3I0NA

Structure of the s. pombe nbs1 fha/brct-repeat domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
320
structure length
296
Chain Sequence
MWIIEAEGDILGSRILFPGTYIVGRNVSDDSSHIQVISSISRHARFTILTPSEDYFTGGPCEFEVDLDTFGTVNEVVGQNGDSYEDLIQLGCPFTINAYWRSMCIQFDNPEMLSQWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLTVIIDDSYLQYLSTVESVIEDASLMPDALECFNIINNDQFPSSPEDCINSLEGFSCAMLNTSSESHHLLELLGLRISTFMSLGDIDELISTDFVVLNNAVYDSEISFPEGIFCLTIEQLWIIIERNSRELISEIERLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and telomere maintenance protein nbs1
publication title A supramodular FHA/BRCT-repeat architecture mediates Nbs1 adaptor function in response to DNA damage
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 71
structure length 296
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i0nA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3i0nA02
3.40.50.11080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i0nA03
4IGKA 2FF4A 2JQLA 3QVGA 3II6X 4XPZA 1J4KA 3GQSA 1Y98A 4H87A 3PXEA 4Y18A 3FA2A 4BMDA 4EJQA 1J4PA 3I0MA 4EGXA 3ELVA 3QVGB 4BU1A 2FEZA 5A8IA 1K3QA 1WF6A 3U3ZA 3EF1A 2VXCA 3VPYA 2JQJA 1T2UA 3EF0A 3AL3A 1OQAA 5ECGC 1G3GA 3PXAA 3UEOA 4BMCA 5DJOA 2COKA 1J4QA 2BRFA 3PC8C 2KFUA 3FM8A 3K16A 3PXDA 2DUNA 1FHRA 1IN1A 2PIEA 3UNMA 3UMZA 2R1ZA 4N40A 3SZMA 3HUEA 2KB3A 3HUFA 2COUA 1J4LA 4ID3A 1T2VA 2AFFA 2AZMA 2EBUA 3SQDA 2A0TA 2WT8A 3PC6A 2ETXA 1YJMA 1UJXA 3K15A 2K6GA 2K7FA 1LGQA 1QU5A 4U4AA 3UENA 2KKLA 2NTEA 1T15A 3OLCX 3COJA 1UHTA 2E2WA 3ELSA 3PD7A 1R21A 3PC8A 3T7JA 2CSWA 3L46A 4D9VA 3PXBA 2XT9B 3UV0A 3PA6A 4JLUA 1K3JA 4Y2GA 3POAA 2COEA 3UN0A 2JQIA 1J4OA 3JVEA 1WV3A 3K0KA 3MDBA 2M2IA 3L41A 3AL2A 3KT9A 3K05A 3I0NA 2JPEA 3SHVA 3I6UA 2XNHA 2LE0A 3T7KA 4XQ0A 2EBWA 1MZKA 4OFBA 1L0BA 1L7BA 4IFIA 1K2NA 3UOTA 1Z56C 2VXBA 2HTFA 1IMOA 1K2MA 3SHTA 2JKDA 3HX1A 1GXCA 1LGPA 2L42A 4G2SA 3L40A 1WLNA 3PC7A 3T7IA 3PO8A 1GZHB 2D8MA 2G1LA 2JW5A 1G6GA 1DMZA 1KZYC 1FHQA 3KTFA 3UNNA 2INGX 4BU0A 1T29A 4A0EA 2LC1A 1N5OX 2ADOA 3PXCX 4QCJA 3VA1A 1YJ5C 2XNKA 4JONA 3T1NA 1K3NA 3OUNA 5E50A 1JNXX 2EP8A 2EH0A 3K0HA 1CDZA 3I6WA 2KB4A 2W3OA 3VA4A
chains in the Genus database with same CATH superfamily
2DBVO 3DMPA 5MGBA 1UBTS 2J8ZA 2KBFA 3ZJ4A 5JO0A 2D5LA 3ZWXA 5A4DA 2C7QA 4OJQA 4QPPA 4OHYA 4OGFA 3QX9A 1SHZA 1V16A 1VPDA 2YQ5A 4I08A 2WSMA 4ZODA 1P75A 2AFHA 4LE2A 3EEBA 5CCXA 1GTG1 1EFHA 2PZKA 3NBYC 1NNI1 4JGIA 1NNUA 4LJLA 5C7LO 1QGOA 3GFPA 1I36A 2DLDA 3EF1A 1IZYA 1T8WA 1J5PA 3DMRA 4LVOA 2PQ6A 4ZKDA 5EY5B 4IJWA 1Q7TA 2K5UA 4AZ3A 1FXWA 4R8MA 3K9QO 4JHXA 5A1TA 1CR1A 3AOEA 5CLHA 2ZB8A 3GFQA 4Q1AA 4JDPA 1DX6A 2NVBA 5A7GA 5K0GA 1P7WA 3ILYA 4UJ5A 2KFUA 3HHPA 4QHTA 2CFRA 3UXMA 2VHUA 4DDVA 1A9RA 1LC3A 1S1MA 3AH8A 3C5EA 3GDOA 3M5DA 5CVVA 4ZU3A 3TINA 1HG0A 2XSZD 1Z8HA 3FYSA 3HB4X 3N7UA 5CT5A 4BC0A 1DL5A 1M83A 3JQGA 3WGYA 2BEJA 4MQLA 3W3AA 4MV7A 4N40A 5IT9A 4JJGA 5SZJA 2X0RA 3NZEA 4M9CA 1Q95A 2A84A 3ZIAD 5GMOA 5KQSA 1FIUA 1JJIA 1ZN8A 1D2EA 3UKJA 2ZE7A 1GL9B 3IE0A 4IDBA 1NVGA 2B4QA 2Y1EA 1KIFA 2WAMA 3KXKA 3EPKA 4DL9A 2Q21A 4Q9LA 2YVQA 4KQCA 3SBDA 3TLKA 3WL5A 1HZZA 1FNCA 1JR3E 1CJCA 1UFKA 1NI5A 2PIAA 3NTRA 4A8JB 5HRAA 5JAUA 1ZN7A 1F8UA 1XJ5A 3IDFA 1M72A 4P4NA 1FDVA 3AC0A 3GJXC 1A04A 3G7UA 4GVLA 3OBBA 2OGUA 4JXKA 4EEXA 2JEZA 5ALNA 1E9EA 3L1HA 4K1LA 4DEVA 1YFLA 3PQ8A 3PUVA 2IUUA 4O8CA 2FXVA 5CB6A 1JR4A 1L4LA 2IIPA 3AP3A 3DAHA 3IKMB 3WQRA 3WLMA 1M2FA 3VJRA 2B1RA 3G5LA 1L7OA 1MAAA 2FMFA 3HCCA 4D02A 4URYR 1JDVA 2LNDA 4J76A 4D98A 2OR3A 3TLJA 2OXCA 3IJEB 1U9IC 4UHKA 4A6EA 4I55A 3IQDB 5G41A 1KAMA 1SUCA 3I6UA 1Y6GA 2O2XA 3U4QB 1NWHA 2QE6A 2NXEA 5DU2A 5EJFA 4Y1FA 4LTMA 2ZBEA 3EUEA 1RIIA 3Q1LA 1NQVA 3C3WA 3AI3A 1ZHHA 1OFUX 3E2PA 3IDOA 4MV3A 3L06A 5EIAA 5K8LA 1GG8A 1J8QA 2ZSFA 2ZZNA 1MAHA 2Z1MA 2GTIA 2W42A 1GXCA 1IHUA 1YZUA 3GAAA 4F84A 4BO2A 3RIGA 2QLMA 4NCAA 1TU3A 3BWVA 2PWYA 1AD2A 3KSDO 5EMJA 2JGLA 2UYYA 1NA5A 2C8VA 4U5QA 1JIXA 1HQKA 4LDQA 1W6RA 4G2TA 1HNXB 1AKMA 1U0TA 3N2KA 5B36A 3W1EA 3UJ9A 4P3OA 2A30A 1Z38A 1I01A 1YJ5C 2WP8J 4HEA1 1XUOA 2ZUWA 1YONA 3HMKA 3CLRC 2CEKA 3B1JA 2H1CA 3IDZA 1JTEA 1K6EA 1TU0A 4Z8YA 1Z2AA 3ROQA 1J0XO 3LDUA 5IK2D 3DBRA 1MUUA 5EPOA 5DP2A 1UMKA 3LY5A 4OCZA 4L16A 4Z9AA 3TG8A 2AN5A 2IDJA 4Q4AB 4MP8A 4MRNA 3IURA 5KNCH 2OV4A 1KDZA 3RAFC 2VAXA 2IYYA 1XZ8A 2R4UA 3RYTC 4JP8A 4MA0A 2P2LA 4IJKA 1NW4A 5M2QA 4EMUA 2ZZKA 3W5IA 4GKJB 4CDRA 2ORED 1GPBA 1PX0A 2ZJFA 2ZRBA 3LTEA 4TRRA 1J0CA 3DE4X 2O7RA 3QZUA 2AN1A 1ODCA 5TT0A 1K2WA 1R18A 3KOZA 1G3GA 4HEA6 5DXAA 3ZQKA 2DPYA 1IIBA 1PR3A 3GJ8A 3DOJA 3LD9A 3AHCA 3Q2KA 2AWOA 5GP1A 5LBTA 5CG2A 2PMEA 3GOQA 3WXMA 2II6A 2BJVA 4JJ4A 5JEMA 1ARZA 1DUVG 3ENWA 4JC4A 4NPHA 3UMCA 4CQLB 2PEYA 3C3XA 3AR2A 4QSHA 1T13A 1ZOSA 2JAQA 3MINA 3VYWA 1VI5A 4JUBA 1ODTC 3UT5B 1ZI9A 3U26A 3JAMA 5KAMA 1GLGA 2PVCA 2VHCA 1EJ6A 1FFAA 2FFJA 1A2BA 1AXRA 4L9SA 3RJ5A 8ABPA 3KJNA 1TGYA 3UCEA 4XFKA 3WWPA 3I4CA 5AR1A 1RW4A 5K6RA 4PZPA 1POXA 1NFFA 2XDQA 3BJEA 4Y1RB 1PFGA 3NDIA 2CFCA 4YWJA 1WMFA 5LCXA 2CZGA 4XCXA 3AUXA 1L1FA 1VLQA 1E9CA 3OOHA 3OX3A 1OILA 5EGNA 5JNVA 4B83A 1TX4B 1U9ZA 5IHPA 4V2IA 4MLZA 1EUDB 1K1EA 