMA 3OM0A 4WLUA 2VYNA 4DM7A 2EL9A 1JFRA 3CE9A 4KXXA 2ECQA 2Y0BA 3V1LA 3LFTA 5JZSA 1AQUA 1YUNA 1ZS9A 1Y1LA 2AGVA 5C80A 1GAXA 2A4MA 1Z8NA 3FKSA 2BE7A 3C43A 2X5KO 3EIXA 2NZJA 4OH7A 3WLFA 3OESA 1G8SA 5HKKD 4OH1A 3COYA 4R7TA 1LVUA 1PS0A 1CE8B 1SNYA 4D9MA 2O3UA 4Q7LA 1KHUA 5BVIA 5T4BA 4LF5B 5ALJA 1PT8A 2C3MA 4QL3A 4D5GA 1SR8A 3ILYA 3PRYA 4DY4A 1LK0A 2O2ZA 1CQWA 4WY2A 5IZ4A 4OAOA 3E8XA 3GT3A 3KUKA 5FQNA 4AY5A 1DFIA 2AI3A 3FA2A 4MUGA 2PRYA 4WXRA 1BEUB 4TS9A 3ZY4A 1KRXA 4F6CA 2JHPA 2H11A 4AUMA 3WICA 1FK8A 2ZUFA 3S2GA 3WLEA 1T36B 3CZ4A 1YL5A 2GBPA 3PC3A 4Y1EA 1E2JA 4GZLA 1H1DA 3R3YA 1C3OB 4Z3DA 2H1IA 3WBBA 4X90A 3JQCA 4EFMA 3L1HA 3RUIA 3O3MB 3Q10A 3V2GA 4GKJB 1T5BA 5JWHA 4DLNA 1KI7A 1VE1A 1Z6QA 4D9CA 2OBXA 2P11A 4MI6A 3UB2A 1YKFA 3NGXA 3ONEA 4E3ZA 4K3UA 4EF5A 1I2CA 2XCQA 3AX6A 3BJIC 4EB6B 1UPTA 1YZLA 2X8AA 2IXTA 4A27A 1Y8RB 1M2OB 2OQ2A 2I4RA 1PTKA 1Z7GA 3EG9B 4HYEA 4C88A 1BH2A 3DT9A 4B3CA 1R8JA 1FHRA 3FPAA 4U02A 2AOWA 2CNWA 2XA2A 2H5JA 1G7RA 4XQ9A 4DCOA 4IIBA 4DCGA 1U1GA 1SZPA 1QOPB 4HNVA 2IYXA 4FOOA 4HWPA 4OQPA 4EEKA 1M2VA 1K89A 2V03A 4R2MA 4WWHA 1UMBB 4Z1MD 5G1OA 4O4HF 1KH2A 3ES9A 2YN2A 5IYZF 3JZDA 4HQ6A 5FADA 5B6JA 1NNSA 1WZNA 4HWGA 3EVTA 3TQTA 1X7WB 2CJWA 1AKNA 2LD4A 1J0DA 4Z9YA 1Z34A 1XZBA 3KX2A 2EJTA 4XM0A 5IG2A 4MUIA 1UP4A 3WIDA 4EUHA 1EJBA 4DXAA 1DBRA 4UTPA 3KVRA 1EXWA 2PLNA 4R51A 5CLQA 2QKYA 1Z3CA 2ZRKA 3LCJA 3BD7A 5D8DA 4RTPA 3Q0IA 3HKEA 2IBMA 2QSJA 1MTZA 2W4MA 3T99A 4DRYA 5F7OA 1W5FA 4S0ZA 3C3PA 4JSRA 4NU0A 4QFDA 2WTEA 5FLEX 1ZUNA 3F74A 4RH3A 4R1UA 4EGFA 1EGMB 2ZJ5A 5IXSA 2VF8A 1DFHA 4JENA 2QX8A 4RD0A 5TVKA 2ONYA 3JV7A 1MO3A 2K2WA 3QLUA 4P0QB 2ON6A 3NHUA 3PEEA 4PSKA 1L5NA 4JYMA 2AUTA 4JBGA 3OX3A 2PZJA 4GU5A 3UN1A 3PTAA 3H5IA 1SKUA 4GHWA 1NNEA 2QD5A 3Q6MA 2HT1A 2HJ9A 3KYDA 4UHEA 5AH0A 3RFVA 2YHSA 2V7WA 2X9LA 2ZYAA 2HA2A 3L46A 4GZ3A 4L5BA 2W9XA 2WUFA 2QPLA 4MGIR 4BU1A 2E5LB 1JIIA 1JXQA 4R31A 4L9RA 4QDXA 1TT5A 1QP8A 1XCBA 5AP9A 3VR1A 1DO8A 2CC2A 4C4AA 4X6UA 3OQJA 3QYFA 5KOYA 4OHYA 1HZZC 3IX7A 4RFLA 1RXYA 3OZCA 3GEPA 2AG6A 1A50B 5HVNA 3LQQA 3MWFA 3Q12A 2BTQB 2AOTB 1ML4A 3IDZA 4BUJA 4LJ6A 4DA9A 3VTAA 1UP7A 4CQMB 2ZTVA 3GNQA 4JJ6A 3LY5A 2GYVA 4A26A 1CYEA 1XYGA 4GL4A 1VL2A 1P1KA 1CB0A 2J07A 2FQ1A 3D4OA 2R2AA 3ETHA 4GI7A 1G0NA 2HEGA 1AQIA 1VM6A 3NMUF 2B8WA 1M5TA 4BQFA 2YYZA 2I87A 2GX6A 5ELMA 1U7XA 2F3SA 2J3HA 1YBVA 2HU2A 5EMHA 3GFBA 4TKVA 3AJ9A 4KDCA 