5DHPA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 67
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhpA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhpA01
2BONA 3AFOA 1SUWA 1Y3IA 2I2CA 5DHRA 3T5PA 5DHSA 2I2FA 5EJIA 3VZBA 5DHPA 5DHUA 3V8MA 3V8PA 3V8NA 3V7WA 3V7UA 5DHQA 1YT5A 4L02A 2I2DA 2I1WA 2JGRA 2I29A 3V8RA 5EJHA 2P1RA 3PFNA 5EJGA 2I2BA 4V24A 2QVLA 3S40A 4WRRA 4WERA 1U0RA 5DHTA 2AN1A 3V8QA 4HAOA 1Y3HA 1U0TA 3V7YA 3V80A 2Q5FA 1Z0ZA 1Z0SA 1Z0UA 3VZDA 3VZCA 4DY6A 5EJFA 2QV7A 2I2AA
chains in the Genus database with same CATH superfamily
5FUQA 1UXJA 2X9VA 5CT9A 1P5RA 1I01A 3UV7A 1ND5A 1XWIA 3L49A 1L7DA 2NXWA 5IG2A 3RK1A 2MWMA 3UJBA 5TQ0B 3V5NA 5GTDA 1DCTA 1QSGA 2EEZA 3ROGA 3CG4A 4N01A 5AK5A 5I7RA 4NBWA 3AGQA 1UT6A 3E9EA 2DUMA 4MCJA 1TA4A 1WVMA 4HN4B 1MNAA 1N7JA 1DEOA 4K9DA 3PWSA 2CNNA 3NOVA 2IWRA 1XZFA 3TAHA 3NHBA 4DR7B 1ORTA 2QDXA 3D7KA 2JASA 4GZLA 621PA 1V9CA 4LC1A 1K9SA 1OOEA 2C4MA 2FG7C 2WTXA 3AHJA 3EGDB 3WFJA 3HKDA 3UMBA 2YQ4A 2FRVA 2P9FA 5JC1A 1VI5A 2GPJA 2QTGA 4OJQA 5JXWA 1DWOA 1TPZA 3GFGA 1SXJD 3A25A 3B5EA 4AUNA 3MCUA 2P9EA 2QSUA 3H8JA 3K09A 2B7BA 2K7FA 4CWAA 4W4TA 5EPOA 3IPRA 1JEQA 3NTVA 1V96A 4Q9HA 3V33A 4QPZA 4JB2A 4J03A 1GZDA 1SD5A 3NJ8A 2V3CC 3CNOA 5ALQA 4BQFA 4DR5B 5JCOA 3OD1A 4XIJA 3L92A 5E8RA 4NHOA 4ZPXA 1XWWA 4CM4B 3DVAB 3F3KA 3QF4A 2ATVA 4ZVOA 4D0LB 2OC9A 5JJKA 3BIJA 3ZWYA 2WAMA 1MG5A 3TLMA 1J4QA 5EKDA 2PD3A 1OH5A 3GDWA 4PEVA 1ZWLA 5K2MA 2XLBA 2LZ0A 1I4LD 1IFXA 2ZI9A 3LLUA 3KQUA 2D6FA 3CR7A 2G9UA 3C7AA 1RZ3A 5B36A 1D2RA 3UJAA 2YICA 2X0DA 1G8KA 2WB2A 3BREA 3K20A 1XCOA 5CIWA 2NPFA 1T0PA 1J99A 3CZ4A 4BBJA 3V42A 2QZ4A 4B3IA 1QIFA 1CB7A 1Z62A 3F78A 3MGBA 5FWDA 3Q41A 2GMWA 4URYR 4CTNA 3PYXA 1EIWA 4RIHA 5TQ2B 3A2LA 4HB0A 4L7VA 2OPHA 2I1LA 3K4HA 1EGQA 3LUBA 3NEPX 4CL8A 4Z2YA 1O97D 1ZOQA 4EARA 3MTGA 4PYKA 4TZKA 4IIJF 2J08A 