3L5KA 1WDWB 2XUJA 1BEZA 2B99A 3F2VA 4P3PA 4CTJA 1LNSA 1C8VB 1AN0A 4QBFA 3A6EA 3COJA 3RUCA 2RGGA 2WSSD 3OG9A 4PYIA 3SM3A 1QHIA 2HLHA 1SU8A 3T4XA 3VDMA 4BE7B 4IG9A 2DP4E 3SQXA 4NLLA 1XDGA 2H1WA 3F6PA 3R6TA 4DC0A 5K8CA 4H7JA 1V43A 3S68A 2WPDA 2M6LA 1F0PA 2NMVA 1K5HA 2IKSA 3KLBA 3VPSA 3W78A 1HE1C 2R1TA 1ONBA 3MM4A 1EK0A 1BVUA 2FUKA 3VR5A 4KIFA 5J4VA 4Q1DA 2HO5A 5EZ5A 4HB4A 5CW1A 3O75A 1MGOA 1TM7E 3G8DA 3OKCA 4DKXA 3I6BA 1P3DA 2IEYA 4XJTA 5COBA 1KMNA 4G25A 4KBYA 4IFIA 4NZYA 3TR0A 2ZVPX 3ZI0A 3X1WA 2XUZA 8ATCA 3JYQA 1RXCA 4PNPA 2WIGA 3E15A 5KNBD 3OZ7A 1T5LA 2O8VA 2D4AA 2WDPA 1XXHB 5JAMA 4ZOAA 1R88A 4MUIA 4B7XA 1BQEA 2D8AA 2QMQA 3DD5A 3MLBA 3N07A 4IIUA 2ADFA 1H0KA 5CH3A 1FSFA 2WF8A 2YIDA 5FXMA 1TPYA 1MVLA 3ILVA 4BRZA 3A3NA 1TOAA 3PUHA 3KETA 1GZ4A 4NCXA 3UK7A 3PJFA 4MMXB 1U0FA 1YRHA 3H8JA 3TIFA 3DHWC 1VE9A 2V98A 4Y9TA 4W99A 2QVLA 2VOJA 4HLNA 4R0NA 5EZYB 5M29A 4W5JA 3MHTA 3FNIA 1R0BA 1RU3A 3W5AA 1NYRA 2YZGA 2ANBA 5JU6A 4HAYA 1H8HD 4TQAA 1O9HA 3R5TA 4I36A 3DA8A 4GE3A 2JAXA 2WQ6A 2ZJ0A 3FUUA 1DV2A 1ZLYA 4C07A 2BHNA 5KREA 4LC9A 5GZ1A 3NIBA 3R8CA 4BMVA 2HV9A 4H3KB 4BNLA 1N2CA 4CKBB 1EDZA 4HDAA 5AK5A 4A8JC 2O8DB 5BUSA 4LY9A 4QYWA 4JBXA 4NE9A 1H2HA 1A9XB 3NEJA 1NQUA 1ETHA 4NVRA 4ERNA 3C6XA 3VSDA 2ZI6A 2D5IA 2HX1A 2PG3A 3ESXA 4MA4A 1ZGBA 1QMGA 3CA8A 4KK4A 2BN4A 5FPYA 4V0MA 3UAZA 2YY5A 2G4CA 2D74A 3CPEA 4BVGA 1L2TA 1O5OA 3HWRA 2IZ0A 3OQMA 1KZHA 5KTMA 2C5AA 5AXBA 5EZYF 4TMKA 1RWQA 1BROA 4DLPA 3SQNA 1KEKA 4QJIA 4PCLA 4LZAA 1YB7A 4Q7JB 3WZLA 2JLRA 2ZW9A 2EKZA 2P4EA 2YVUA 2B7BA 4FYHA 5EWMA 3A2NA 4G37A 5FFFA 4B4WA 4RTSA 1XAJA 1GKLA 1FFWA 2BFBA 5DASA 1WBBA 2WF7A 4YUVA 3GYGA 2XMCA 5K6TA 2PFSA 2P9HA 3MTDA 1L4GA 4PGHA 1JFTA 5L51A 3OQOA 3OCYA 2X8BA 4ZO6A 1JZQA 5HZGA 1DNPA 1Q0UA 4KK3A 3WBJA 4D4HA 5BR7A 4FNMA 4JBNA 3EQ9A 1HUQA 4NE2A 3SU8A 3PA8A 4CKXA 3TLBA 4AYTA 3DF9A 1G5PA 1KH3A 3QWHA 3IOEA 2UVDA 3I8OA 2WA2A 5IP5A 4HKTA 4HS4A 1R6UA 5TJHA 1ID8A 2OFPA 3PCXA 5LA6F 4QODA 3W0LB 4KFUA 2I4MA 1CLEA 1AK2A 5CYGA 4KHPB 3P94A 2AEMA 4NRDA 5A3QA 2RGRA 1SBQA 3W7AA 2RH5A 3DOIA 3KJHA 2A6PA 2K6GA 1FMJA 1F2UB 1WHTA 4LDNA 1OZHA 1CQJB 1VSTA 2PRSA 2WG2A 4E94A 1SIBE 1N92A 2G4LA 1O94C 1U3DA 1YU9A 2B37A 2ZSJA 3PVZA 3OU2A 4HXFB 4X6YA 5AOVA 1KBZA 2CDNA 2EL9A 3K1AA 1J8VA 2W4MA 4DY6A 1O77A 3QJ5A 4J0EA 4QTXA 4TSFA 5BYBA 1U0BB 2H4HA 4G0QA 1SA0A 1NRWA 4J0DA 2JIDA 4F2PA 3RVMA 3WGOA 4TMVA 4IDAA 4QG7A 1D3AA 1SXJB 4H1HA 4BKRA 2AK3A 2P5TB 2WE8A 3NRJA 3BL5A 2HK6A 3ZLBA 4U2KA 5L45A 5HKAA 4CGZA 2ZBFA 4N5NA 2FW6A 3IODA 1S01A 3PYLA 4X44A 3M6IA 4D46A 2GVZC 2ZDGA 3OI7A 3KAKA 621PA 2LPMA 2WU1A 4BZXA 1Z56C 2D00A 4MHSA 2QYOA 4F06A 3W4KA 4CLOA 4QAQA 1Y5LA 3AG5A 2QQEA 5JO9A 2AFRA 5A5DA 3HQ4O 3VBCA 4FW8A 1N1GA 2CXNA 2CNWA 3GQVA 3GLHA 2HEIA 2WJHA 2I87A 3EEQA 4OFWA 3ZWKA 4EOGA 5JVDA 2EW8A 1MOSA 2G25A 5DSZA 2IWHA 3VTAA 3RDPA 5ALIA 5G4KA 2O5VA 1HR0B 4FWBA 2XIQA 5HF9A 3WL6A 1W6UA 4RC9A 4NZOA 4BNTA 4AWAA 1G2IA 1Z2OX 4EUSA 3UXHA 2H2AA 2H29A 4U02A 1K27A 2PJZA 5K0TA 1BE6A 1TF7A 1UBMS 3IUJA 4Q15A 3KX2A 3LDFA 1A4RA 2VQEB 1FJXA 2V7TA 2YJ4A 3ESRA 5K03A 4LEIA 3H04A 4F3NA 5IXSA 5LXTA 2AF3C 2B1JA 5L4LA 2RK4A 4YEDA 4EA7A 1GA4A 2MDTA 5DHQA 1WXQA 1S2OA 3DNPA 3KR1A 3MT8A 1QQ5A 2AKAB 4J1QA 2Q5FA 3L6UA 3R5SA 3VI3B 1ZLXA 2PS9A 5HM6A 2PPVA 2I65A 2WIAA 2WU0A 3N5CA 1Z0AA 4R40A 3AEZA 5DTJA 1MQ9A 1ZNZA 4IGFA 5REQA 1UIMA 1PJAA 4BGVA 2W6ID 5JH7F 1LJLA 2PX8A 3HBNA 3WIDA 4IXDA 4NU0A 4C6SA 1JXQA 5FV4A 1N9KA 3DXXA 3NAMA 3SR4A 3DEIA 4JNKA 1CP2A 5K8JB 4DCJA 3WK8A 2KBEA 3WYNA 2VHEA 4R05A 5CAEA 3BWXA 5E8JA 1XTUA 1M10A 2JFPA 3OF3A 4M3NA 3SWWA 3OPMA 5DNAA 5IAEA 1C80A 3D2LA 5E1OA 4C4XA 4F2GA 5TX7A 1PR2A 5I7RA 1I1NA 4EFKA 2QY6A 4G84A 2MTBA 3B1XA 4GICA 4RHFA 4YGXB 3OIGA 1G7TA 4GAEA 4CLHA 4ZOLF 1DXOA 4MRPA 4HQ0A 2VP5A 1SU6A 2W8ZA 3D1JA 2OO5C 3PWZA 2KB3A 4F21A 4KW7A 2HLPA 1S7GA 1G291 2W6JA 4E5DA 1LF5A 1N0VC 4FZRA 5EPEA 3VAAA 1MGPA 3RC3A 1BWQA 2IYOA 1LPOA 3J7TA 3D5EA 4FI3F 3DMYA 4O59O 3SQDA 1GQSA 2O8BB 1T6XA 1JN0A 1H5NA 2NYAA 2CMDA 3MJHA 2PGNA 5I45A 1U0JA 5KKAA 4DR7B 1LNQA 4IAOA 1CZUA 1MRZA 1XI2A 4R6XA 3CR8A 3DMNA 1ID1A 2E3JA 1KERA 3B3AA 3LAWA 5D84A 1I4WA 1JUDA 3QHAA 4E22A 4R9SA 2XAAA 2XOKA 2IYWA 5AVTA 4BGIA 1B4DA 3RFVA 1OWPA 5A06A 2I7DA 3NHSA 2E4YA 1Y4UA 2JHAA 3AR5A 3K0FB 4GW3A 4LYFA 5F2EA 1M2OA 5EYPB 3SS9X 4ZREA 3ZQUA 2QVYX 5JECA 1E98A 4PF1A 5G0WA 2ID9A 4MCJA 1K4MA 4OXRA 3A4NA 3CVYA 4FFWA 3QPBA 5LD2B 3DPIA 5JS2A 1ULBA 2WIFA 2IPXA 1N5RA 1XZHA 4EELA 2FPIA 4UVHA 4NZ9A 3VO9A 4EUKA 4CV0A 3AKDA 4CKEA 3Q9UA 3OESA 4D57A 2PMKA 2AFHE 3RVBA 3B6MA 4CU5A 4JVLA 4TMZA 1X80A 3C41J 4GL2A 2P3OA 3GWZA 4HNAA 3HYCA 2IPMA 4R8KA 2P4SA 1OBCA 1X3SA 4US1R 3K31A 5DCLA 1XAIA 5A0TA 1BCSA 5BSFA 1A95A 1H1LA 1SG0A 2BR5A 4H2DA 2H7YA 1B0UA 3WI7A 5T4EA 4CV3A 3UOWA 1K5PA 4Z2AA 5KKCA 1PQWA 4ARCA 5MHTA 1NUPA 3LUDA 4FWTA 4YQFA 3WE7A 1LLFA 3RB8A 5KSYA 4MCAA 2C00A 3DT9A 3EZ9A 1KQOA 3BHNA 4I5EA 3C6MA 4N3AA 5FP0A 2HN9A 1ENOA 1MCZA 3ZG6A 3CY6A 4ENTA 4RTLA 5C1PA 2FPUA 2AZ4A 4MS3B 4MDHA 3B5IA 1T9KA 2IV3A 1M2VA 4F2WA 3VJMA 4OP2A 4ECAA 1USVA 3E6AA 3H5VA 3P52A 1CB7A 1WR8A 2FPKA 2XQVA 3S7ZA 4ARIA 2R9VA 3CHYA 3KJZA 2IIVA 3M82A 4NZZA 4UOZA 