4MOWA 5CIQA 1MTOA 2WU8A 2YJ3A 5H1YA 2I6TA 1VL1A 2Z5GA 2CLHB 4HZUA 5KKAA 2DQ4A 3E15A 1KKLA 3TLYA 2Y0DA 5DN6D 2F4VB 1M66A 2SNIE 4HOYA 3ZHSA 1I7DA 3D8NA 2JD2A 4HTAA 1QGUA 1GO2A 3BGOS 4JT8A 1ZWKA 4FW9A 4ZI7F 5DVZA 3AM1A 5EPUA 4RCZA 3S44A 3OU6A 1KHXA 1T8UA 4KPGA 1GITA 1WULS 2FZKA 2FFHA 2VJMA 3HDHA 1YFJA 1ESCA 3NW9A 4A6XA 5JZMA 1FMFA 3DMDA 1K4YA 3STYA 3AT1A 3EFEA 3OX1A 4BY9E 4YJHA 4ARSA 3I5MA 2PKQO 4TXJA 1XCOA 1XAJA 2C8KA 4BNDB 1JQ3A 4YXWD 1GTZA 4R0VA 4S2EA 1GT6A 3FYUC 1AK2A 1IPHA 2P9EA 3E5MA 1HO3A 1ZGJA 4XIIA 4XFJA 1R2QA 3UB3A 2BH9A 2BC9A 3NTOA 4ZGWA 1NFQA 1NT2A 1VLJA 4IIDA 3IMFA 3QSYA 2NAFA 5FB3A 4F8JA 5J2TB 3KDAA 4JUFA 3EMVA 3L7DA 3NHJA 5AKGA 1XIVA 4Q02A 1E9CA 4BCCA 1Z5ZA 1T1JA 1J2TA 2EQBA 1VL6A 4EGQA 1PSZA 5E2IA 3HV2A 4J0HA 1Q21A 2GCNA 4OFZA 5KNDH 2DETA 1UM8A 3ABSB 3O31A 2PZ8A 3IXMA 3OOEA 3OPYA 2X7HA 1N5DA 4UTVA 3ONFA 4S12A 2PH1A 1BDHA 2CUTA 2PWZA 2ZJ7A 4ARBA 4B4WA 5ED4A 4BXOB 4G26A 2QI9F 1DC5A 1HEUA 1I51A 2JCGA 2B2NA 2X7XA 4BOYA 4EJSA 1FVOA 5AYVA 1WUTA 1WDLA 5JWRA 4HV4A 1MAAA 3UGTA 2RGXA 4H18A 5DNUA 1RLUA 1N0UA 2Q29A 5A8IA 5K0JA 4JI7B 4WW0A 3OMLA 2J9RA 3H6GA 3F4LA 4IO1A 4CDGA 2I99A 2PL5A 3BL5A 3EBPA 1UL1X 2G6TA 2E2WA 4MIEA 1XZEA 1BS1A 1AKVA 1OJ7A 2YVQA 1E3QA 3N5KA 4IBOA 4HYTA 4P82A 2AJDA 1M8KA 2HF9A 5JATA 1SUAA 2CXSA 3BTUA 1O94D 1MD9A 1QIMA 2D1TA 2Y2UA 4WXPA 4AMBA 1SQFA 4F4UA 3LQYA 2PFSA 1VP3A 1UPCA 2IYUA 2JIMA 1O77A 5H3HA 4OYLA 3NAMA 1NE7A 2VSNA 4HWOA 5M2QA 3HU3A 3NDPA 4BO4A 5LN1A 3E7DA 2B3TA 3FAZA 1T3LA 1G6OA 5CDTA 2VNHA 3NHFA 3TQSA 4EG8A 3ER9A 4C0JA 3HM9A 2BEWB 1RYHA 1AOXA 1MXFA 1SUCA 2ZRLA 4X8MA 2H2GA 3U0VA 4JJGA 4BNZA 1QPGA 3HO8A 4Q34A 1Z5VA 2ZYWX 4DV0B 2VXBA 1O94C 4YFVA 5LL6P 2H4ZA 3TUJC 5JQGF 1SK9A 4S1OA 3OQ1A 1KJWA 1RIIA 3QJGA 4AJ9A 1NBIA 1GDTA 2WJJA 3C24A 3ORFA 4M1WA 4QFCA 4ER6A 3GJQA 5CYGA 3RC9A 5JDIC 1VL0A 1Z45A 1WEKA 4E1VA 3NETA 2RH5A 4XD7D 5ALKA 4M6WA 2QENA 2CMDA 3G5TA 2JAHA 1MH1A 1T13A 3GP3A 4PHFA 4DIKA 3QOFA 1MKYA 1BMFA 5ALZA 5AOAA 3I05A 2H1LA 3W3ZB 4FSDA 4J4TA 3ZE1B 4EA7A 1TUBB 3Q7TA 2AW5A 1L4FA 2OBNA 1JP7A 4RQUA 5EP1A 3I5XA 3VRHA 4YAFA 4DIDA 1Z82A 1KMHB 2HSWA 4BV8A 4P5PA 1D04A 2AQHA 1U1IA 2RGGA 4PEVA 4TWZA 3VDXA 3W4IA 4AN4A 4D79A 4ITUA 4OQFA 4IJUA 4LRTB 3DUFA 1GL7A 3MJTA 1L4EA 2P6PA 1NMXA 1A9XA 2YHUA 4ANFA 4W9MC 1TU0A 2G4CA 2Z4SA 4P81A 3MQFA 3QELA 4KQEA 4C3UA 4P1ZA 4C4TA 2WKQA 1DAFA 1XQXA 4DCTA 4F8YA 2ZBQA 3NTQA 3MWYW 2Q6VA 2WMYA 