5KQMA 3QXSA 1L9XA 2SNIE 3B78A 1AUVA 4FYIA 4CUJA 2HWWA 2WIKA 3EDYA 5J1TB 3ZEIA 3NT2A 2I2AA 5BN5B 1E2IA 1TQHA 1QDEA 2REBA 3IP6A 2IYZA 5F5LA 1E3DA 4ZI7B 3PPYA 1EK6A 2A7XA 3E84A 4AX8A 1M2VB 5K8VA 3ETDA 5DV9A 5FA8A 3EQZA 1A9ZA 3C7CB 1V6SA 1KF0A 2G8LA 2NT4A 3HVIA 5JJ5A 2A30A 4EMTA 4I08A 3ISTA 1E0SA 2G25A 2OPBA 4LE0A 5CMLA 2C8LA 2FXIA 3TS1A 1K6MA 1Y42X 5FTWA 4UHCA 2KPOA 4UEKA 5SYAA 1L3BA 2Z8YM 4RD2A 5TVKA 4CEHA 3WIDA 4OQ4A 4F6CA 4B3HA 1WP9A 4HEA1 2R2GA 3U4AA 2DPYA 1STOA 3AQ4A 3A4TA 4FE7A 4BO3A 1XZGA 2WUFA 4Q93A 3Q5EA 5T4FA 3EGDA 3FYUC 3REQB 3L5KA 3S1AA 3OZRA 2ZTHA 1MC1A 2PKQO 2VXOA 1MJHA 2W6JA 4NNPA 3DFMA 1FNBA 1R9NA 3K7EA 4WVLA 3EE6A 2BGNA 3AB7A 4AJOA 4DMLA 5DPMA 2F2TA 4J4HA 1L7PA 4CCWA 4YQFA 5EQJB 1EVYA 1JEYB 5F9HA 4PSUA 3TLXA 2EFGA 2XMQA 2PKYX 2EARA 2W43A 4QPCA 1F9EA 2IUEA 1YDGA 5GPBA 3KSUA 3I1IA 3TECE 4MO2A 3KALA 1IB0A 1Z8NA 4S2EA 1SNYA 4H1VA 4IJ5A 1ABEA 5E9AA 4HB4A 5IJAA 3PGJA 4O4JF 3SZMA 4B3GA 4EO4A 3DJFA 5AM5A 1GUBA 2ZW9A 1YCFA 5LYYA 1NN0A 2ZRCA 2YHAA 2AOXA 4RVCA 4O63O 3P32A 4G3XA 1V1RA 4KQ6A 3ZX5A 3B38A 1GAXA 2IUYA 2R4TA 1UBHS 1E2DA 3O84A 3VR3A 1RHRA 1D1PA 3B53X 3C0KA 1H3FA 3SMVA 5JUWA 3OU6A 2WU3A 2RHOA 3WICA 4DXHA 3CIOA 3L77A 1IXRC 1YC5A 2DBRA 2EBUA 5TQ2A 4HH1A 4QUAA 5JYDA 1VB3A 1J07A 2E3JA 3NBQA 2FG6C 2VP9A 4YCSA 1Y6ZA 3ABSB 1AJEA 5B4VA 3UH1A 1CY2A 3ZK8A 4DIUA 1CULC 2V58A 3PDWA 5JEJA 3NWOA 1QGUB 2R3SA 2LXNA 2OP1A 4UAVA 4CVNA 2QBYB 4DNPA 5ISMA 1J0BA 1QOZA 2O8VA 2OHVA 3BK2A 3IJRA 1HYBA 1SUSA 2AVNA 4LJ8A 3WR5A 2Z5VA 5BN5A 1AUOA 2XCSB 2UUOA 4P5EA 5FBVB 3CVWA 1XHEA 4OQMA 4ZI7A 1CQIB 1YU6A 2JIMA 2OXEA 5H9WA 3DH0A 1L7AA 4V0KA 4TV8B 3ENKA 4JI2B 3EAQA 4S05A 2EQAA 4MHTA 4ZFNA 3UYLA 1U63A 1K5HA 3BL5A 3ICWA 3K1TA 3KUUA 2AN4A 1IM8A 3WA7A 3EZNA 4KQIA 1J9GA 4WERA 1SKAA 2WWGA 1L9KA 3CLTC 1QO0A 5D7BA 2ZIVB 3C43A 1N9ZA 2VPQA 2YINC 4QYIB 3PZBA 4BHTA 3BK1A 1U90A 