2GZDA 1EWVA 1VI6A 1TCCA 1RLMA 1XKXA 4IEEA 3LLUA 3GLQA 1NBEA 2BDUA 4P86A 2AZDA 1VMEA 2GGSA 5FBWB 4MR8B 2SCUA 4N3BA 4B3HA 4C08A 4DNOA 4EPXA 3B7PA 4XSHA 4ZQIA 3R3WA 1QC5B 2O1EA 3F2IA 4KN5A 1LX6A 3EFHA 5G0TA 3UGKA 3V55A 4F9FA 4GWGA 1N1MA 3LYLA 1O6BA 4BVHA 4D45A 3ILHA 4UJ3A 2PDAA 4H6WA 3PQ2A 1FTYA 5M3BA 5ECGC 4F11A 1SXJC 3JQ6A 4G81A 4PLTA 4DIKA 4XFJA 2IBSA 5L8VA 1NX9A 2XVYA 1XNGA 3KE8A 1Z25A 4X0EA 2YWDA 3U3MA 3EGWA 1QH9A 4EI7A 3A1DA 3CNOA 4TTIA 3PI7A 1QPBA 5HRUA 4YVFA 2G3YA 3DE3X 1B6GA 3ANNA 2LCIA 3KZ1E 3L0PA 2CMGA 4L78A 2YIVX 3KZXA 3ZZTA 3VBEA 1JSXA 3KR2A 3KAJA 4JBYA 1I5RA 1KGDA 2PXCA 3P0HA 4PM4A 3QKRA 3HZHA 4J3JA 5BWOA 2ZRDA 3LRPA 2GXAA 4CMEA 1Y9ZA 3CH5A 4O2AF 5JPIA 4JI2B 3ZEAA 4CODB 3PQEA 1YK0A 4TYMA 1KBQA 2DLCX 3T8YA 4N6GA 3PCRB 2GSWA 4QUJA 4U8GA 4ZTZB 3JALA 3KAPA 1YHYA 4EZEA 1KXZA 2IZ7A 3KUUA 4GBGA 3D0RA 1T6YA 3DQQA 4ARUA 2FPRA 3FYCA 4AMBA 4BV8A 4PO9A 4TMYA 3RFTA 4DUGA 1EWQA 1N77A 2JLWA 4FGLA 1B1AA 2XT0A 5FTMA 4TS4A 1GG5A 2YMQA 2GCIA 3CEPB 3ZHVA 4RLFA 5SZIA 3GBSA 4YMTA 5LQCA 1G5IA 4KHZA 3W8NA 4OMFG 2WYUA 3RU2A 1OTHA 3T38A 5KTPA 3REOA 1XD8A 3UUEA 5J63A 3GPCA 4BS9A 1A8IA 1FDRA 1QZTA 1GAEO 3QKWA 4UAJA 1PFUA 1QFXA 1L5LA 4C7OA 3C16C 3NWPA 2IOHA 2P9YA 3SJCA 2UYCA 3MTBA 2LRHA 2Z5FA 1H2AS 1EEHA 5K7SA 2A58A 4UC0A 5CA1A 4UUAA 3M83A 5DXJA 3M9LA 2IIQA 3O26A 5TEVA 2ECPA 4AP9A 3EQ8A 4MW9A 4D3ZA 1U4NA 2Y68A 3AL0C 1R6TA 3CGWA 4ZCLA 2YJ3A 5LB4A 5DTIA 3L5OA 5E4FA 1RDFA 2LGJA 2RJNA 1W2WB 4WCFA 5FLKA 1T9HA 1K86A 1Q0HA 3K2IA 3KDPA 2C3MA 4NABA 1EFVA 1XA4A 2A33A 4UHCA 4XIYA 1OFGA 3T3GA 1EE9A 3GUHA 3HXTA 2BM1A 1TJNA 3HBAA 3CNEA 4LRYA 1Z4KA 3IVGA 4AG3A 4FU0A 2H0RA 3K0CA 2I76A 4CU2A 4Y9UA 1E1CB 2VT2A 1B8OA 2ADOA 4GM4A 3HWX1 1OB2A 4GPIB 2QM8A 4DR2B 1D4AA 4AF7A 1L7RA 1XWIA 4MVJA 5KSOA 3T9FA 1M0SA 3A1FA 2GLTA 1VPWA 4CKWA 4KRYA 2I2WA 2B98A 3MMPA 5DM4A 1W87A 3HWWA 1VA5A 3WFJA 3G59A 4EJSB 4HJRA 1RZVA 1RPTA 3T1HB 1SVLA 3QKSB 4O5OA 1Z6XA 4X20B 4EW1A 5A5VA 2XCSB 3L7BA 1V1MA 4NMMA 5KVAA 2GH1A 2VSQA 1F9AA 2WD8A 4FXOA 1R50A 1H94A 3HLKA 4NIMA 3T0IA 1SVWA 2Z1DA 2GDJA 5BRAA 4LBZA 3UW1A 4HDRA 3DDOA 4Q9AA 4QUHA 2QSJA 4E4RA 2NSLA 3N2LA 3CRVA 3UPUA 1LJ8A 1AKEA 2VXCA 4OXNA 4BGEA 4PBTA 1HBJA 1S96A 2H08A 2W2MA 4MVJH 4QOEA 1PTJC 1WB5A 4DUPA 5CCBA 3GX1A 1NDUA 5JZ9A 3NHYA 4OFXA 2RGDA 2YH2A 4FCVA 3EULA 4RHTA 3HMQA 1U9IA 2GD2A 4FLMA 4O4HF 1M34A 3E03A 5EUBA 4UQPA 3C6YA 5LD2C 2R7NA 5CVJA 3A9CA 4II3A 3SHWA 1TAHA 1U1IA 3EVZA 1VOTA 1CS0B 4XDGA 2AVNA 2I91A 1QK5A 1G8AA 1E3QA 4GMKA 4RUKA 1ZMTA 3NDBB 2Z2ZA 1ZNWA 3DEJA 2R65A 3KU4A 5HFAA 4ESEA 1FFHA 3ADCA 2WI8A 2O50A 3F4LA 3FWHA 3UMFA 3SOPA 3UATA 1RC8A 1IC6A 4ND2A 1JPJA 1UBRS 4ZAGA 2BSAA 3U3KA 3X1MA 1NTRA 1QYDA 3CIFA 2J7KA 4FKBA 3ZCUA 4CMGA 4XX0A 4Y2VA 4BMSA 1CY8A 3QE0A 2HU2A 3F5QA 4YACA 2GZRA 4DLNA 4B17A 1W0CA 3PHHA 2A35A 2GS9A 2N75A 1YJ5A 1PZGA 1UJBA 1BIFA 4YRQA 4HD8A 2E5FA 4LJ6A 4MP3A 2NU7B 3EPJA 2ZJ6A 4RH3A 1AKVA 4MHTA 1F3LA 2DPMA 2PX2A 1G5QA 1Z6PA 2GO7A 3D6UA 3LOPA 2CLIB 2YV2A 1BNCA 4FQ8A 2V97A 4ZN6A 1N2CE 5EUCA 2VEDA 1RQNA 2YXNA 4DDUA 5KVCA 2PAAA 1QHFA 4UHBA 4AFNA 4DM4A 2O2EA 2ZB4A 3ORQA 5FJIA 4KLAA 5EJ5A 3R3XA 1D4ZA 1QZZA 1KPGA 2IWRA 5KOHA 3NORA 3R7FA 1KEPA 2WU3A 1B23P 1N8NA 1PTKA 3IXQA 4RYLA 3TIIA 2ZFUA 3MUEA 2WA1A 4V0ME 4FHZA 1DKOA 1GUFA 4G4SO 1H1DA 3ISVA 2HDNB 4JITA 1NF8A 1PT5A 3KWJA 4I50F 1A2KC 2DFVA 2GYVA 2O0JA 1I14A 1E4OA 2YX1A 1ISJA 3GJRA 3H8WA 3PR1A 3A9TA 5HF6A 4RK1A 1C7FA 3BFPA 4TT8A 3CKKA 3F5DA 2N47A 5TDHA 1Z5WA 4GFDA 2X7JA 1X77A 3DH0A 2KHZA 3KOWA 1JFLA 1Y1SA 3RSLA 2PZBA 4S1PA 1B0PA 1TYZA 2AQHA 2BGNA 2F1OA 1HYBA 3LWDA 4HEHA 4QGGA 5BW8A 5ALKA 1ZVJA 1IZ0A 3NBUA 1A2QA 3SVTA 5F3WB 3H87A 2JAWA 3DZJA 3TFOA 5A9RA 2ZG6A 3SBXA 3ZVMA 1T3SA 3I28A 3ZQ6A 3QIAA 1YBMA 3FR8A 1XRRA 1KK2A 1VI2A 3D02A 1ORWA 4WFKA 5ESRA 3BBLA 1OWOA 3T7TA 3CFYA 4ZYZA 1NURA 2RCYA 3GH1A 5TPWB 2NV6A 4RJIA 3D4PA 1X7GA 5JBNA 3HXQA 2R7MA 3ZD9A 3KHTA 1WF6A 4BNWA 4LCBA 1WDLA 1D4OA 2OCYC 4XIFA 1NI3A 3RS7A 2ZYHA 1B3BA 1JAZA 2Q9BA 2W43A 1E0SA 3AHIA 2D2XA 3OJOA 3Q7TA 4HLDA 4HRYA 4QYMA 5FADA 1GPKA 3UEOA 4K0KB 1PR6A 3HL4A 5LZ2A 2D0PB 1IWOA 2VNJA 4R51A 1RBYA 1YQDA 3C7KA 1G9TA 3PHIA 4RQUA 4DIEA 4ZFNA 4H4CA 2I3GA 4QU9A 1VCMA 3L02A 2O5CA 1GNVA 4YUZA 5I9IA 1ABBA 1E6EA 1GU1A 1QOZA 3FW1A 1PL0A 4DSNA 3BFJA 3HUEA 4PGGA 4F1WA 1EUCB 3OD1A 3ZHRA 1IY8A 3DWEX 5JNRA 3IDQA 4QNMA 2PBFA 1BWRA 1UOEA 1VL5A 3ROPA 2RHWA 2VK1A 5B7QA 4I3GA 1YJQA 3MD0A 4YQZA 4EM6A 4Q02A 4F4CA 1ZGZA 1ZH6A 1A9PA 1BD4A 2G40A 2QTAA 3GLHE 1PJCA 4JK3A 5DOVA 2CF6A 2HFKA 2O7VA 2RD2A 3QM1A 3VOAA 2O2YA 2QA5A 4IF6A 4KAAA 5EEGA 1U2TA 3W6PA 4M9XA 2BGIA 3QVKA 3KT3A 2BEKA 4OYLA 4ALJA 2GSDA 4IH4A 3Q87B 2BCEA 4QWMA 3ZGZA 3EFEA 1JU4A 1R64A 1IUNA 1IXKA 4CM6A 1G55A 1SUEA 4F86A 3GEMA 5DKFA 3E4CA 4UVDA 1JYEA 1SOVA 4EY5A 2F62A 1Z2CA 2YBDA 3CR7A 2A86A 3MA0A 4MGHA 2OZLA 3SNKA 4EJSC 4LSGA 4A8JA 4N6NA 3WMFA 4D6PA 2I1WA 3F98A 3NVKI 4OQNA 4CM8B 2WEKA 1PUXA 1RM0A 1I2BA 2Q9CA 3FPBA 3LP5A 3FGNA 2YYYA 4CL3A 5AVQA 2WJZB 3LKZA 3UWMA 4X8MA 2R47A 1K5GA 3SQLA 1T1SA 3PRYA 3R7LA 3OOJA 3K72B 4WK4B 1AMOA 2CD9A 2CN1A 2CZQA 3ZVNA 4GMDA 4ZARA 1UK8A 4JR2A 4RX1A 3WK4A 5L3ZA 1V8OA 2C2WA 2NXWA 3I8SA 3Q11A 