4PRYA 3UC9A 2UV8A 4MP3A 3I53A 2O50A 4LY3A 4UNNA 5GY7A 1DUSA 1Z33A 3IIKA 3L7JA 4J0CA 5DXAA 4ZDWA 4ZCIA 3BIFA 4OKIA 3FWPA 1BFKA 4H59A 4IKPA 4B7CA 1YNOA 5KSZA 3M3DA 4KR9A 3VR3D 5CGQB 1P0CA 4IDNA 4F60A 4CG1A 1F60A 2XMCA 3TECE 1ZD9A 2FPPB 2G25A 2CV2A 2WJHA 4KGZA 1YH3A 1Y3IA 2VDNB 3PC2A 1XQVA 4YREA 2PXXA 5JS2A 2BTOA 2PR2A 2OV2A 4US2R 3EXHB 4C6TA 4CF3A 1X13A 2G0AA 2V65A 1S3SA 4NG4A 4PLYA 4CLRB 5K0EA 3QLUC 3WLHA 2AHRA 2IP2A 2VUTA 3N86A 4GBED 5HOEA 1G6HA 2BHTA 4DVJA 2L69A 4LMPA 3RAJA 5FXMA 2V3VA 3WK6A 2HJGA 5K0FA 3LPMA 5FI3A 1JEQA 1T5TA 4GI3A 5JTTA 5KX5B 1U0HC 3E9EA 4QGHA 4DMRA 3FTPA 3A2NA 3IVCA 2O19A 2XSZD 1JDUA 5BVGA 4IYJA 2A58A 2W11A 2YY6A 3OA2A 2WI8A 1AUQA 1MC5A 3FKJA 4HGNA 4IJ5A 3WLQA 2RD2A 1R8YA 3F3MA 1DQRA 1ZNWA 4TQAA 5EUQB 5J59A 2QTNA 4JJ4A 3ZJVA 3BCUA 3WFIA 3A4NA 5EP3A 5J58A 5JNRA 1I13A 1TM2A 4LYEA 2E55A 2GRJA 2JBWA 5K45A 4YMWA 5I8PA 3I5UA 1KS2A 3L0PA 5FOVA 3PI7A 5EFZA 3ZIDA 5IKXA 3C6KA 5JCZA 3CUUA 3L1JA 4FW8A 2WPDD 4OFXA 1VECA 2O8VA 4E12A 3EH1A 3TB6A 1CE8A 5T7BA 2ATEA 2EATA 4FB5A 3VNBA 1MJHA 3DQZA 5BN5A 3HL4A 4W6ZA 4NCJA 1AHPA 1R5JA 4H3KB 1BAPA 1KYVA 1LLDA 3Q8LA 3I4FA 3UYLA 1G64A 4Q7EA 3W9SA 4W5JA 4Q7QA 2Y05A 3ZZTA 3UJNA 1SVNA 4KAFA 4NHEA 2PRZA 3DBRB 1LTHR 2O2CA 4ZAVA 3EYWA 3FGPA 2P91A 1CR1A 3K9QO 4RX1A 5THXA 1T36A 3K15A 4WBNF 4KQ1A 4WCVA 3IBSA 1WCV1 2RH9B 3QYPA 2CSXA 1IJBA 1C3OA 1Y63A 3AUJB 3D6UA 3N58A 3W2EA 3FSGD 3H1PA 4YCMA 2CLDX 1T9HA 2G28A 3ND5A 3R24A 5ADHA 2A7QA 5CH3A 3O92A 2ZR7A 3GHYA 4YRNA 1GGNA 4M46A 4JFAA 3OQHA 3I0NA 4WADA 2H2AA 1UBTS 4IWXA 1PR5A 3MCZA 5DB4A 1FYEA 2GF9A 2HDWA 2PS1A 3ANTA 4EB6A 4YHHB 4UFNA 1C3VA 4BNXA 1TJ5A 3O2QB 4TKZA 3O1JC 1NBMA 3ZZ0A 4LSGA 3PTZA 1B16A 3B6IA 3D6JA 3PITA 4G37A 1C7RA 3CSSA 3AY0A 2J0VA 4A15A 1D6NA 2J41A 3JRNA 1KDOA 1OLUB 4JUBA 2VDRB 4WSOA 5E6RB 4XVCA 1WWKA 2QN6A 4PLGA 4RKRA 3RU2A 3A7DA 4OXNA 1IVYA 4NC9A 4OIFA 4Q4CA 3PJEA 5IEJA 3OY7A 4UOZA 5JNVA 1Z08A 3AR3A 3QU9A 4OHZA 2JBHA 5ITZA 1KO1A 1PU2A 1V7QA 3G8CA 3NBKA 4CIXA 1UBCA 4ZOEA 3K9WA 5E4TA 4F4JA 1JLLB 3KQSA 3HK2A 4L3OA 1BN7A 1HXHA 4CI9A 1XCGB 2OO7A 2XQJA 3A2MA 3NPMA 2BYTA 1UMBA 3JR3A 4JHLA 5LZ7A 3UMCA 2JJ1D 2HC9A 3O75A 2CZQA 2OK8A 2Q5OA 2C3OA 3SHVA 1N75A 4L4SA 5SZIA 4PZDA 2WM3A 3HI6A 3UWPA 4CM9D 4ESEA 5JANA 1ULZA 1I01A 1OXKB 1E5QA 4ZI5A 3TLJA 3QY0A 5K03A 1T8YA 3WP1B 1RM0A 2Z5FA 5AI0A 1WVIA 5INTA 2HA4A 2GHIA 3PPVA 4EKDA 1A2OA 3IS3A 3P9PA 3GEMA 1LTKA 