1V8OA 1M6WA 4I9HA 3OFJA 3SQOA 4ALMA 5CLHA 5I7EA 3UZUA 2PL3A 5CT5A 1AS3A 4JFAA 1Z36A 1KK2A 2Q1SA 2QX6A 3F96A 7YASA 4YT4A 4NPHA 4TMVA 3BWDD 4OGWA 3U3MA 3N0VA 3W04A 4ARZA 2GA9A 1IY9A 1V4NA 2CE7A 3BGIA 4JDUA 5DOVA 4PYJA 1DAGA 3FOBA 4GHWA 5A5GA 1UFOA 1GNPA 5F2EA 3IBFA 1A5TA 2C2MA 2ACWA 4E5UA 1H2WA 1R8JA 1F4VA 2ZIUB 1KHXA 2V8BA 2OHGA 3NATA 1T25A 3DM5A 2YTZA 1R6DA 2AN1A 2O0HA 2ACKA 3IDFA 2W2LD 3KXPA 3ZD8A 3ZDZB 4F86A 2BEVA 1GTRA 1SB9A 2EX1A 1TCCA 2AKYA 2YJ5A 3RJ5A 5G2OA 1A98A 4Z9BA 2BONA 3HTXA 4H0CA 1VCHA 4LYFA 3VR0A 4JR0A 3WQSB 4KDEA 1NP3A 3E18A 1H0HA 1U6KA 3EG9B 4I5GA 4Q4DA 4BYGA 5COAA 3IUPA 1C9MA 4MRRA 5IAKA 2B21A 5DHPA 3VZQA 4ZT2A 3ZC3A 4K9RA 2IEBA 4TT3A 1T24A 4DABA 2EP8A 2H9YA 2BEWA 3ZNQA 5K0ZA 2Q6IA 1JIVA 3WGVA 3RWOA 1ECLA 3UJHA 3UANA 4DMGA 3UAXA 3JALA 3GV0A 4B6SA 1DRKA 3NTQA 5I8ZA 2PMKA 4Q7QA 4OYHA 4CL2A 3T8YA 1Y89A 4DSUA 3FE2A 1VJ0A 3H11A 3GFTA 1W88B 2OTCA 3CZCA 3ZV6A 1X8LA 4LJ6A 1R6XA 2D13A 3KFLA 3OU7A 4KLZA 3OUNA 2Q29A 4Q47A 2PH5A 1E1NA 3AP3A 1M2OB 3DCYA 4KQHA 3TI7A 1QGUA 1M8FA 1N25A 3B9PA 1XTUA 4QICA 4XJVA 3RIYA 2C2YA 4JJ8A 1JR3A 3AR5A 4EG5A 4R0VA 2O2XA 5ARBA 4KKXB 2APJA 4ZMBA 2JZCA 3NTUA 4HWKA 1HL7A 3L8HA 4PBRA 1CQIA 4YJFB 1GXSB 5LA6A 1U5BB 1G9SA 2RB5A 2XNCA 2PZLA 4TV8A 4ZVRA 3SFTA 2HRBA 1V8DA 3ESXA 4RTOA 3K9CA 5FXMA 2Y3IA 3SAJA 4PHTA 1ANKA 2CZGA 4RPGA 5K3DA 3VSBA 4ZT5A 4W5NA 1L7QA 2CLKB 1K88A 4MUNA 3V8EA 3WRWA 2B4AA 3M6UA 2IVZA 3NXKA 2IU4A 4PFJA 2XA1A 2NVWA 4HMOA 3TRHA 2VUTA 2GD1O 1E2GA 3IVCA 3D81A 3KTDA 5F3DA 2VG8A 3FNEA 2H52A 5ENZA 1RBYA 2XHEA 1J0EA 3NALA 1E63A 3FY4A 3ELBA 1IY1A 1IG0A 1G2QA 1Q44A 4UPVA 1Y34E 2VRWA 4Y2JA 3OPVA 5CDFA 3K9LA 1XCMA 1SY7A 1R0LA 3HMKA 2ZWPA 3IRUA 5TT1A 1WHTB 3AZPA 3OZVA 4M49A 3I76A 4NYIQ 3FF4A 5EJAA 3PIDA 1JH9A 3F8TA 3PR3A 3ZXYA 2Q3DA 2WTMA 3G0HA 2YIMA 4XWTA 3ZCSA 2IYWA 4I36A 1SBZA 1GPJA 3GH3A 2AK3A 1IOWA 2WJYA 1U0GA 