2VCYA 1JAHA 3BJRA 3D5QA 2G80A 5DHTA 1K7EB 1I3MA 1L4NA 1Y7PA 2B1QA 4GR9A 4JLJA 3WLPA 4YHHB 2G36A 4PFQA 4AS1A 3A8TA 1CV2A 5BNIA 2QL9A 2IA5A 2Y77A 1RMQA 3BK2A 1XZGA 4BFVA 1MVNA 1N8KA 2JI6A 5H5JA 4JI8B 2CNDA 2J5RA 2XEDA 5ALXA 4PYJA 1J5XA 3GT7A 2F8SA 2PGDA 2W6NA 2CHFA 4KMSA 1Q21A 1DTEA 1L7QA 2N9UA 4O33A 1E18A 1A5BB 1UBCA 2FEOA 3FZNA 3E8SA 4KO4S 4M0LA 1OIVA 3K9GA 3O8OB 3KT6A 3WNCA 4NAUA 1KFKB 5IJXA 1C0KA 1UJCA 3EY4A 3LCMA 2EAUA 4NCKA 1EG2A 2XUDA 1U3WA 4O5AA 3GARA 4Q34A 3VA4A 5DLDA 5TS2A 3K6KA 4BDSA 4UPDA 5DLYA 4UM5A 3TRFA 1YZQA 4QSMA 4AMVA 5D7NA 2JFFA 5JMPA 5JMWA 1DAKA 3ANYB 3X44A 1FJGB 2QXYA 4WOJA 2XUPA 4D3SA 2ZT7A 4RVOA 3FCOA 3ZCSA 4BJ5A 4CHTA 1PWZA 4R5MA 4BKQA 5BP7A 2DSTA 3C14C 1J99A 1A9OA 1EDOA 3KKKA 3QG5A 3SYLA 3P2KA 1MH9A 3AL3A 5KBYA 2IV2X 1ODKA 4B6SA 4R1PA 5J4KA 1OQAA 1J9GA 1ULAA 2I6UA 1S8AA 2FDXA 3L3BA 2L17A 1KEUA 3M3HA 4HAWA 3EGEA 3O9ZA 3M3DA 4B79A 4BMCA 4ENQA 5BQ3A 5BUZA 5LYJB 2GM4A 2MYPA 4Q4AA 4LFCB 2XZTA 3AV0B 1ZR4A 3B2QA 4PEVA 3OM8A 4Z7JA 5IYZB 5I4IA 3ZWCA 3RC1A 2H07A 3AYXB 1EGHA 5CITA 2Q5QA 4FX2A 5CFLA 9LDBA 2P1ZA 2ZQ5A 3LRTA 4HF7A 1VDZA 3SZMA 5EXSA 1SVMA 3K0AB 4NENB 3MCVA 2B1IA 4FYWA 3L18A 1XCBA 1Y34E 1KMHB 3EG9B 2H4ZA 4FDMA 3NGLA 5CB8A 2QRQA 2R68A 2VKQA 3ZNQA 1NFRA 1E59A 1R5BA 2A88A 3KBOA 2GBPA 4YXFA 3KM0A 1FFDA 3FPGA 4MOWA 3QV2A 1IATA 1ZW6A 2J7PD 1HKUA 4HAXA 3ZCVA 5AIAA 1ML4A 2E85A 2WVAA 3IQIX 4TXLA 1T0IA 3QBVA 3C7CB 3O84A 1KQNA 2C04A 1T4GA 2OFWA 2QL7A 4Q48A 1AHPA 1IXSB 3SX4A 2Y76A 1ECFA 4CCSA 4H1VA 3R3SA 1HTBA 1DWQA 3AESB 2ROQA 2VSYA 5F12A 2FI1A 4FJ1A 2C4VA 2PD4A 1IB6A 5I9BA 1M76A 1R2QA 3I37X 4MWDA 4TKUB 5DEOA 1GRNA 4JYCA 4DADA 2AD5A 1G3UA 4EHAA 4JQYA 4LRSB 4NMHA 1NXPA 3RC8A 3DB1A 2F43A 2Z30A 1NJ2A 2P41A 4GI1A 4UFPA 4BRSA 2D0OB 3RRXA 4HH4A 3Q8KA 2OYCA 1EUDA 1GL6A 3D3NA 1MU0A 4MR7B 1I3CA 4BEVA 4E1VA 1WMSA 4HYQA 4MUBA 4C04A 3W5DA 4RZSA 3DM5A 3KEOA 2J5XA 2YY6A 3TQCA 3BGWA 4V1CA 1OBOA 2NZVG 4N39A 3GZ4A 4K6OA 3FZGA 1FP2A 1TI7A 4MI9A 2C8JA 3Q5GA 3SXPA 3PS9A 4BO3A 3QUSA 1KTVA 5FTWA 1T0PA 1WXEA 1UCFA 3HXOA 1S2IA 3AVOA 4KGZA 4YPVA 1EIWA 2Y1DA 4O4JB 4H1UA 1L5HB 4C5CA 3LC1O 3OA0A 4DHEA 1DC7A 1PGPA 5AKEA 1T9GS 4V0KA 1E79D 2X22A 1XD2A 1YJBA 3EH1A 3G6KA 4L75A 4P4SB 3ZXXA 4CE6A 4MYTA 3WLHA 3VHLB 2OO5A 3UUWA 1WM1A 2FAXA 1CUDA 1HV8A 2ZI3A 1EX9A 3CKLA 4W5RA 4DAEA 1RHJA 1J9EA 3VJLA 4H4EA 4H7IA 2QT9A 3HPQA 1TVCA 4OTZA 5T8KA 3IE1A 1SY7A 1TDJA 3DHVA 4JA0A 4FYVA 4GWLA 1MAVA 2HNKA 4DLSA 1CY6A 2QTVB 5HMLA 4ZI3A 3DZCA 1SVUA 2L18A 1VPLA 2YS7A 3RADC 1S8FA 4KPFC 2H48A 4E5MA 3I9KA 4WRRA 4N47A 3CB2A 4B7CA 4D9HA 5BPFA 4A8HA 4UNIA 1DTWB 1YDHA 1X7HA 5JSZA 2NM0A 2CDRA 3GCGA 5EZYA 4I4NA 2NU9B 5BORA 1ZRHA 1I2MA 3P8ZA 3BEOA 3KS9A 5K3FB 2NTNA 4L95C 3OICA 1A97A 3PQDA 4O25A 1MX9A 1KRWA 4HPWA 1SBYA 1CUGA 1BDJA 4AT1A 3OA2A 2XGMA 4OVKA 2OLJA 3HUTA 4GI2A 1A69A 4CQMA 2BGGA 2O8DA 1FYWA 3AUAA 3STHA 3EMVA 3D8BA 4Z6KA 1SXIA 2FPOA 2G70A 3KSZO 1WX1A 1UWCA 1A9XA 1I10A 2VJOA 3SZOA 2NO4A 2JCGA 1P5RA 4KKVA 1QOPB 4RXTA 3HE3A 4NK5A 3ZLUA 2WTXA 5LA6A 4AJKA 2HPHA 2W2KB 2CK3A 3I1JA 5JSYA 3WHIA 5B7PA 3VUEA 4C4AA 2ZM6B 1SUBA 2ZYIA 4LF5B 3N0XA 4OUKX 4RH1A 2BBWA 2ZDHA 3PFKA 1T4MA 4GZLA 4MYHA 3UOGA 3TUZC 1C29B 4E5NA 1QFJA 3LBHA 5EQDA 2X6QA 3BRSA 3KTAB 3ZE8A 2JI7A 1YDEA 3BXEA 3D54D 3FLAA 3TXXA 4W1QA 4RTKA 1JBKA 4ZV9A 3VPXA 4L6CA 4D9JA 3N05A 4NCBA 1LDYA 2IYNA 2J31A 3SLRA 4CKYA 4F9GA 2A9QA 4BO0A 3VKGA 5EJ6A 4JWTA 2P9EA 5LL6P 1JWLA 4MICA 3Q41A 5CM8B 4MVJE 4C3VA 3QSYA 2EP7A 3LKBA 4G5FA 3PJRA 4XJXA 4IDPA 4JC5A 4LDJA 3GI1A 1I6MA 4DMCA 2F9FA 5A3RA 1SHLA 3K7EA 1FQOA 4PYQA 5D3KA 5E1MA 4X7RA 2AF4C 3NOXA 3Q9SA 3KT9A 5J5CA 3B9RA 4QFDA 3V1LA 4MYUA 1CQJA 1FNDA 1GUBA 1R8YA 2I99A 3ZLTA 2IVZA 2QDKA 3C3EA 3DPSA 5EEHA 2E4UA 4O2LA 3EDCA 4S1WA 3F5MA 3UG6A 4B45A 1NP7A 1WEKA 3ETHA 4DBZA 2EKBA 2XCLA 5GV8A 4C1BA 4MLPA 4BFXA 4COKA 2PZLA 3DUFB 5A71A 2PGJA 3FYDA 4GI3A 4HI0E 1FUYB 3ZY5A 5CA0F 4ITRC 5L3QB 1WB6A 1YIDA 3GW8A 3R6LA 4J0QA 3IYLW 3LWNA 3R7NA 3VR2D 3O5AA 5CDHA 5HZKA 1DQZA 3KT8A 4HWKA 2VTDA 2BRUA 4IOLA 5TMPA 4B4DA 2RBEA 1WW8A 1XYYA 2GN9A 2C98A 5JZSA 2P91A 3H9QA 1UP7A 2JVJA 2P9GA 4KQXA 1GFZA 4DA6A 2GZAA 1OXSC 3G79A 4CIAA 4PHHA 1M34E 1VZ2A 1BS9A 2EHDA 2PEZA 1K63A 3URMA 1C4XA 3RGGA 4JDUA 4Z4EA 2X4DA 3RIYA 1Q2UA 3PP8A 3WGQA 4RK0A 2ERCA 1KOGA 1HG1A 1TKCA 3FTPA 4KH0A 4LGMA 3S0JA 3ZI4A 5E50A 2GHTA 5JQWA 1WU7A 2ZZMA 3D8TA 3LA8A 2Q6OA 1ODJA 2GEVA 3W90A 4LAFA 3EIFA 2JA2A 1OH5A 2IH2A 1E58A 3HHEA 4JUDX 3RLFA 4YPFA 4MV6A 5JZMA 1IQ0A 3C1OA 1MHPA 3BCUA 3NUGA 5J5AA 3WLEA 5I3CA 2FF4A 1ODIA 3LHIA 5JH7A 2IGBA 3AB3A 2VQFB 5EWJA 2AXPA 1J25A 3NANA 4FOSA 1JJAA 4Z3OA 2GEFA 3EB9A 2DY0A 4C0XA 1GTRA 2IUYA 2FDRA 3RSGA 3RYHB 1IY1A 1L4HA 2CDCA 3DTVA 4BNFA 3NJ4A 4EW6A 2WM9B 5CHYA 3CW8X 3TPCA 4P53A 4EUFA 4D7AA 5JCXA 5K0CA 4C7JA 3A4YA 4Q3AA 3GHHA 3L8DA 1HDCA 2OLKA 1EZ4A 1OKKD 2G0NA 2VQ6A 3UMSA 2CVZA 4ZOLA 5KTYA 3QVWA 1F2TA 2VA9A 1QP4A 1DJOA 4TXHA 8MHTA 2R751 2ZKIA 3L7KA 4RVCA 4WBNF 1JEYB 2QAIA 5C9ZA 3NYQA 3NU1A 3G2QA 3DVSX 4M0FA 1S2MA 2GJ9A 1YXMA 5TPZD 3HN7A 4PZZA 5D3QA 1DJLA 4GRIA 3ZWMA 1DBWA 5EKSA 3DYIA 1ZCZA 2WJPA 3IQWA 4MEAA 5TV2A 3ZZNA 1FTNA 5E3HA 1OT3A 4PS0A 4B2PA 3MQ2A 4PU0A 