3DITA

Crystal structure of mad mh2 domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
188
structure length
186
Chain Sequence
AFWASIAYYELNCRVGEVFHCNNNSVIVDGFTNNNSDRCCLGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPPGCSLKIFNNQEFAQLLSQSVNNGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Drosophila Mad MH2 domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Protein mothers against dpp
total genus 42
structure length 186
sequence length 188
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03166 MH2 MH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.10 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3ditA00
1MR1A 3GMJA 3A77A 5JEKA 1U7VB 4R9PA 5JEJA 5JELA 1J2FA 1QWTA 1U7FB 1DEVA 1YGSA 3DITA 1G88A 1MJSA 1U7FA 1MK2A 5JEMA 1KHXA 1KHUA 1DD1A 1U7VA 5JERA 5C4VA 1ZOQA 5JEOA 5BVIA 3DSHA
chains in the Genus database with same CATH superfamily
3ELVA 5EJFA 1MR1A 2QV7A 4HAOA 3GMJA 1DMZA 2AFFA 2Q5FA 3UOTA 1FHQA 5JEJA 5DHUA 5JELA 1U7FB 5EJGA 4KU0D 3VZCA 5EJHA 1YGSA 3UNMA 4EJQA 1J4LA 3V8RA 1J4PA 4WERA 3V8QA 1MK2A 2A0TA 2W3OA 3AFOA 4H87A 1KHXA 2QVLA 1U7VA 3MDBA 1MZKA 1G6GA 2KB3A 5DJOA 1J4OA 1FHRA 1K3JA 3S40A 5DHPA 3DSHA 2CSWA 4DY6A 2I2FA 2I29A 3UN0A 5JEKA 2JQJA 4WRRA 5DHSA 1J2FA 1YJMA 2JKDA 1QWTA 3UNNA 2KFUA 1K2MA 1Z0UA 1Y3IA 2XXSA 3I6UA 2JPEA 2I2CA 4L02A 3HUEA 1Z0ZA 3VZBA 1SUWA 3HUFA 3PO8A 1LGPA 5JEOA 3V8MA 2XT9B 4A4YA 1Z0SA 1J4QA 2P1RA 2FF4A 2I1WA 5DHRA 3HX1A 1K3NA 1LGQA 2BONA 2BRFA 2JQLA 4QCJA 4JONA 3V8NA 1UJXA 3I0NA 2G1LA 3V80A 5EJIA 5A8IA 4V24A 3V8PA 1J4KA 3UMZA 5E50A 1G3GA 3POAA 3T5PA 2JGRA 4A0EA 1MJSA 1R21A 1WLNA 3VA4A 1K3QA 1K2NA 1DD1A 5JERA 5DHTA 3ELSA 1YT5A 3UV0A 1ZOQA 5C4VA 2LC1A 1U0TA 1Y3HA 4JIWD 5BVIA 4EGXA 2I2BA 1WV3A 2EH0A 3V7WA 2AN1A 1GXCA 2PIEA 1UHTA 3A77A 2FEZA 2I2AA 2JQIA 1U7VB 4R9PA 3I0MA 3OUNA 3VA1A 4D9VA 1QU5A 2KKLA 3VZDA 1YJ5C 1DEVA 3DITA 1G88A 3I6WA 2KB4A 4JIVD 1U7FA 5DHQA 1U0RA 3V7YA 3V7UA 1KHUA 3PFNA 2I2DA 3FM8A 5JEMA 3GQSA 4G2SA 3VPYA 3KT9A
chains in the Genus database with same CATH topology