1V3VA 4IUBS 1Z07A 2XITA 4CEHB 2I9PA 2VA9A 1NN5A 1UEIA 3CLVA 2AK2A 3KYCB 3MVEA 3X3HA 4REQA 2CCGA 1LU9A 4P7JA 4D3ZA 3DKKA 4F9FA 4OG2A 1XAIA 3PZRA 4G1FA 2R3SA 2WZQA 3L1UA 4FFSA 3FZYA 1LLQA 5CR9A 3L7MA 1GARA 5LBIA 4CR8A 1GAQA 4FYXA 4IF4A 4TWBA 5D7BA 1IN7A 1NQOA 3D64A 1KAOA 2XB6A 1R0LA 2AH5A 3Q6NA 1PJLA 4JNKA 3GA5A 3FVRA 5TY0A 5HDBB 1NV9A 4G4JA 4BAGA 1Z47A 3CXRA 1F2UB 2HOQA 2CEKA 4UMDA 1XROA 1N7GA 3DR5A 4PLHA 3VU9A 1X7DA 1NGSA 3LUCA 1BMQA 1FSPA 2G04A 3BDVA 3GEIA 3O2NA 3QE3A 3UMSA 9LDBA 1VXRA 2A78A 3H8WA 4DABA 3SNKA 1AUPA 1ONPA 3H3XA 5B5SA 1PYOA 3KJGA 4M3NA 4N54A 4OD0A 1JQ5A 4IWNA 2G0NA 4H1TA 1CHNA 2GK3A 4RUKA 2LV8A 2FZVA 1E59A 2R8BA 5BRJA 2WKRA 2ASEA 4JJKA 5IVIA 3PFCA 1R7RA 1WZEA 4MW7A 5L3VA 2BTQA 3QX8A 4K9PA 2D13A 3BE6A 1ODIA 1A4XA 1PJ3A 1Q95A 3C5EA 4JDUA 4CQMA 5DTQA 2X19A 1JW9B 1HM5A 2N75A 3BQNB 1L5MA 1YBMA 4UCFA 1EZ1A 1EFVB 4TS3A 5TV2A 3TLZA 1UDWA 4WLNA 3PX2A 5I3CA 2FSHA 2DBYA 1NFFA 4Q4JB 1ABEA 4BQPA 1YRQA 3FVTA 5JECA 3HYNA 1PLLA 5IDXA 1NUQA 3BB3A 2O2JA 3U7JA 3GROA 4DRXA 5AVXA 4DSOA 3TRJA 2FI1A 4OL9A 4BQIA 5G53C 3FDZB 3L5OA 4D46A 4GRIA 1CUGA 3LHDA 5BV8A 3NHLA 2W2XA 3O91A 4UC0A 3OOYA 1AUVA 3QITA 2ISSD 5M29A 4N41A 2GJAA 1VRWA 2JAXA 1P17A 3NHRA 1DWPA 2A59A 2H06A 1KQPA 2Y92A 1XD8A 3HYTA 3O4FA 5KNDD 3G68A 2J7PA 4CMKA 3WLSA 4LJYA 4BTVA 4QGSA 3WE7A 4B4UA 3WB1A 2YOGA 5HZKA 1Y1TA 1JSCA 5DBIA 3CRZA 5TF4A 1TCAA 2VATA 4HVAA 2YWFA 1GGHA 16PKA 2HMVA 4HNSA 3E3AA 4LSMA 4P93A 1SCKA 1P2FA 2DTXA 4BIIA 3QX7A 5HILA 1CSEE 1U0RA 1NI5A 3PCTA 1ORRA 2HKIA 5JAQA 4JBIA 1Q1EA 4B3XA 1Y8QB 4QLBA 5DNCA 3MHTA 1DOAA 2WVHA 1E9RA 2C5AA 1GV0A 2NXCA 3FVWA 3GZNA 1UK7A 3G2NA 4OLFA 5KYGA 1X1QA 2V55B 1XXHA 3LUFA 3GMSA 1K7EB 4XDGA 3T3MB 4BVBA 1L1QA 1XDDA 1ZFNA 3CQ9A 4GT1A 5FO1A 1RAIA 1SA0B 4QEKA 2NU7A 2P9CA 3WWYA 1FLDA 1KP3A 3IIIA 3MD0A 4N7JA 4ZAYA 3AI3A 3RAEC 2GOYA 5KYWA 1GU7A 4JSTA 4RABA 5CVUA 1XB2A 2VUUA 5AHWA 1WNTA 2AYZA 3DW1X 1PCXA 4U2BA 3N07A 5JCJA 3GLHA 1CQZA 3CUYA 1TC2A 1R4NA 1VHJA 2DT8A 4GPIB 2BGUA 4PLZA 2P65A 1Q11A 3QFRA 1PGPA 3E9YA 5TC4A 2REOA 1LDYA 2H57A 4DIEA 5K8JB 2O8DA 3LDGA 1U9ZA 3E3NA 3C6BA 1G18A 4LJAA 5KHAA 2V0GA 3HN7A 5EZYB 4TYPA 4WKGA 1UXHA 5HKOA 2JFOA 3RVBA 1IEWA 4OP3A 1MGPA 2HXYA 1LPPA 3TCKA 2NVUB 1QGYA 1Y3AA 2JJ2D 1T9AA 1VJRA 3KQOA 3RWOA 3ACCA 2NU6B 3KKZA 2GARA 3AY7A 4TQ9A 5F73A 3S0JA 3ZNNA 1M9NA 4KSYA 4OQMA 4F12A 1KY2A 3QMWA 3FPJA 1W93A 5JJKA 2C4TA 2DWQA 3VJMA 2H4XA 