4OP3A 1ZGAA 2ZB2A 3VZDA 1U7WA 3P2OA 1YTLA 1T2AA 3IEUA 2QX7A 4EJ6A 1QP7A 1W5AA 2RFLA 4O59O 1R74A 5HJ2A 1WDWB 1W25A 4QJIA 4TRRA 4M1KA 4AZ0B 4ZVTA 4V1CI 3KSRA 1GILA 3A27A 2NZ2A 2Q9BA 3GLUA 2N75A 3HCRA 4DMUB 1DRJA 4KRFA 1EFCA 2QTLA 4B81A 1M2HA 1SWWA 4HNSA 1JG4A 4F1WA 2HPZA 1KFBB 2FR0A 3GLSA 4LPSA 1DIAA 2CEAA 4LJ5A 4MIKA 1JFRA 4C4YA 2REQB 4EFNA 1UXGA 1XZKA 2WEKA 3FGPA 3WLHA 4CW7A 4ZCMA 3UY4A 3ZI4A 4HTAA 4FJ0A 3SG0A 3Q6MA 5EXPA 2YV2A 3O91A 3SKXA 4F3RA 4BWGA 4CKWB 1OJLA 4W8OA 2YY6A 2P3QA 2XX3A 1RWOA 3PXAA 4KNVA 4UNPA 5AKXA 4PO3X 4M38A 3UJCA 3IQGX 5IFKA 2X7XA 2V8OA 5INTA 2PVCA 1LFAA 4JU8A 1M2OA 3JR3A 1MC8A 1MO5A 1J1UA 2V7PA 3I73A 4LY0A 3GPLA 3NUZA 1WP4A 5JAOA 1X70A 2ZKIA 2C77A 2V5VA 3BXXA 3PXUA 3R7FA 1GXSA 1KORA 2Y67A 3FZQA 4FZ5A 4PHFA 4U9IS 4X24A 4E5VA 4F0JA 4O1IA 3P9IA 3DGEC 3JZAA 4FFNA 2Z5LA 1MDBA 2W6JD 2F1KA 3T7SA 1VCIA 3CISA 3FGNA 2PRZA 3EVCA 3KJXA 4G07A 4HWPA 1J4OA 2UVQA 3IMKA 4XEHA 2DKOA 4U8HA 1JALA 2OCGA 2WWWA 3I5AA 1BX3A 1Y5NA 2O8FB 1Z7EA 1LNQA 2DGDA 4TQUS 5KNBA 2ZVJA 4OAPA 1B1CA 4AN0A 5AOVA 1KR2A 1E4OA 2W2NA 4B71A 5CB6A 2D0OB 5MF6A 3CVVA 2IPMA 3EFHA 4ZCLA 4DA8A 5ALTA 1CJMA 1TYZA 3MLEA 5AXDA 5KTSA 1GSIA 3GHYA 2Q99A 1T2FA 2EYQA 2WVJA 3L07A 1P9OA 3L8DA 3Q72A 3R77A 4M8KA 4QSMA 2BHNA 1L5KA 1Z18A 4WPGA 4MXDA 4BGIA 2ZYWX 3DFKA 4NICA 5ESRA 3VNRA 3LPDA 3MRXA 3W8NA 1A77A 4HGQA 3EUAA 3HDJA 1VHTA 4RA9A 4EKEA 1FDVA 2JEZA 3I0MA 4YP7A 1GYRA 3ZHCA 5AK4A 5HQ3B 2JLWA 1G20A 2DPGA 5DOZA 3B13B 1E0DA 1OFHA 3JZMA 1EU1A 2P9GA 4FDLA 1FFDA 3KWFA 4DUPA 2Y0BA 2WNSA 1GRVA 3CE9A 3SC3A 3NPMA 4KJXA 4LVUA 4BCBA 1USKA 1V5FA 2BTQA 1XAGA 4BNLA 2JKZA 4YECA 3J81k 2XQFA 3LKBA 2ZUFA 3EXG2 1DUSA 1NQWA 2HTEA 3CRZA 2WM8A 4OKIA 5E6UB 1QE5A 3T0GA 1F8GA 1CUDA 1VHJA 4PQEA 3V8PA 3CIFA 5CW2A 2ZT7A 4FINA 1L5GB 4RANA 1UDCA 3PEYA 1XELA 2QNIA 1NYLA 3DOEA 3GT7A 4TTVA 5EGNA 4TXJA 4AJHA 4L27A 5F1YA 