3ELVA 1MR1A 2QV7A 3GMJA 1DMZA 2AFFA 3UOTA 1FHQA 5JEJA 5JELA 1U7FB 4KU0D 3VZCA 1YGSA 3UNMA 4EJQA 1J4LA 1J4PA 4WERA 1MK2A 2A0TA 2W3OA 5JEMA 4H87A 3MDBA 1KHXA 1U7VA 2QVLA 1MZKA 1G6GA 2KB3A 5DJOA 1J4OA 1FHRA 1K3JA 3S40A 3DSHA 2CSWA 3UN0A 5JEKA 2JQJA 4WRRA 1J2FA 1YJMA 2JKDA 1QWTA 3UNNA 2KFUA 1K2MA 2XXSA 3I6UA 2JPEA 4L02A 3HUEA 3VZBA 3HUFA 3PO8A 1LGPA 5JEOA 2XT9B 4A4YA 1J4QA 2P1RA 2FF4A 3HX1A 1K3NA 1LGQA 2BONA 2BRFA 2JQLA 4QCJA 4JONA 1UJXA 3I0NA 2G1LA 5A8IA 4V24A 1J4KA 3UMZA 5E50A 1G3GA 3POAA 3T5PA 2JGRA 4A0EA 1MJSA 1R21A 1WLNA 3VA4A 1K3QA 1K2NA 1DD1A 5JERA 3ELSA 3UV0A 5C4VA 1ZOQA 2LC1A 4JIWD 5BVIA 4EGXA 1WV3A 2EH0A 1GXCA 2PIEA 1UHTA 3A77A 2FEZA 2JQIA 1U7VB 4R9PA 3I0MA 3OUNA 3VA1A 4D9VA 1QU5A 2KKLA 3VZDA 1YJ5C 1DEVA 3DITA 1G88A 3I6WA 2KB4A 4JIVD 1U7FA 1KHUA 3FM8A 3GQSA 4G2SA 3VPYA 3KT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR1 A;  3GMJ A;  3A77 A;  5JEK A;  1U7V B;  4R9P A;  5JEJ A;  5JEL A;  1J2F A;  1QWT A;  1U7F B;  1DEV A;  1YGS A;  3DIT A;  1G88 A;  1MJS A;  1U7F A;  1MK2 A;  5JEM A;  1KHX A;  1KHU A;  1DD1 A;  1U7V A;  5JER A;  5C4V A;  1ZOQ A;  5JEO A;  5BVI A;  3DSH A; 
#chains in the Genus database with same CATH topology
 3ELV A;  5EJF A;  1MR1 A;  2QV7 A;  4HAO A;  3GMJ A;  1DMZ A;  2AFF A;  2Q5F A;  3UOT A;  1FHQ A;  5JEJ A;  5DHU A;  5JEL A;  1U7F B;  5EJG A;  4KU0 D;  3VZC A;  5EJH A;  1YGS A;  3UNM A;  4EJQ A;  1J4L A;  3V8R A;  1J4P A;  4WER A;  3V8Q A;  1MK2 A;  2A0T A;  2W3O A;  3AFO A;  4H87 A;  1KHX A;  2QVL A;  1U7V A;  3MDB A;  1MZK A;  1G6G A;  2KB3 A;  5DJO A;  1J4O A;  1FHR A;  1K3J A;  3S40 A;  5DHP A;  3DSH A;  2CSW A;  4DY6 A;  2I2F A;  2I29 A;  3UN0 A;  5JEK A;  2JQJ A;  4WRR A;  5DHS A;  1J2F A;  1YJM A;  2JKD A;  1QWT A;  3UNN A;  2KFU A;  1K2M A;  1Z0U A;  1Y3I A;  2XXS A;  3I6U A;  2JPE A;  2I2C A;  4L02 A;  3HUE A;  1Z0Z A;  3VZB A;  1SUW A;  3HUF A;  3PO8 A;  1LGP A;  5JEO A;  3V8M A;  2XT9 B;  4A4Y A;  1Z0S A;  1J4Q A;  2P1R A;  2FF4 A;  2I1W A;  5DHR A;  3HX1 A;  1K3N A;  1LGQ A;  2BON A;  2BRF A;  2JQL A;  4QCJ A;  4JON A;  3V8N A;  1UJX