3EODA 3VHXA 3L93A 4CMJA 1E2FA 4RANA 5CXSA 4BTLA 4XGQA 3R3VA 1KVTA 3G85A 3T41A 2BEWA 1ZJYA 2X7JA 1WXIA 3U37A 4AXXA 5L6LB 3GCDA 1U0BB 3U1VA 1UC5B 2OFWA 3QOWA 2QPAA 1GR1A 2C2MA 3QV1A 4O4LB 3MTJA 3HB7A 4GLJA 3UFXB 1XU9A 5KDDA 2DAPA 4LGYA 1TIKA 2XR1A 3VHRA 4EVQA 5L45A 2WUEA 5AW0A 5I9BA 5CLFA 4DQUA 5ARCA 2HSJA 5EVJA 3GJ5A 2PKQP 3KZKA 3EQ6A 3U3MA 5DDIP 5T41A 4PCLA 2WJPA 4K9OA 3RHTA 5AR1A 4TMZA 3GQSA 2ZXEA 3DCYA 1VIVA 3GAZA 4UE6A 4Q1AA 3KVOA 1JF8A 3RROA 4D57A 3HKDA 4K3VA 4KVFA 3TXAA 5A2QA 1NP3A 1TUBA 3ILVA 1GZHB 3KU1A 2DT5A 4REOA 2W00A 5TEVA 3NG1A 1EK0A 2YWRA 2OILA 1J8MF 1W2HA 3D4NA 1RI5A 1HLGA 3FYTA 4L85A 3MSXA 2XY4A 4JCCA 4HLDA 5A04A 3IUYA 1BWPA 4L3VA 3SEZA 4DF3A 3I6QA 3U19A 4BO3A 2GS9A 1D4FA 1TJYA 3NWBA 4DLBA 2QRVB 1G7CA 4Z51A 3DBLA 3QNWA 1A2BA 5LZ2A 1G3GA 5JS6A 2IOYA 2O2XA 4ZDKA 1PFYA 3V00A 4YUAA 3MUEA 1GSOA 1A9ZA 1JEOA 3VZRA 1SRQA 3PXEA 3P0HA 1DKPA 1NTOA 3AF3A 3F6CA 5GIPE 2H4YA 1LQUA 3NHPA 1D5CA 2IUFA 1UMKA 4DUZB 4LNUB 4MQ4A 1P74A 3B6KA 3FZGA 3PD0A 4PZ9A 2COKA 3LLCA 4HVTA 2ZRJA 4QYXA 4U9IS 2BZ1A 3ZTTA 2A4KA 1C4OA 5IH3A 5JVDB 4U7GA 2A0TA 1Y5IA 2ATIA 3OKPA 2Z9BA 1YL7A 1X7YB 3FMOB 2PSFA 3GLRA 3PVSA 4B9AA 5CBPB 3GJ7A 5L53A 3FPGA 4RWZA 3WWCA 3EXHA 1ZUIA 3A1UA 3GDHA 1KVSA 1QG2A 4DQKA 4RVNA 1I8TA 2BELA 2QR3A 2QN2A 3U40A 1UBKS 4YCBA 3F0TA 1RWBA 5AOBA 2P8SA 5KCMA 3ZDEA 1JBEA 3IIEA 3K2QA 2I03A 1H4QA 1J9GA 2EP7A 1FP1D 1K3FA 4H27A 2UUBB 3RHZA 2XWJI 2CLSA 4DC9A 2G63A 2XA1A 2PFGA 3AHHA 2WV7A 4KO1S 1B0UA 2E6UX 4JJZA 2JI8A 2XTMA 4Y0NA 4UZSA 3QE9Y 4I5GA 2PWYA 1WZUA 1CF4A 1WMDA 4A0FA 4EI7A 4DA6A 4D4KA 1RAHA 1XI2A 4Q93A 1Z68A 1K8RA 1HYEA 3GMTA 1ECFA 1N2CB 2PQ6A 5D7NA 2QX4A 3TKYA 1IBKB 4X1OA 2GVNA 3I9FA 5TPZA 4FJ2A 4FR0A 3CZMA 1DDGA 4E7OA 3GLIA 3RTEA 5DYGA 1L6RA 3K1TA 3WA7A 2C2KA 3W4KA 2X77A 2ZR8A 3KR1A 3ADKA 2IH5A 1C9NA 2P9YA 3PRJA 1IUKA 1NL3A 4K6MA 1HYBA 1D2NA 2XMPA 1BD4A 1IB6A 2MSCB 3HEMA 4H3SA 5IAEA 3OIUA 3V9PA 2JVJA 4Z54A 1CVIA 1K7YA 1I36A 4X63A 1XNGA 4KIJA 1AS3A 4JLPA 5AUNB 3O4GA 5KOIA 4HPJB 6NULA 3H8VA 4I8DA 2DPYA 4U9UA 4DSTA 3DO8A 2Y66A 1C29B 4IIXA 1G4UR 2B4TO 3VH3A 2FZ4A 3GAAA 5EIFA 1G5HA 3RUDA 5HQTA 5TR9A 1L5QA 1NMYA 2W0SA 4GEGA 1GSHA 4X1YB 3BGSA 1ZIYA 4DNOA 3AR5A 4IUYA 1BH6A 1NAHA 1CZRA 3O95A 3TH5A 3NV9A 4EQZA 4LBYA 1IH8A 1ORTA 1Y6QA 4CE6A 2ZTUA 2YY7A 3EZ7A 4Z8XA 1BDMA 5I5GA 5TT0A 4QPZA 3WSWA 3DEKA 4K6GA 4AUKA 3BIWA 4MS1B 5E6RA 1OLUA 1SUSA 4IO0A 2YC2C 4JIGA 