3VR6H 4RGQA 1OLXB 1EE2A 1SCIA 4O4IF 4N12A 2M6KA 2BBTA 3G49A 3R09A 5ALYA 3Q10A 4CUJA 2GERA 1DOAA 1CRZA 2ZBVA 2ZWMA 4OI4A 1AN9A 2D2VA 3SHOA 2WU4A 1FDTA 3KKOA 2ERYA 3QXXA 3WGGA 2WZBA 5EERA 1DBRA 2D1QA 4ND3A 3VHXB 3GG9A 3W5VA 5JOQA 1XN4A 4AS3A 2V6FA 2ZUSA 1J33A 3AUTA 3CJRA 4FR2A 4D81A 2A1IA 1UP6A 3A9RA 4KVZA 2X9LA 4RD2A 2DUJA 3BWYA 2HLDD 2QLNA 2DCMA 2EEZA 2O8BA 2QENA 3H2BA 2HXGA 4YMSA 1II8B 3OM9A 2F55A 3QX3A 1LVUA 1QYXA 3JWPA 1YR8A 5ED4A 1P7CA 3T5TA 2IS2A 5F3DA 1Z75A 1TM3E 3WB0A 2YINC 3SHVA 1HI9A 1KHUA 1P0PA 4BB6A 3H9BA 3IULA 1X1AA 3OPYA 4WSOA 2ZYTX 2PCLA 4PZEA 1VKZA 4L7VA 3SLGA 4S3MA 1ZUNB 1Q5PA 2H3EA 3JVIA 3MN1A 5K0NA 2NV0A 1Z35A 4RKWA 2K7ZA 4MW1A 4U7PB 4L76A 2Z08A 5TMBA 1O96B 2BFWA 3PEVA 1AHIA 1PTJA 2G7ZA 2JKDA 2ACWA 4ZVLA 3SMVA 3EQ2A 2H54A 2QUAA 3VX4A 2EJBA 1BHQ1 1QK3A 2FEKA 4BWFB 1RXVA 1TVKB 4IIYA 2QT1A 3HP7A 4OLBA 3OTWA 2B94A 1UBHS 3JRWA 1RC1A 3WGJA 2VJMA 4IW3B 5CFOA 5HUJA 3DMTC 3ESCA 1GZDA 2FZCA 3ROXA 4E46A 2PBRA 2EQAA 2GWHA 2IXEA 2BP7B 1MK2A 1XROA 3P9IA 2DWUA 2I1VB 1JJ7A 1WXXA 2HXSA 2O5RA 4BQPA 5EJMA 5I5EA 2PUCA 2A0UA 4OJNA 4ZDWA 5AVWA 4WCVA 4ZDIA 5KC8A 1C3OB 1B3RA 1OD6A 1W1UA 2ZWPA 1NASA 2I5PO 3BB1A 2FUG6 3EE6A 4H6VA 2HQ1A 2GCGA 4TUYB 821PA 4YTEA 4G5RA 5CK4A 2IU3A 3LYAA 4GEGA 4PS1A 1TT5B 4F3CA 3U44B 1U2ZA 2HRDA 3EGXB 1JQ3A 4QBIA 5B1EA 2RH9B 1W44A 3Q2OA 3PD1A 4INJA 1ZK2A 2FZWA 3ETLA 1TECE 3AF3A 1GIAA 3K4PA 5CTJA 5EP3A 1DMSA 3SC2A 1JIVA 1SVKA 4PQFA 2Z2YA 3M33A 1NW3A 5KQGA 2Z04A 4BGUA 1ZH0A 2PL5A 4EW2A 5J43A 3CVJA 4QPCA 2BFOA 3DTNA 1YE5A 3FMOB 4XB1A 2UZ0A 4NOLA 1XJ0A 3IP6A 4UU1A 2P6NA 5C53B 4BNIA 3CW2A 1WUTA 4JEMA 1U0NA 1J0BA 1YACA 4CEJB 3LXRA 3SF8A 1ECPA 5ED0A 3ZW8A 4HVCA 3GV0A 3U7FB 3D6TB 2C2GA 3DWIA 1N3YA 1VB5A 2CLEB 3EAFA 4ARZB 2WWTA 4MR8A 1Q3TA 2XXAB 2VDVE 2WOJA 4K9LA 5J1TB 4RSMA 4NONA 2DWQA 2X58A 2VPIA 2H1SA 3DL4A 1PN3A 3LX8A 4JB8A 4O2AA 4QPJC 1ACJA 1Z88A 4MR9B 3PQ4A 3REQA 3T5CA 1I5OA 5FTKA 4YRKA 1YJCA 3EIQA 3DDHA 3FPJA 4TZTA 2E5WA 4F1KA 3O4HA 4B1FA 3PV0A 5AHRA 2R2AA 3OCXA 5CVDA 3W06A 4R4JA 5JAZA 1C0EA 2WAYA 3KFLA 3IT3A 3QPDA 3GDGA 1H2YA 3C45A 1ZICA 1A5SB 3CJTA 3LGSA 4F71A 5L3SB 4MIYA 1WSAA 2IXBA 1FX0B 2VHVA 5BQ5A 7MDHA 2V1XA 1CVLA 1HFKA 1QMPA 1ZBQA 5FLXA 5C1BA 3LHSA 4KL8S 4Q4LA 3RE1A 3T5DA 3RBAA 2UV8A 3SF0A 2A0WA 1NC1A 1V7CA 3UOAB 1USIA 3VVLA 4J3FA 4N5MA 2W2LD 4GZ6A 1A27A 1YDWA 4Z4IA 1OE0A 1DCKA 5A7HA 2VHWA 4HX5A 3LQ1A 1JBEA 4GXTA 3BBPA 4M54A 2FQWA 1PQPA 5H80A 3WYEA 2QW0X 2LCFA 1TB4A 5HKLA 4XH9B 2XXSA 3DC2A 1Y7LA 3CBGA 1H8EA 3JD1A 3LVBA 3ONWA 4K1XA 2Q29A 4OPMA 5IMSA 2Q5IA 5ICCA 2P30A 4QDJA 2VHJA 1PO7A 3CUWA 5L7YA 1YKGA 3F4KA 1SULA 2A4KA 2D59A 1R10A 4DB4A 2JJ2D 4UOEA 1VM6A 2CT8A 3FVWA 3SEFA 4PLHA 3DZKA 3TBHA 1LFDB 3ET4A 4OSOA 1H2BA 3AVUA 5DHSA 5CM2Z 2ONCA 1IBRA 4IUBS 4J9UE 1SUAA 4OGLA 3H97A 3RAPR 4ZT7A 2INGX 3PHGA 4DYHA 1ZHFA 1XVLA 3O1JC 5DEIA 1G7CA 1TQHA 1KETA 4GKAA 4G5HA 3SP1A 1JHRA 1O6GA 1USKA 3MMSA 5AVXA 3FSGA 1E5TA 3NEAA 2IQ5A 3ER9A 3EXEB 5I8PA 4FR5A 2VYVD 3C70A 4M7OA 4B74A 2VF5X 3BK7A 3IAXA 2J0UA 2PZGA 2FZKA 3O8QB 3ZDAA 2QZPA 4ON9A 2KB4A 2G04A 1W9HA 1VBFA 4MQ4A 4NCNA 1E89A 1EGVB 1MAUA 1Y8RB 4PC7A 3PSAA 1DDIA 3ABOB 1R37A 1ZCBA 3O9MA 3P4YA 4RHEA 2RDMA 1Q7BA 3PE4A 1H2FA 3FOCA 3HBMA 3NRCA 5J5VA 1TYCA 3ZK7A 4P7FA 2RCNA 5BT8A 5KU7A 1H4VB 5E6RA 2NXNA 1JSZA 1TUBB 4RF3A 3WDLA 4INAA 4UBIA 4Z1MD 2E1PA 3N53A 4FT2A 1OV4A 1ULHA 1Y9AA 2V6GA 2XDWA 3OQIA 3VPYA 4JB3A 4LK2A 1Z6AA 3WZMA 3ME5A 4O4HA 5KCMA 2GBGA 3E05A 1WCIB 5C5EA 3WTCA 4EJ2A 5DHRA 3RVRA 3CRMA 1MRNA 3ZC3A 3O92A 3L7YA 5IULC 5BSUA 1FP4B 4X20A 3QKSA 2YRFA 1X8KA 2ERXA 4CGYA 4QYIB 3M5WA 1QPGA 1TC2A 1N75A 3GT3A 3V97A 3DEKA 4D43A 1JP7A 4K05A 4PC2A 4W1RA 3QFTA 3EIUA 1KOJA 2WOOA 5KSWB 1R0KA 1QGUB 4HGNA 1R0CA 1X0XA 3SEAA 5DGHA 1VBNA 1VPVA 1ZFNA 3A6GA 3V7UA 1N4DA 1NV8A 1YIOA 3EIXA 3GVXA 4UARA 3NCHA 3N6XA 4BV9A 4XGQA 4EPYA 3TPFA 3DTYA 3QE3A 1JR6A 3AO0B 4AJJA 2Q49A 1Y80A 1FFGA 5EIFA 2VHTA 2QRNA 4RGBA 2HRQA 2UZAA 2JF0A 1DTSA 3B60A 4GVPA 1M7HA 3ML1A 1HQCA 1OZFA 2J9YB 4HRVA 4ZZ1A 4QQRA 3MGCA 3QK7A 4S1NA 1AQIA 1OOEA 2DSNA 3OX1A 1R8XA 3THYB 1UBJS 2QQFA 1J2RA 1GQ2A 1UHTA 1NBMA 1Z36A 5F21A 1AUPA 4YRPA 1JA9A 5JAIA 4A73A 4ZANA 1HL3A 1U4SA 5CURA 1K7XB 2NP6A 1SQSA 3EVCA 3KHKA 4X95A 1BU5A 2OMEA 3ANLA 3TR5A 5DGDA 4JASB 1PRYA 3OLYA 4EGCB 2WJGA 3N6VA 4L73A 5BSTA 1T5HX 1WULS 2C42A 3KVYA 3QU7A 1SFRA 3W5HA 2Z2KA 4X1OA 3CPHA 2R6CA 3HZRA 1VHJA 1C1DA 3L77A 4X93A 4BMNA 1J90A 4LW8A 4RFVA 4MV1A 1P45A 1EK5A 3KYDB 1JZTA 2LE0A 4LXTA 2R97A 4LDPA 1T26A 4BN4A 4KUHA 1W34A 2VP9A 4PN3A 3PKJA 1RQRA 4I50A 2OFOA 4ZQBA 4URZR 4R2JA 4B8ZA 1G41A 4ZVOA 2IPNA 1PZNA 1PQ4A 1ZINA 1DARA 1JHQA 3HL0A 5AKLA 5FNVB 1ILWA 3SE7A 3U39A 3VTKA 1X2EA 3CF4A 4K8OA 9GPBA 1EB9A 2A9KA 5MGNA 2GCNA 2VJKA 3KKEA 5NULA 3ED5A 3IHKA 4L85A 4N7JA 1E2JA 2WAXA 5EHXA 2WDZA 3IEMA 3OJFA 1SCDA 1XZFA 4G0ZA 3UCXA 3THXB 3C98A 1YOVB 2WWGA 1E7WA 4B6QA 3TVYA 2PQ2A 1F5SA 2OZVA 3AW8A 1ZX1A 2SKDA 1YHZA 3G5UA 3ZVRA 2XW6A 4HQOA 2B5OA 1U0LA 2Q62A 1PSWA 1B2LA 4LWPA 2HHHB 4EL0A 3KLNA 4QU0A 5DCWA 5K9ZA 2NU8B 3B1YA 3I04A 4QUEA 2DTEA 5DV9A 1N36B 1F14A 5LMNB 3MOGA 1UQUA 4X62B 1EXDA 1UF9A 3EGDA 1PHPA 4X61A 1DT3A 1QQ6A 