A;  3I0N A;  2G1L A;  3V80 A;  5EJI A;  5A8I A;  4V24 A;  3V8P A;  1J4K A;  3UMZ A;  5E50 A;  1G3G A;  3POA A;  3T5P A;  2JGR A;  4A0E A;  1MJS A;  1R21 A;  1WLN A;  3VA4 A;  1K3Q A;  1K2N A;  1DD1 A;  5JER A;  5DHT A;  3ELS A;  1YT5 A;  3UV0 A;  1ZOQ A;  5C4V A;  2LC1 A;  1U0T A;  1Y3H A;  4JIW D;  5BVI A;  4EGX A;  2I2B A;  1WV3 A;  2EH0 A;  3V7W A;  2AN1 A;  1GXC A;  2PIE A;  1UHT A;  3A77 A;  2FEZ A;  2I2A A;  2JQI A;  1U7V B;  4R9P A;  3I0M A;  3OUN A;  3VA1 A;  4D9V A;  1QU5 A;  2KKL A;  3VZD A;  1YJ5 C;  1DEV A;  3DIT A;  1G88 A;  3I6W A;  2KB4 A;  4JIV D;  1U7F A;  5DHQ A;  1U0R A;  3V7Y A;  3V7U A;  1KHU A;  3PFN A;  2I2D A;  3FM8 A;  5JEM A;  3GQS A;  4G2S A;  3VPY A;  3KT9 A; 
#chains in the Genus database with same CATH homology
 3ELV A;  1MR1 A;  2QV7 A;  3GMJ A;  1DMZ A;  2AFF A;  3UOT A;  1FHQ A;  5JEJ A;  5JEL A;  1U7F B;  4KU0 D;  3VZC A;  1YGS A;  3UNM A;  4EJQ A;  1J4L A;  1J4P A;  4WER A;  1MK2 A;  2A0T A;  2W3O A;  5JEM A;  4H87 A;  3MDB A;  1KHX A;  1U7V A;  2QVL A;  1MZK A;  1G6G A;  2KB3 A;  5DJO A;  1J4O A;  1FHR A;  1K3J A;  3S40 A;  3DSH A;  2CSW A;  3UN0 A;  5JEK A;  2JQJ A;  4WRR A;  1J2F A;  1YJM A;  2JKD A;  1QWT A;  3UNN A;  2KFU A;  1K2M A;  2XXS A;  3I6U A;  2JPE A;  4L02 A;  3HUE A;  3VZB A;  3HUF A;  3PO8 A;  1LGP A;  5JEO A;  2XT9 B;  4A4Y A;  1J4Q A;  2P1R A;  2FF4 A;  3HX1 A;  1K3N A;  1LGQ A;  2BON A;  2BRF A;  2JQL A;  4QCJ A;  4JON A;  1UJX A;  3I0N A;  2G1L A;  5A8I A;  4V24 A;  1J4K A;  3UMZ A;  5E50 A;  1G3G A;  3POA A;  3T5P A;  2JGR A;  4A0E A;  1MJS A;  1R21 A;  1WLN A;  3VA4 A;  1K3Q A;  1K2N A;  1DD1 A;  5JER A;  3ELS A;  3UV0 A;  5C4V A;  1ZOQ A;  2LC1 A;  4JIW D;  5BVI A;  4EGX A;  1WV3 A;  2EH0 A;  1GXC A;  2PIE A;  1UHT A;  3A77 A;  2FEZ A;  2JQI A;  1U7V B;  4R9P A;  3I0M A;  3OUN A;  3VA1 A;  4D9V A;  1QU5 A;  2KKL A;  3VZD A;  1YJ5 C;  1DEV A;  3DIT A;  1G88 A;  3I6W A;  2KB4 A;  4JIV D;  1U7F A;  1KHU A;  3FM8 A;  3GQS A;  4G2S A;  3VPY A;  3KT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...