2H17A 4YV1A 3O2SB 4WK6A 4WFIA 1G8GA 1HTTA 3R1IA 4LI3X 1T4BA 4BN5A 5ALHA 1T24A 1C3LA 2ZAGA 2I78A 5IT0A 3TFQA 5JARA 1YNSA 1FNCA 3GRCA 5ESXA 2GFQA 5ELXA 3IAHA 5AK4A 5CG1A 3D31A 1QGDA 2JFYA 3R5JA 2RJOA 2ODQA 4KMRA 2R84A 1ZN9A 3OO0A 5IMBA 2C98A 1QIKA 4YMHA 1RE1A 1RM5A 4Z4CA 4UHCA 1ZJZA 3OZXA 2J3DA 4JOQA 3IVRA 4OYHA 3VR6A 1ULHA 1HMPA 1H2BA 2FX2A 1PP4A 4CM1A 1KJQA 3Q9SA 4XVQA 1RRGA 2CSWA 5LBTA 4BE7B 3L4KA 4PYNA 3WGMA 1GV1A 3VBEA 3JWGA 5BWNA 1YJ5C 3U7FB 1SC6A 2QZSA 3GGPA 2XIQA 4JBNA 3ZHUA 5GTDA 3PIRA 2HGSA 2JANA 2JIDA 1TZ2A 1TQ8A 3QBEA 3VH1A 4BWYA 4UXJA 821PA 3NTRA 1ODSA 2YMLA 3GJZA 4MS4B 1AHIA 2E5FA 5D3KA 3OH8A 1B43A 5KMGB 5LXTB 1AB5A 1NQAO 3KYCA 3K71B 4Q4HB 3JQ7A 4CUZA 2R60A 5JFOA 2NG1A 2R44A 2XMSA 3BERA 4U7HA 2FPIB 3GD5A 4JX8A 1MEOA 4NYMQ 5G1PA 5M3BA 1MMFB 3ZJ4A 2PX4A 1PZFA 1M83A 4E6EA 2MYNA 5TSDA 1M6HA 3NIGB 1C5KA 2DKNA 1HLDA 2WTUA 2ZIVB 4QGGA 1CJKC 1Y8ZA 2ZPTX 4K1XA 1N5OX 3BH0A 4MYUA 2CB0A 1F2UA 2H31A 3CONA 3NASA 1G66A 2HR1A 4BVGA 5DM1A 4P6VF 4Q5IA 4DDMA 4QYWA 3S40A 4MZDA 5BR1A 3G9TA 3NAZA 4NRDA 5CVJA 4C0QC 3QUCA 3R7WB 5KNLA 4C7JA 2E3JA 1V11B 4DR1B 1B0ZA 1XRSB 1KQFA 1Z0AA 5K6AA 1GNPA 1YQGA 1U2ZA 4YWJA 1TEZA 1JR3A 2F8SA 4XGNA 3JQAB 2VDPB 4X91A 3TX2A 1Q1QA 2D2EA 1EINA 3B6ZA 2E37A 2JLRA 1K6JA 5FV7A 2OV6A 1SUEA 1KI8A 4J2HA 1AO3A 4OU4A 4Q48A 4IL5A 1SXGA 3OTWA 5KOJA 1UEJA 3WNDA 1V9CA 2VK8A 1QC5B 1QZUA 4BZXA 3HM2A 5ER6A 3ZKAA 2RHJA 3A4TA 3KK0A 4JX9A 2OYSA 4JQSA 2EJCA 4JEHA 3B3FA 3LTEA 3QEBZ 3UNMA 2IZOA 4G56A 3I58A 5B2EA 1A9XB 4LKOA 5HYVA 3OE5A 2ZIWB 5AVQA 1VPWA 2J3MA 2FHSA 3H9JA 4F11A 3IQGX 4CQLA 4LFBB 3TIGA 3VR4A 4JMPA 4OQYA 4JITA 1YONA 2ZDQA 3HY3A 3LOUA 4YLEA 3ESDA 2NVWA 4A82A 1VPEA 1XNRB 1QAMA 3A1TA 3FDZA 5TMEA 1Q7TA 3F2IA 3E1KA 1V41E 3OF3A 1CJBA 4N82A 1YMUA 3OUTA 1XTJA 4FYVA 2AXQA 4AMYA 2QF7A 2QTGA 4B6RA 3RU9A 1EWTA 4U7PB 2QMZA 2C96A 3WQQA 1W29A 3D1VA 3FBTA 1GD1O 4AWAA 3BJZA 4DLXA 4YV7A 4D98A 5GVSA 2NIPA 3II6X 3K94A 1T15A 4J0QA 3WWEA 1U04A 5THQA 4B4DA 4L15A 1BE0A 2C9YA 1P4SA 3UMJA 2WLSA 1D2CA 4MVCA 3BMQA 3NOQA 2DBZA 5C52B 3EVNA 1AXEA 1L4BA 2RGUA 3PTLA 3AW8A 3LLUA 3FD8A 4BP3A 5LP6A 1LQ2A 1YVEI 5DTJA 5BXYA 1M34A 3I8OA 4XUEA 1J23A 2CXXA 3R3JA 4LRUA 4ON9A 5LCXA 3A3OA 5ABPA 5I4KA 4P98A 3HKCB 3AKZA 1N6IA 1X7XB 2P7HA 1BOOA 1VLQA 5LYJB 1LNSA 1SA0A 5EXTA 3R9IA 3DAOA 2QM8A 2CVZA 4JQOA 3FROA 3TZBA 2NMVA 3C7TA 3A31A 1VL5A 4Y7DA 5CA0A 4N47A 2G9ZA 3CTMA 3L04A 