1DFHA 1TF5A 4MYRA 4X54A 4C4PA 3GAAA 4F3YA 4YCDA 5A5FA 4LG1A 2REQA 4MIEA 5CJJA 1WAMA 3KJEA 3TLKA 4DANA 5FIUA 4B79A 3K0FA 2BDUA 3MWDA 4DHWA 3UGKA 4DIKA 1YQ9A 2YVLA 5I8PA 1T4MA 3GRCA 4ZCPA 3A4YA 5HTOA 1YBVA 4CKWA 1E5TA 4M89A 3A1TA 1GXCA 2WWVD 4EX6A 3TIGA 2AUTA 5JZ9A 4S3MA 1QF6A 3EBLA 4HRVA 3V7NA 1FRNA 1JNYA 3W3AD 2BFCA 3UJ9A 1EWQA 3HUFA 2DMRA 4I2VA 4Z4IA 4EVQA 3SNKA 1N1EA 3SR0A 4YJ2B 3EGIA 2GBLC 1ZJYA 3GDFA 4HWSA 2W0MA 5AHKA 4KVAA 4N5IX 2RGBA 5HA5A 1KYVA 1RYZA 2VXCA 5H82A 4MHOA 1BDIA 4BNJA 3BFKA 2HU5A 1WU8A 1L5MA 2HF9A 4C4TA 4PX9A 3WWOA 1SHKA 3CLRD 4PTLA 2ZANA 2QN1A 3V1TC 4C4SA 4DPKA 4Z49A 4K3VA 2NT3A 2ZWOA 1JIIA 1M9NA 3OESA 4RK6A 5IDXA 4EZBA 5EIXA 4KYTA 1JVSA 1LK7A 3K70B 4WN3A 2QXTA 3F4KA 1N3IA 1X92A 1KI7A 1Z5NA 4RIGA 5KHOC 5K8CA 2D1SA 1PRYA 4MWBA 4UJ5A 3KU4A 1B8VA 1U0FA 4TS1A 2BP7B 2XUKA 3ICCA 1N0IA 2I4LA 3SR4A 4ARSA 3OX1A 4KX3A 1MA3A 4RSHA 2Z5FA 2XR1A 3OOHA 1DTWA 2YWDA 4P81A 3TLCA 3QHQA 1U2RA 4TTPA 3PKJA 1KSFX 5HQ3A 1CRZA 1UC5B 2QYSA 4XCQA 1X86B 2WIFA 3FUUA 3KJNA 3Q8WA 3QNUA 2SKDA 3N8KA 4DS3A 2XXAB 3C39A 4KE8A 2JJ1D 4NCNA 4X60A 3AL3A 2YNMC 2O1SA 4BPRA 1ZK0A 1XZ8A 3CTMA 3IAS6 3UCFA 5FUBA 1SR8A 3FBGA 3N59A 5E6UA 3SX2A 1HQDA 1M1NB 1Y3CE 3RVOA 1PGQA 2C29D 3DFZA 1BWSA 4PGGA 1RQPA 1R8QA 1PNOA 3LO8A 3UHFA 2DHDA 1XMXA 2XYHA 3F3MA 1EWKA 3N0RA 2NO9A 2C5EA 3M7IA 3PIIA 1XNRB 4JLKA 4WADA 4WZBE 2PWZA 3TK1A 3JZFA 1G3QA 1ZJ6A 2ZDQA 1JR3D 2W6PA 5ALGA 4C6HA 1JJAA 2C7BA 1D0VA 3L3BA 3KT9A 5GMOA 1NVBA 3BWEA 4Q48A 3WHPA 3WLPA 2W98A 4HH3C 1OHHA 3GJSA 1TZKA 4BTVA 2UUCB 1T5BA 2O8EA 1OT3A 5I9LA 3RR2A 1EJBA 1W76A 2GCNA 2R6R1 2FETA 4JUDX 1AMOA 1QC5A 2JPDA 3H5LA 1I7QB 1I6KA 4BV3A 4DLLA 4FOTA 5DHUA 3ILSA 1B74A 4CUZA 2FEAA 2XBLA 3RQSA 3D5QA 4U7DA 1TD1A 1VDMA 1Y1QA 3DZHA 4YJ2A 3R0VA 1B3BA 1G42A 2GILA 5ALLA 3HPQA 3PQ8A 4UTPA 2IYOA 3RCBA 4D92A 4DIDA 4E31A 2H7VA 4EELA 1ADYA 1A8HA 1DC4A 