4QT0A 4L8GA 2IT1A 4R9UC 3T99A 2FWPA 1NLFA 4NATA 2A4MA 3ELVA 4C5BA 4CR6A 2RC5A 1N5JA 3ZHOA 5C32A 1QIDA 3GJ0A 1CEQA 3N2YA 3EXG2 3O74A 4ROTA 3R6GA 3WJ7A 3WLKX 4DMRA 2C4WA 2JRLA 1PG2A 3ZY3A 1UPBA 2P65A 4RV5A 2PD3A 4PRLA 3Q5EA 4RPKA 5BOSB 3RK0A 2V8OA 2HREA 2WE7A 3L93A 1JALA 1FS4A 5CH8A 2WWFA 1CIVA 1QO7A 4MV4A 4NQRA 3W3AD 5F9FA 4E31A 1IN8A 4I5IA 4V2UA 4ZC1A 1NJ5A 1CUJA 5GQSA 4MGKR 1ZM2A 4EJFA 3I2IA 3ZZ1A 4XWOA 4CQNA 4G63A 2FN3A 3JRNA 1VC2A 3C7DB 2GBCA 4CG0A 4IRUB 1U0SY 2O6LA 3L6OO 3V1TC 2IELA 2L82A 4CL8A 3CG4A 1UFQA 1ADGA 3C15C 3BQ9A 2LWIA 1NW7A 3BMNA 5IU6A 5CT6A 1P73A 2RG7A 3HKEB 3PC2A 4ETWA 4ZYVA 3HV0A 4KODA 3TB6A 3C8MA 4A2WA 3ZJVA 1FVHA 3KU1A 4K5QA 3UENA 3UA3A 1XJWA 1DRKA 1ZXXA 1WB4A 2OG1A 3GIWA 3MAJA 1NTOA 1HY3A 1U90A 2HWKA 3B78A 4HQFA 3HSYA 4WMLA 5D3ZA 3A6LA 3GUUA 1FFXB 1EUCA 1WMBA 3NCTA 1XZNA 4XEHA 2ZJ8A 1RAAA 2CLCX 2GA8A 4TLMB 1XKTA 2NO9A 3ECCA 1W88B 3DOHA 5CJPA 3IH5A 3TM5A 4LVNA 4TTVA 5DBHX 2W70A 4C29A 1CDOA 1V2GA 4PCVA 3FZYA 4I6GA 5KYUB 1JT9A 3D2CA 3DGFC 5CYPA 3ACBA 3DEYX 3WK6A 4CEIA 2G83A 3COZA 3OUUA 4BTVA 3OOYA 4PLZA 4DV7B 2A67A 3BTOA 4OQZA 4HSGA 3OQVA 4QDXA 2D54A 2BFPA 1W5TA 2J45A 4D97A 4EGQA 1JQ5A 4K8RB 4F46A 2G1PA 1E0AA 5AVKA 1XFAA 2NZ2A 4EFNA 3GLFB 1P7PA 1ISRA 4F4UA 4MJ7A 2IF0A 4BX9A 1C1YA 1QTNA 2HLNA 3BCSA 1O57A 4DYDA 2ZRCA 1GRCA 1MEJA 3PHLA 5JNUA 5JRZA 2L42A 2WFZA 1D5WA 2BE7A 5JC1A 3AI1A 2Z56A 1F0YA 3X3HA 4L08A 5AH0A 3KTDA 2G08A 4EJ0A 3IEXA 1P0MA 3K5HA 1U1GA 5KMGB 2DU8A 2Q3DA 1H6CA 4HZGA 5FD8A 4LNHA 5LU8A 1NE2A 3HP4A 2Q2WA 2QLTA 1T29A 4FDAA 1VCHA 5GTDA 4MRVA 1LQUA 2VK8A 1V3VA 4H16A 2VVTA 2XNCA 2XF2A 5DGXA 2CCGA 1E7SA 1QXSA 3JPYA 3RRJA 5IG2A 2Y1KA 1QIGA 2FW9A 2HA0A 1L5NA 4BUZA 3LOQA 4DFDA 3ZV7A 3RVNA 1JH8A 2A2ZA 2IUSA 4M0UA 4DMLA 3TSYA 1QP0A 4QO8A 1E20A 4I1YA 4CMIB 5CXUA 1M2NA 3A1EA 4N8EA 3I53A 4O63O 1AKRA 2HIMA 5BWBA 2ZAGA 3U31A 2DG2A 2QVXX 1IN4A 1OX5A 4B46A 1DBVO 4L22A 5KAPA 2EVWX 4BO4A 4FVTA 4A0FA 3TOSA 3B3GA 2H31A 3LVRE 1Q1AA 1JL3A 2I3AA 3VVMA 1FXUA 1HDOA 2O20A 1H22A 3C1UA 3U4DA 4I8IA 3RUFA 3UA4A 2DTXA 2RAVA 3ND8A 3C1TA 2D4HA 4HYTA 2IITA 3O8OA 4DRXA 2ASVA 2ZAMA 3T94A 3CUYA 2UZ4A 3N8NA 4QXPA 3OM0A 1KAHA 4OHUA 1X0VA 3RUDA 4GGPA 3PDHA 1BXRA 4PTYA 3Q3GE 4P4UA 3ILXA 2QSYA 3CBQA 4XIIA 3DJFA 4BKUA 4F6RA 5JXWA 2WU8A 3B1FA 4UFOA 3F1LA 3OQPA 3QWFA 2QZ4A 2H63A 3MD9A 3QITA 4HN2A 2RE8A 4KXUA 5JS1A 1XTSA 3SZRA 1ZKMA 5JJBA 4TWBA 1JQBA 2YWXA 2QNRA 2W4QA 3CE9A 1T4CB 1DWUA 1SEPA 2NVOA 4P2BA 2IH5A 3TQIA 5AKKA 3DFZA 5TPWA 3OFVA 2UU9B 1KJ8A 1QRDA 4FEAA 3FAZA 3RD5A 5BMVF 2R8BA 5EJHA 2C95A 2Y1GA 1TK2A 2XI4A 2ZATA 3BERA 3OZXA 1JEQB 4KVAA 4N65A 4UUNA 1QGDA 4WK2B 5NLLA 4GYKA 2WM2A 1GQQA 3A27A 4LMPA 3ZGNA 5IYZA 2H2IA 1O97D 1TIKA 4RLSA 1ZRMA 2WUDA 3ZDZB 2LIVA 1LK0A 2JJYA 3FYUB 3NBAA 1MVOA 3ZIDA 4WH0A 5JFGA 1VIVA 2WF5A 5FX2A 4HZUA 4OHBA 1KMHA 1L5SA 3EG9A 4ACAA 2DY1A 1EAYA 3AJ8A 1X86B 3I12A 1AK9A 5G3YA 1KFCB 4C7XA 2XGJA 3VR5D 2D5BA 4LJ7A 1YVEI 2H0QA 1XPRA 2TSYB 3NKVA 1COZA 1Z17A 3W6OA 4EKYA 4X54A 1VRCA 3BMOB 4Q5IA 2Y93A 4AJ4A 3SJ7A 4INZA 3L6BA 1JHUA 1G9XA 5ELLA 2XVZA 3AFOA 1S89A 1UEIA 4GKBA 4Q3EA 3FX2A 1JDUA 4TZKA 4PNEA 4D96A 2JJ8A 1EFCA 3DUWA 3FJYA 4HUJA 3RCBA 2MOKA 4HVLA 3UC9A 1BKYA 1OTYA 2MHCA 4NYIR 4RO0A 4TKUA 1W36B 3I64A 1WZNA 2YHAA 4HO1X 3IIJA 1P9OA 2DC1A 1XVVA 2PUVA 2X41A 3AP1A 3E2IA 4ZXFA 1M2GA 5A0VA 3TAHA 1Z7EA 2R7LA 1J00A 1AZTA 3OQBA 3AEKB 3OT5A 4YYZA 4MR7A 4BU1A 3V48A 1XQVA 1Z4MA 4XUEA 1AO0A 4UUMA 2C7OA 2R6GA 4WLEA 3PX7A 1Y6RA 1R0XA 4QICA 3V9AA 1CUXA 2J07A 5GVRA 5HQJA 4OHXA 1IPFA 1OAAA 1GGJA 2HCTA 3NI2A 4C1NA 3EPLA 2VK4A 1E94E 3ENQA 1I1OA 1YMQA 2BF4A 2FP4B 5HA5A 1E5VA 2W2TA 1FC0A 3JASB 1A4IA 2RBKA 1JMYA 1D9XA 1DINA 3LZ6A 4FZ5A 1WG8A 5DM0A 1KDPA 5ALWA 4A2CA 1XTVA 4UTZA 2ZRKA 4EG0A 4IG4A 1WWKA 4O4JA 2XMSA 4YUAA 1YMVA 3FCUB 1L5HA 2O7QA 4EDHA 4PYRA 3G13A 5CFQA 5K51A 1JAYA 4XGKA 4N0QA 1ISHA 3RU9A 1SNYA 5K6AA 3TL2A 4L8FA 1TQDA 5CNJA 4BXOA 3E7XA 1TYEB 2OEPA 3I92A 4GPZA 4TVOA 4K03A 4ESOA 1JWAB 3OIUA 2JI4A 3AIOA 4JFAA 4A8TA 5AVSA 2XE4A 2ZU6A 3LUBA 4H4DA 4MUYA 1AMUA 1OGYA 3KE9A 2BMEA 5I9TA 3TTXA 4E2FA 5KIAA 1OMOA 2C4KA 5DRYA 1C3VA 5IDVA 1B43A 3WX0A 2OD7A 2RGNC 4WA8A 3JAWA 1U7PA 3TW8B 1G1AA 1RJ9A 2FQYA 1Y4DE 2GNOA 4C78A 1FUEA 1ICEA 3A4VA 4XDZA 4RULA 4BVBA 1DTWA 5FEMA 5JG7A 2QAGA 4IZ6A 3RNOA 1D1TA 1XTJA 4GUDA 3PT5A 4QJ5A 2H1HA 4ZQHA 4G4IA 4C76A 5K3FA 4MWEA 2EJCA 5B53A 1UOOA 1ZIDA 2VPPA 4RJTA 2FR8C 4GZMA 4QTYA 1QQTA 4ERXA 4F72A 2R87A 1X70A 1FLNA 4J0FA 2IIBA 3BWMA 1NMZA 2HQRA 3BL6A 4D9NA 2C1ZA 3EISA 1MP0A 1CR6A 4IYJA 4QA9A 3JQ8B 2WIBA 2XX3A 1N0IA 4R31A 2W7TA 1GRQA 1B8UA 3A31A 4RKFA 4Y0VA 3V4SA 4C6TA 2NSDA 1FTSA 5G40A 1BDHA 2YHIA 5M5BA 3NMUF 1SHKA 3OD5A 2HF7A 2RC6A 3L1IA 3H1GA 4TSFD 3UJBA 5B3LA 5AM5A 3V1NA 1NL3A 2YJNA 2W2KA 3BTUA 4UASA 4WLOA 1S8OA 1ISMA 2NTVA 5ALZA 4OQXA 2NACA 1J23A 1QR6A 3T9BA 5BV8A 1EG7A 5C1IA 1KZ9A 3FRHA 3COVA 1A7JA 4ZQFA 5FTLA 2FN9A 4JLUA 3VZBA 3PEWA 2WHQA 4N49A 4Y2GA 3FMPB 5AKJA 1OLUB 3HA5A 4YRJA 1KJIA 2WBLC 3D59A 1JTVA 1XZKA 1Z13A 3ZIUA 3FJ1A 3LKVA 4XW2A 3STYA 4P0PB 4LRXA 5CA0A 2VDUE 1THZA 2J9FA 2BELA 2OCPA 1JPNA 3OLQA 1T9BA 3QUBA 4HMQA 5EQFA 3TZCA 3QOFA 3ZCXA 4YP6A 