4W99A 4ZT4A 2FPLA 1TQ4A 3HDVA 3KB1A 1BE1A 4KJZA 3RTGA 5KU1A 2W42A 2P6RA 3C6ZA 3JARA 4HDAA 1XKQA 4YYZA 2QNIA 1OKKA 4QQKA 2I1WA 1TI7A 3V8NA 1XRQA 3N2IA 4Q7JB 4ZOAA 5ALIA 1SURA 4DILA 3CJTA 4DG8A 1E2EA 4MR7A 5SY9A 1FEZA 2DRIA 1E3EA 2GKSA 2OAP1 3HJGA 4BNFA 4ZTZB 5B6PA 2R65A 3DTYA 1CEQA 2HCRA 2ACVA 2V8OA 3I2GA 2IZZA 1FMTA 3HXPA 4BEJA 2HZ7A 3RIEA 2NVUA 1ZGBA 1I4DD 5JNSA 4L0CA 2NU6A 3DDOA 3R7LA 2QYSA 2IEAA 4IZOA 4OSPA 5B2ZA 5SYMA 3PD1A 1Z17A 3LDAA 1DKQA 1QGZA 1T0HB 4JUAA 3TNYA 2CSUA 1MOQA 1JQAA 4PZPA 3QLEA 3IP1A 2WR8A 2H4FA 3NC0C 1OFVA 3B7PA 1O97D 1NF2A 4QQNA 4UBJA 1EX7A 2NW6A 3PHLA 4KHPB 2P67A 3EWSA 5BNZA 2FG6C 5AI5A 5I51A 3U3RA 1UXKA 4QPCA 3DDSA 5GJCA 2OZVA 3DLCA 3KCNA 1LPNA 4II3A 1E0SA 3FTCA 4Q4LA 4AP9A 1UK9A 1E9EA 3A6KA 5AVJA 3K4HA 2A0KA 4J9UE 1E63A 4P2BA 3IBCA 3QTLA 3VAYA 1F38A 3LVRE 4NOMA 4W5QA 4G5OA 1CZOA 1SKBA 4IHKA 2BP7B 3WK9A 4LOLA 1C2YA 3ZCPA 1JU3A 3L7YA 4ND8B 4QUAA 4UCXA 4PQYA 5AHKA 4G4SP 5F7XA 1PT9A 1WMBA 3ENQA 4PWZA 3ZWBA 2V7EA 3DW3X 4RJ2A 1O97C 4B48A 1FRVA 5LFAA 2Q21A 1HLFA 3INNA 4RKYA 5IJ9B 1C1HA 5IM5A 2P2YA 4PN7A 1U31A 2AZ4A 4Y1FA 2BGTA 4PYLA 3R3SA 1XBTA 1JXOA 2FG5A 3KSAC 1HQDA 1J42A 2DR2A 4Z4IA 5TGZA 2OXEA 4D3DA 4DT1A 2YWBA 1ISMA 1NPTO 2BRUA 2HA0A 1SUFA 4U7JA 5FLKA 4PLCA 3U81A 1VIMA 5CFOA 3U4DA 4DCMA 1D4OA 2X2FA 4MKXA 3FRHA 1CUYA 3IA2A 1DRVA 1XCLA 1T4CB 1XDSA 2A9VA 2WJGA 1SUWA 2QV7A 4M0MA 4QYTA 3R7FA 1V26A 1VIDA 4RK4A 4MEJA 5AVVA 3ZBUA 1PVVA 3GNTA 4H6PA 1QO9A 4RY9A 4EYGA 2CFOA 1JT9A 3E8MA 1NXQA 5HKBA 1TJPB 2EG9A 4TXHA 4HB2A 5TVGA 4G0YA 4TTVA 5IANA 1LA2A 2NPIA 4G81A 2OHGA 1E2MA 2C1XA 3KLPX 4TMYA 4UUNA 5B3KA 3CF4A 1YJQA 4ZOBA 3TJZA 4PGHA 3H2BA 2PUFA 1HEYA 4AQYB 3H1FA 1RJDA 3L7OA 2HV8A 2P0EA 2B4YA 2QUZA 2WU4A 1X7YA 5ITZB 5FA5A 1XO1A 3CO5A 2DPLA 2RJ3A 2X22A 3VMMA 2PUTA 4XWYA 5EPOA 2QP3A 4BHTA 2ZTHA 3LWBA 5AVSA 2FZLA 4O4JA 3PJFA 4J2TA 1IOLA 3FNEA 5K3SA 3BCRA 4IXMA 4P3KA 2ABWA 1FX0A 5DI3B 1RWOA 4YYEA 3JQ8A 4ZYZA 2WHYA 1NF9A 1SC9A 4DS3A 1DBPA 3LK7A 5KYYB 3AL3A 3CA8A 3EZLA 1UMDA 2EDAA 1TQ2A 2JFGA 4B7ZA 4OQLA 4KSBA 4HDSA 4Q4DA 3RUFA 3PUJA 5EQTA 4I8IA 1K9SA 1OI3A 1TCBA 1N1EA 1HDGO 4FDTA 4RVUA 4BL5A 3L05A 4HD8A 4XARA 3VVMA 1N2CA 4PTZA 1GQRA 2QK4A 1L5GB 4AT1A 3ZWOA 1J5EB 4TKLA 1LLCA 2IV2X 5JSZA 5BV0A 1SWWA 4V0LA 4F4FA 1IL0A 2YYSA 2BZSA 3RG2A 3SSNA 1TX4B 3BOSA 4RZHA 3F2VA 3SE0A 1X3SA 4BZQA 5AIBA 4MWGA 1NLMA 4YAUA 3RFXA 1D1SA 1GQ2A 1A8PA 1U90A 2Z2KA 