The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
71
|
sequence length |
320
|
structure length |
296
|
Chain Sequence |
MWIIEAEGDILGSRILFPGTYIVGRNVSDDSSHIQVISSISRHARFTILTPSEDYFTGGPCEFEVDLDTFGTVNEVVGQNGDSYEDLIQLGCPFTINAYWRSMCIQFDNPEMLSQWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLTVIIDDSYLQYLSTVESVIEDASLMPDALECFNIINNDQFPSSPEDCINSLEGFSCAMLNTSSESHHLLELLGLRISTFMSLGDIDELISTDFVVLNNAVYDSEISFPEGIFCLTIEQLWIIIERNSRELISEIERLYA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
DNA repair and telomere maintenance protein nbs1
|
| publication title |
A supramodular FHA/BRCT-repeat architecture mediates Nbs1 adaptor function in response to DNA damage
pubmed doi rcsb |
| source organism |
Schizosaccharomyces pombe
|
| molecule tags |
Cell cycle
|
| total genus |
71
|
| structure length |
296
|
| sequence length |
320
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-06-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00498 | FHA | FHA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Tumour Suppressor Smad4 | Tumour Suppressor Smad4 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | BRCT domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