4CIBA 1QGYA 3ZXIA 5E4YA 4ZYWA 1FNMA 3MRTA 1LB1B 2CNWD 2XUFA 1YA8A 2W2NA 4MUXA 2J32A 2IH4A 3HV2A 4BBPA 4ND1A 1UFOA 2OXFA 3MGAA 1RCUA 1G5TA 5ISMA 1FNNA 5E7JA 1VG1A 2DX7A 1QG0A 2BR3A 2O2HA 2J6IA 4MZDA 3L05A 3QELB 4RFLA 1AQYA 5LZ9A 4ARVA 3G23A 2PA3A 3K20A 4E30A 2E6KA 2QTZA 4IMIB 4AJPA 3EHDA 1E1RA 4ALIA 2NIPA 2R48A 3VPFA 4FLFA 5BRJA 2O8FB 1HGXA 4CT5A 1KXJA 1U31A 5IRCD 5SYAA 1BKDR 2VSNA 4G0PA 1CY1A 5B7GA 5J4YA 4NOMA 4UNPA 1NQTA 3DBHA 4HGPA 2QIPA 2A1TR 3TRKA 1P0QA 1GNLA 4B2IA 3R20A 1MABA 4EHLA 5L3QA 2FVYA 4ICIA 1XEWY 3D0OA 3OTHA 5GPBA 5J58A 1NUSA 3PUWA 1LLUA 3KWMA 721PA 1KJNA 1UKVY 2XA9A 1VCNA 2A57A 2KJQA 4MQEB 3H7AA 5EQJB 3IIIA 4PBRA 4IIDA 5B1IA 4DG8A 3G02A 1P62B 3EVNA 3F3MA 3NBMA 3ZDFA 4QVIA 2HJRA 2ACEA 3D7MA 3JATA 1PFWA 4GPAA 3MLAA 1LRLA 3NGMA 2HUPA 2PVPA 3FGZA 4X1KB 5AIBA 3FYUC 2DH5A 1TKBA 1VHLA 4UE6A 1UDWA 1ONNA 3E3LA 3IBTA 1RI4A 5CUQA 5DM70 1D1QA 1ZY2A 3WMRA 4EHJA 1E8DA 4JJFA 1SEVA 3IB6A 3E7DA 5IUNC 5DGCA 3OCZA 1NBME 1T9CA 4M36A 3T0FA 1JR2A 3I3OA 1SOWA 2JLSA 2ZSBA 2HU5A 4OH7A 3PXAA 5FQOA 4WBNA 2QTNA 3L07A 4ZPJA 2NYRA 3RQIA 3R8FA 2OAP1 4HQ6A 4GLBA 1KQ3A 5FA5A 3M1AA 3NPAA 4BFUA 2NGRA 4PONA 5FAKA 2YZKA 4BO1A 4F2DA 5HILA 2O3SA 2FE4A 2VDNB 2WM8A 1JKJA 1YH3A 1Q50A 3DO5A 5EP2A 4Z49A 1ESEA 5HTKA 2CYCA 3T1VA 4O4IA 3AF6A 2OFFA 3ENVA 4P08A 4KXVA 5T3UA 4X9XA 1W36C 3CO5A 4BNZA 1XN1A 3ITKA 1CULC 2HRCA 5ELXA 2XR1A 4KRGA 2DR2A 4PX9A 2ATVA 4YAOA 3G3EA 3B12A 3ZKAA 4Q6BA 4JMLA 4WJKB 2XEXA 1XRMA 1JEYA 4HAOA 3E53A 1CP3A 2C4UA 3B36A 1T1RA 5J59A 1EMDA 2XOKD 1FP7A 1KI8A 3I9NA 5JXIA 2HA6A 3IAS6 4JWKA 4Y2XA 4NZMA 1AZSC 2DUUA 4L7QA 3UUFA 4QXAA 3T3IA 3DEZA 2MSKA 3U4HA 2CCKA 3B7GA 3PXBA 4US0R 4M7PA 3VU3A 5BR4A 5KYXB 3PEUA 4P58A 3GZNB 1W73A 1K3JA 2BHTA 4I0WB 4IVNA 4N8DA 2JFHA 1ZH2A 1GR0A 4F5DA 1HL7A 1L9KA 1NBWB 2A92A 4G4GA 4IM7A 4Q05A 3ONVA 3MOSA 4FEYA 2Q7OE 1XFDA 1V9CA 3B52X 2PYIA 1KL7A 2QRJA 2RMKA 3I0NA 3MPOA 4RZXA 5P8WA 3VHXA 4L5CA 1EVZA 4OFBA 1CZNA 4RELA 1VXOA 3GAFA 4HDOB 1VG0B 1L7EA 1PL7A 3OJ0A 4PYNA 5DNEA 4YREA 4TKLA 5L6LB 3IUPA 1NVDA 1U81A 4PG6A 2Z8XA 1W8DA 1SWVA 2C9BA 1G59A 3QVXA 1XAHA 2W0MA 5F3RA 1I8TA 2PTHA 4BHTA 1W5SA 4DGQA 5IWAB 1II8A 1PYDA 4JT8A 4RD3A 3D4NA 2CLMB 4FR0A 4YRMA 2CW5A 2D8MA 3JD3A 5FWXB 2ZXUA 2Q1WA 3OY2A 2WT4A 2ZIXB 3G2NA 3UY4A 2PZAA 2TMGA 4RJKA 4ZT2A 1U3VA 4YAGA 1LLQA 4B75A 4AJHA 3K1JA 1KAOA 3TQQA 2BPOA 2PR7A 3ZV3A 2Q2OA 3C74A 5IKMA 2V4ZA 1SUWA 5A4AA 1AV7A 2C8KA 4ARBA 4GYJA 1V5WA 2GR9A 1EAMA 1A76A 1NXSA 3PJDA 1K3NA 2Y1LA 3R1IA 5K8TA 5IXYA 3GF4A 3FJOA 3ZE0B 2O0MA 1LS1A 1MO3A 1ODSA 1JE1A 3LJKA 5HUQA 3IL2A 4C14A 1O0SA 2X40A 3NH9A 3TEJA 1TVKA 1CUAA 2CNLA 1OYVA 5EHGA 3AFMA 1JRLA 3R77A 4H15A 4LNUB 1HFEL 1R5OA 3AUJB 3F8WA 4M22A 3B1ZA 4TTTS 3KYCA 3L79A 3WKCA 4TYNA 2OZPA 2B35A 2QG4A 4MJLA 4NYIQ 5A62A 5K3SA 5AKHA 5JDIA 4KLCA 3BAFA 3MWJA 1S3FA 5E95A 4DS3A 3A3KA 2F1RA 4ZMBA 4JLPA 5KHAA 1P2DA 1NBAA 1F2VA 3E8MA 3ETCA 3JQBA 1B8VA 1C3OA 1JIUA 3K9CA 4TUYA 4F38A 4UUOA 3Q0EA 3BE6A 1F60A 2IY9A 4HWPA 5KVQA 4E12A 4YR9A 1NVFA 2H2GA 1SUPA 2I4OA 2Z3ZA 3LHDA 4EA6A 5HCUA 1U8ZA 1EFAA 4FE4A 4DJAA 5F23A 4M88A 1XU4A 4PPGA 3C5WP 1CJBA 3L01A 1MC1A 2I8CA 3K16A 4G9BA 4DLWA 1T2NA 5ICEA 3K9FC 1AOXA 1U5AA 2RGXA 2WSSA 2WYVA 3OZTA 4I4IA 3FM9A 1MX3A 1N25A 2AG1A 3ETJA 4OI2A 2W6OA 4KDRA 5EFOA 1CUFA 4I2NA 1RZRA 4KJZA 5F2KA 5AKIA 3DFIA 3TDNA 1KIAA 3GELA 5FTJA 4ZHQF 3ORRA 2JFBA 4JR0A 5D86A 1U6JA 2IUFA 3A05A 3A4IA 4WZAB 2XWPA 1HLFA 1XTQA 2A0TA 3V8PA 1UBUS 3SYRA 3UGQA 1Q0SA 4OM8A 4NU6A 1WOYA 2MINA 4G23A 4JJ7A 5FBKA 5C4GB 5A1JA 5A5EA 4Y2TA 1YJMA 1GXSA 4ARZA 4DANA 1XX6A 3NO4A 4NG4A 1MMFB 4PGFA 3TLGB 1GOTA 4CDMA 2JVKA 4WZBB 5HCNA 2DAPA 1PR5A 3B70A 2YOHA 4MR9A 1KARA 4ES6A 5GV7A 4YMHA 4UOQA 4OMUA 4RMGA 2QI9C 4MRMB 4ED9A 1LV7A 3NHAA 4D9VA 1P6UA 2RBGA 3HKDB 3KB8A 5IAOA 2VPYA 1KU0A 2RFLA 3C6QA 3R6DA 4LJKA 4NS1A 1R27A 5FL3A 2ZPTX 1FNSA 3PFGA 2YNMC 3KZCA 3V32A 3AM4A 4UM9B 3A4LA 3FPAA 4EQZA 1T2DA 1X1BA 2PIDA 1FX0A 1PEYA 3IP5A 2GOYA 3WY9A 1W4LA 3MCZA 2P2DA 4M1ZA 5IDQA 2C4MA 2HSWA 2ZYSA 3A2MA 1PNQA 1GLNA 1RHRA 1SOUA 2ZXEA 2J09A 2NXJA 2XMGA 5CT9A 3KYBA 5DX8A 1T0UA 4YT5A 3R9XB 1TA0A 2FLKA 2I9PA 4GLOA 3SHTA 5JRDS 2GBFA 3HRKA 2FP3A 4GNKA 2B78A 4RPIA 5KNBH 4N41A 1DZ3A 5EXDA 5B3JA 2QNIA 3U9SA 4E88A 4G2SA 4FS3A 1RACA 5H81A 2QRGA 4M37A 3LYUA 1FQKA 3AJAA 5HDQA 4BX0A 4IHQA 4QXQA 5GINE 1HO3A 2FG6C 4H3SA 4UMFA 1RJDA 4M0CA 2NU6B 4LRQA 1P9RA 2CYAA 1ECLA 3HI6A 1Z4QA 2HA2A 3SX2A 5B4UA 3EFOB 3M49A 1CT9A 2ZIZA 3L7OA 5H9VA 2SHKA 4ZVSA 1OFHA 3PYMA 4GRDA 4OBBA 5E6UB 3T1NA 2VT3A 5E1BA 2OGTA 3WWCA 3H05A 3DITA 4E5VA 3OE5A 5JSZB 1M6WA 3Q0IA 2Z0MA 1XLUA 4GF5A 2HM7A 1UXKA 1X14A 1ZIPA 2HSJA 2PX6A 3CLVA 3KPUA 2ZK7A 2OHGA 1YOBA 4IV0A 3BVPA 3TOVA 3F6SA 3OFJA 1QH1A 2NG1A 2FK8A 2IS4A 4MUJA 3ISTA 4YB8A 5BT9A 5JV5A 1K9VF 4J49A 1KKUA 1QK4A 4RV9A 4A7PA 1K3QA 3CG0A 2JFGA 3G5TA 2G28A 3IEIA 4LX8A 3U3DA 1DWOA 5AW3A 2WUGA 1IQPA 4D3DA 4RTRA 2G09A 2BSXA 5B12A 2I29A 3E61A 1E5QA 2H51A 4NARA 5DLQC 1GEEA 2QM7A 1KRXA 4BKMA 4KO8A 4HWRA 5HK9A 1PLJA 3I34X 4NBLA 1UBKS 1D07A 2B8NA 1IZ7A 3ABRB 2QLJA 3AUFA 4F96A 1XPUA 5ADUS 1L5VA 3L8GA 5EVJA 7ABPA 4XOIA 3QP9A 4RPGA 1JS1X 3F9IA 3MWDB 4GE0A 1XBTA 