1Q1AA 1Z4JA 3L0DA 3CR7A 3V1TC 4FINA 5CYFA 4INPA 3K5WA 3STXA 2A35A 2WDPA 3EQ9A 3L07A 2QY6A 2OBBA 2HA6A 3P96A 1HORA 3EDYA 2FCRA 4AD8A 4G0UA 3RTDA 1DG3A 2XTNA 4M2LA 4Q3NA 13PKA 2FEPA 3P1JA 1EFRD 1QFYA 1UINA 2FG7C 2IEDA 4OMDA 4R1QA 7REQA 5HXAA 3DLAA 1IOWA 2ES4A 4LYYA 3UYKA 4MSUA 3UV7A 1H8HA 4TTIA 4IG4A 2G07A 4H1HA 1QQTA 1H1LB 3HZZA 3SX4A 4CLDA 4UFOA 4F9TA 1WABA 2RAVA 3IQEA 4OATA 1GVHA 1U2GC 3SYKA 3WX0A 5HKKA 3AFOA 3DMGA 4HXYA 1J1IA 3NVDA 4OP2A 3WQSB 1D8TA 3AEKA 3KQYA 2I3AA 3BCSA 3IHWA 1O0BA 2WD8A 2JIZA 2Q99A 2VUHB 3PWKA 6PFKA 4JJEA 4GQBA 1T5HX 2WB4A 2ZT6A 1BVRA 3MGBA 4BCBA 4V3CA 2QN9A 2J9ZB 3IO5A 4RHXA 1J0BA 1O7JA 2HWYA 4F6RA 5AW6A 1VKZA 1AKTA 2H7XA 2XVAA 3OZDA 1DEAA 3P7MA 4PX3A 1VBNA 3IUJA 4RVGA 4JI1B 2F90A 5IDQA 5G4KA 5H7XA 4B74A 1FVFA 2R7AA 2ZS7A 3VTZA 1E96A 3U5ZB 3EZNA 5GM2A 3F3KA 4O1MA 1OI7A 3DC7A 1L4HA 1JVSA 3UT5B 3C8HA 5BVHA 3WTCA 2IU6A 3GPLA 3VNUA 1U0NA 2Z9DA 4N40A 2J9YB 3FLAA 1Q0RA 2UYCA 2YX1A 4LVNA 4PHGA 4EPXA 1R6UA 3KT6A 2QVYX 4UNPA 4C05A 3QVGA 4K2HA 2OVFA 4QQRA 2GEKA 3N0VA 2FW0A 4IX9A 4KGXA 3USES 2RGEA 5A6SB 5L3QA 4XDHA 2R6ZA 3FR8A 4L9AA 4OXRA 4YR7A 3A9SA 3S68A 4II7A 4IM7A 3GP5A 3D3JA 1NRJB 2QX7A 1RP7A 3CM0A 2PUCA 2A2ZA 4Z3OA 4OMCA 1PR6A 4X84A 1P0MA 5LXTA 2IIQA 3WWDA 2Q6KA 3M1YA 4YT4A 3AB8A 2QTVA 3E48A 1AF4A 2BBOA 5DCWA 3BX1A 4IQ0A 2AR0A 2BDTA 1TEHA 1IU9A 2X1LA 1I7PA 2UZIR 3GU3A 1IAVA 4XQEA 1CVRA 3AONB 1TZCA 4RZSA 5IKPA 3UQYS 3OZGA 3PCRB 2VAPA 1Z06A 5ED0A 1RXVA 1JTFA 4RU1A 3EVFA 5DTIA 4JVNA 1XMIA 4H60A 3HUDA 4F2PA 1SKYE 5AICA 3HCEA 3N2KB 5CDYA 2C59A 2OORA 1F4PA 3OCZA 4HRAA 3ZQUA 1J4QA 1IZ0A 1NFRA 1OU0A 2OFPA 2OQIA 2VP6A 1ZI8A 3EIQA 4K6FA 4OIMA 4ZEWA 421PA 3QLTA 1AIPA 1IZ7A 2ZVQX 3EFOB 1OX5A 3JYOA 4B17A 4FYIA 4DV6B 3GUUA 5I7SA 2A5JA 3G2OA 4K9QA 4D74A 5BWMA 2OO5A 2WWRA 3RQSA 3VR4H 2PUDA 4FHGA 4GLLA 3RWMB 3W1EA 3OBIA 2BCEA 1MQ8B 5C1IA 3JSAA 1C7JA 1OOEA 2QXUA 2YDYA 1EWQA 2A0YA 3IT1A 1RZVA 2OP0A 3BFPA 3IPXA 4GLFA 1QC5A 5SZJA 5CEEA 1JHOA 5ILQA 4B1FA 2QJWA 3B1WA 3IMGA 2BSXA 3K9BA 4FHCA 5EKDA 2R5NA 3AG5A 5I45A 3K5IA 2F1OA 1V9SA 1Y9EA 3BJMA 4O5AA 5KJEA 4D56A 2YV5A 3LDUA 5DEIA 5J2TF 2RK6A 1WV1A 1WTCA 1WUIS 3F96A 4GR4A 5AVOA 2EKLA 3S5UA 1C30A 2G5GX 3M2TA 3G88A 1QV9A 1U6IA 1YJBA 3NDBB 2ZPUA 3BB4A 4L51A 2OHJA 3LQ4A 1LFDB 5JEKA 2WVGA 2POQX 5AUQA 3GG9A 3AESB 2QLJA 4PSUA 4JZKA 5KJ1A 3D4BA 1R8SA 4G09A 4CL0A 1Y42X 4DMHA 1M1NB 1P8JA 1W4ZA 2B2CA 1A72A 3EGWA