3RRZA 1GPJA 1VL2A 2DBQA 4E51A 3UNMA 3UMZA 1WP4A 1EK6A 2P4UA 3HDGA 1EVKA 1FDSA 1VJDA 1YNOA 3JYHA 3O90A 3P32A 1TM4E 1XTIA 4LVCA 3TNFA 3U6BA 2NZYA 3T12A 4Z3KA 5EJIA 3QG1A 2COUA 2XB6A 5DO9A 4X6UA 3UB2A 4AW9A 2B6NA 4M55A 1IQRA 1GUYA 2GRUA 3WKDA 5K2OA 4JP2A 5JALA 4S12A 1FP4A 2QYTA 4HXEB 1R74A 3E9YA 1D2MA 3N7AA 4I5GA 5BV2P 1J2YA 2ATIA 4F5EA 3ZH9B 4WK0B 4KACA 4W8GA 4KIJA 2ZBPA 3CLRD 4K6KA 3BRWA 3NHLA 2Q8QA 3VYSB 4K6HA 3A77A 3KV3O 3KQSA 3WNVA 2OV6A 3WGMA 2DHEA 2QG9A 1G5HA 3PC8A 1HLPA 1NLYA 1R5NA 3CZMA 4WNAA 3UV3A 2G82A 4C0QC 2ILTA 3CLKA 5BSVA 5L40A 3FCAA 1A82A 1W4BA 3CLSC 4W6QA 5J3JA 3OHSX 3Q40A 1V39A 1DAIA 4OLFA 1XNQB 1NXQA 4DW8A 5C1DA 4JYZA 1QVAA 2AI2A 2Y66A 1G17A 1Q0RA 4NBWA 5AW0A 4I4TF 5G0UA 2FFBA 1UFVA 3DOCA 2OBNA 3H1AA 3O03A 4KSCA 2BI7A 4WZ6A 3X1KA 4FGZA 3V4VB 2H5EA 5C4IA 2A1UA 3ASVA 3WA7A 4WJLA 2PFGA 2YWFA 3OPVA 3THYA 1VMIA 4EA8A 1L5ZA 3AVPA 2Z95A 1RYBA 3RJZA 3UT6A 3OPNA 3TH5A 3V1MA 5HSGA 1WMAA 5C80A 3MQFA 2O5EA 3VYUB 1NW6A 5T6MA 3EHEA 4OLJA 5GONB 3WHPA 1U9YA 1N2SA 1I9CA 5D85A 3KCQA 4D4GA 2IDZA 1P80A 1U0EA 1VMAA 2R5WA 4Q4JA 5BSRA 5EGSA 4TS1A 1N5MA 3N3AC 5F77A 1Z6ZA 3R5XA 4V0RA 3KLPX 1YC2A 1KFBB 4OJYA 4YT2A 5DMXA 2ZIAA 2FX2A 5KNDD 4EF5A 3SSAA 4P7JA 1GZ6A 3AHJA 2W6IA 4HQRA 2V0GA 2ZIVB 3C85A 3LXXA 4QYSA 1G5RA 5ENDA 3K70B 1K8QA 2P35A 5BVGA 2FF7A 1JNXX 8LDHA 5KINB 5LZ7A 2IC5A 4BV3A 1N6PA 3U1TA 3LX4A 1SXPA 3I2HA 4TVBA 3C4VA 4W5NA 1YBVA 3PYXA 4KG7A 3U4IA 4OHFA 1B14A 2B4YA 2NZ8A 4IIBA 2W71A 1V4NA 1Y5RA 3ESBA 3MS4A 4JVNA 1I33A 4KQ2A 4XPZA 1DS6A 4PWYA 3GLTA 4QLAA 3SXJA 5I7FA 5I9NA 3PHBE 3M3PA 4WY2A 2KB0A 3PKZA 4B8WA 1M8KA 2W2PA 2ONKA 3FGPA 4MUKA 2OQ2A 3PRHA 1U7ZA 1QANA 1K75A 4UHJA 3UQZA 5EFZA 4QEKA 4Y30A 1FP1D 2A9VA 1O95C 2ODBA 4XGRA 2QBYA 5DBFA 1ZC3A 1GTSA 3K6SB 5FL7D 3EEFA 7REQB 3AY7A 5AW7A 3G85A 3LUKA 3AR3A 3D8SA 4IH9A 1Q1EA 2CV0A 3CNQS 3JWGA 3K4HA 2Q0XA 2ZRQA 3QFHA 5TB5A 3AMVA 1FYEA 2VDWA 1GU0A 3SYTA 4KPUB 2FETA 4JP1A 2XUAA 2IPLA 4BBZA 2E82A 1JVBA 1GLVA 3ZY4A 4GLJA 5LLDA 2V5AA 2XBLA 1WMDA 1Z82A 3PXDA 1BW9B 3OWXA 2MCFA 1AK1A 1P3Y1 1QLHA 2GEBA 2VNAA 2GILA 2GPYA 1E69A 4FD2A 4W8HA 1OJ7A 5KZMB 1XEXA 3I9V1 4MPTA 4R7GA 4LYGA 1Q22A 1CY4A 4OXIA 3AUSA 2VQSA 1P2VA 2CVPA 1D7AA 1BOFA 3EZXA 3KV1A 2RG1A 5FTNA 1UBGA 1DD1A 2YZ2A 4LPSA 4NYJQ 4NCIA 1E9DA 4Q93A 4EVSA 2HGZA 5BOSA 5C31A 2OG2A 3NWOA 4K9MA 1IY2A 3L0IB 4HGRA 1ML3A 3MTEA 2FFRA 4PQGA 4D9MA 1D2HA 1XCJA 3LY9A 4A2PA 4QOHA 1ATIA 1PEKE 4DNQA 4DR6B 3PIIA 4TKZA 2EFYA 3I04M 3MS2A 4K9DA 4WE3A 2LD4A 4M9RA 3ROGA 2CVOA 3WKAA 2OK8A 4EENA 5JCOA 1AMNA 1I7QB 4C2TA 2PX0A 2DZDA 3DZHA 4X85A 3CKYA 5IVIA 3O31A 3UJCA 3VC7A 5KPDA 2EP5A 4XPIA 4U6NA 2PHZA 3MC1A 3Q7RA 4TLBA 5EE3A 4AM8A 2JLYA 2N1MA 3OPQA 3Q98A 2QP9X 2Q5EA 2YN0A 1P81A 4XI9A 4OHZA 4DHWA 2BMJA 1JMVA 3P2YA 4QEZA 4UZSA 4FIDA 3V1YA 5FH9A 2NX2A 5IKXA 1PHRA 5EIHA 5DFAA 3R7AA 3CO0S 1CIPA 4IIGA 4R84A 3T7KA 3HUUA 4DT1B 3TECE 4QOGA 1HWYA 2Q46A 1QLWA 1T1IA 1WPRA 1Y1PA 5HJEA 2VBIA 3EXFB 4UXJA 2M6SA 4F4IA 3ANXA 1NPYA 3E5HA 1XMPA 2ZSHA 5CYFA 1EIZA 3UTCA 5KYUA 4UTNA 3CRW1 1RXIA 2YFQA 2XGGA 3A1VA 2Z4TA 3BSFA 1VB3A 2BLLA 1EB8A 3GHYA 3MJDA 3W2TA 4PLYA 4MWTA 1MO2A 4E0BA 2W6CX 1Y0BA 3AQ4A 4TX1A 3Q8MA 1E2IA 1JFRA 1SPBS 2PV7A 2VSXA 4GYWA 3CZRA 4OOFA 5ESXA 4I14A 3EXHA 1TVEA 3HNRA 2OV1A 1EWYA 1P3JA 1AURA 2X3YA 1QX3A 1JIIA 1OX4A 4LS3A 4M1EA 3TSOA 5B64A 4HV4A 1TK3A 3JQAB 4CIVA 2DF8A 3HB0A 1TCVA 1VTKA 2F3UA 2VDJA 3NP9A 4LY0A 4MS4A 4IGKA 4MUHA 3RIMA 2UZ3A 4FHCA 2H11A 2ONYA 1ORIA 3K1ZA 4F91B 5DBOA 4EIWA 3GEPA 1Z68A 1NM5C 3O0DA 1SH7A 3RTEA 3ZHQA 3OT4A 4JJ6A 2GRJA 4R2XA 1RHQA 4QPNA 2B8EA 4YWHA 5EJ8A 2OK7A 3O3NB 4FEEA 4HDNB 5AVJA 5HK8A 1R8SA 2I7VA 4B3JA 3DVLA 3S8MA 1B93A 4GG1A 4FE7A 3UWPA 5CB4B 1MR3F 1V6AA 4QXMA 3F78A 2CB9A 4QGAA 2NTYC 3IHWA 5GJCA 4YUYA 5INTA 4CMIA 4P84A 1NDHA 1ISSA 2R79A 4M0KA 1CJMA 3BMCA 3QGMA 1VKOA 2GEUA 4E3ZA 1YO6A 2PBZA 2Q0SA 4BX2A 4Q9KA 1U6KA 1NNEA 4C2AA 5H1YA 2IE8A 2JAPA 1XT6A 2PYDA 2HF2A 2Z5VA 2GYWA 3EZLA 1L7PA 3GGSA 4L74A 5CLLA 3FZEA 3R76A 3E9RA 3EOAI 3MSXA 4A15A 5BMVA 1MC4A 2P9BA 5BW6B 1PJTA 4DIFA 1VGQA 2O8CA 4URWR 2UXCB 2CSXA 2J6HA 4JNCA 1OAKA 5HFJA 3RQSA 1M1XB 3TQOA 5JFOA 2JHFA 4I4CA 3WC4A 4AY6A 1TTQB 4PQEA 6ABPA 2CWDA 2EKLA 4QTTB 3ROEA 3GA5A 1E3JA 4KR6A 1PW7A 3NT4A 3R44A 4B7ZA 1CD5A 2EV9A 1P9NA 5TMEA 5FUVA 4UVGA 1LF0A 2XMZA 2R6JA 3C3YA 5PGMA 2R1UA 1ESCA 1W5FA 4Y6LA 4AP5A 1BFDA 1PW5A 2E21A 1B7GO 4TYQA 1E3MA 4BTLA 3BXXA 3DHNA 3SYKA 4JV5B 3K70C 3O73A 2WSIA 3M5CA 1HLDA 1DQSA 3GFBA 3OQJA 4J8PA 1CIJA 4MVJG 4Z9FA 3RKUA 3TE6A 2GAJA 3TSCA 1LPNA 3C3KA 3RBZA 4L8WB 1M2KA 2I8AA 2JHGA 3QPWA 4TRMA 1REQA 1R0WA 3AR7A 3RGWS 3SSMA 3RTBA 1JEQA 4WN3A 1H69A 3VC3A 4CT4B 1WXHA 2YR0A 1DAMA 2F4NA 3IOBA 3N8KA 3QEAZ 4K28A 1WV3A 3CPSA 2HFJA 4UMDA 2JI9A 3E58A 1KJWA 5I5GA 1ESZA 2YYSA 3BWDD 5JXGA 2J0VA 3N75A 3ZE6A 4BQOA 5DBEX 3FYUA 2C7GA 2EBWA 3PEFA 3ICOA 1QIKA 3R0QA 4JP5A 3VKVA 1JA1A 4IIHA 3RAJA 4ESHA 1P60A 3L1KA 2GZ1A 2ZJ5A 5AVUA 1HQYE 1D6NA 4H77A 4K6MA 5TT1A 1JWBB 2PL9A 2PRJA 3W1VA 2AYXA 3GGCA 3K9NA 1XDZA 1NRXA 2QK4A 3NOVA 4C7KA 1P7ZA 1T5OA 3BMOA 5MN6A 3HCEA 1M2HA 4KFCA 4MS1A 2AZXA 3ZX5A 1R8JA 2X5NA 3NFRA 1GZ3A 4V0SA 3T3OA 4MLDA