2RHJA 3H4TA 1HX7A 4O4LF 2JFQA 2FSVC 1XQYA 3R6LA 2FUKA 4WUVA 3D8SA 2IRWA 5K51A 5KNDH 5FLXA 1AXGA 5JSHA 2YCLA 4FSHA 3GEGA 3NIWA 4F1JA 4B2PA 5JQGB 4LXHA 1G63A 2VNKA 4LVOA 3TBHA 1QQBA 3OMWA 1VKRA 4KKVA 1SVNA 2G5PA 2PRJA 2HXYA 3KE8A 1IZ0A 2EVWX 3PEVA 2C03A 2EFCB 1UKVY 3SQNA 2WTEA 2BFEA 2GRJA 2H00A 1PEKE 1T26A 3FFAA 4EZEA 5K8TA 4RYDA 1ZXBA 2BP7A 1ODFA 1OA0A 2FXVA 4GLLA 3LOPA 1KK1A 3CBGA 2GAIA 2NZJA 2PUGA 2WPDA 2ZAIA 5BSMA 4C0HA 3KR9A 4CFYA 4RJIA 2C2GA 1IOZA 2CB0A 2FG5A 2ONJA 1CZKA 1RHQA 3W6ZA 3DEIA 1O9HA 2J31A 2LWIA 5LQUA 3MJFA 1RSZA 5BW4A 5CA0B 2XXAA 2GHTA 2ID4A 1T91A 3EA0A 3QVTA 2X5OA 3G02A 4K9KA 3UQZA 3C16C 4EY8A 4QJ5A 4QODA 2I65A 4L6AA 5CDTA 4N41A 3FCCA 1T9AA 2GBGA 1YL6A 1T2CA 1KI2A 1YQUA 4ZQCB 1W29A 4RACA 1M1NA 4YI5A 1ZU5A 4UUNA 5EWLA 4AFNA 5K0BA 1ISIA 1UZUA 5BURA 1F0KA 3HA7A 1Z5OA 4BO5A 1LLQA 1T8PA 3B7PA 5B6IA 2VQEB 2IHBA 2I0FA 4GZ5A 4IH1A 2XAUA 3D6AA 5HJEA 4G5SA 2A0FA 4FQ8A 2ENWA 4H18A 2WHRA 3RVBA 1E8DA 4ZV7A 3LPMA 3OKCA 2GZ1A 2V7QA 3INGA 4QDUA 5EEHA 1B6RA 4MUEA 3W5IA 5JSQA 5CDFE 4UARA 1NJFA 1G5QA 1JLLB 5HE8A 1SU8A 4A1OA 4YJKA 3K9GA 2OQRA 5PGMA 3UMCA 3GVPA 1QFMA 4KUEA 2H51A 3SQXA 1NRWA 5C34B 4S12A 3RVLA 4ZJUA 4J0IA 2OP0A 5KNBD 2WWYA 1CUZA 2OWDA 1PZNA 1A82A 4E03A 1EVLA 5EPEA 1FFEA 2JI7A 2G09A 2HDHA 3AV0B 1Z7BA 1KHTA 2VBFA 2ZWAA 4JYPA 1GITA 3LOQA 1L5ZA 4C7OB 2G9ZA 3LDFA 4Z0HO 4BMVA 4R9UC 4QVKA 3H8WA 3WNBA 4BO0A 1JSZA 1NJSA 1HL3A 2MSDB 1MKYA 4YDHB 5CCDA 3THWB 3THYB 4PAWA 4DLKA 3L1VA 5ESWA 2MCFA 4PZLA 2P79A 2QUIA 3PTLA 3USCS 4HQNA 4GVXA 3P4UA 1HETA 1MX3A 4ES6A 1U2QA 3F1KA 5EMLA 1N4DA 3IERA 4P0TA 4RLFA 2G80A 2IYNA 5BYJA 5JALA 1UP4A 2YN0A 1E66A 3F73A 1YR9A 2AE1A 1ZUNB 4X3OA 3ELSA 4C0SA 2AFIB 5HKKD 3LX4A 1BWQA 2PUTA 4QULA 1ZH6A 2A5JA 1ZXLA 5EHIA 4M0EA 3A6JA 4NOKA 1LJLA 1H2RS 1W9MA 1BQ3A 1UMKA 2FZKA 1JG7A 1K8QA 2QR5A 4KXQA 1AK1A 4MS1A 4K86A 4NYMR 1F2TA 4PCVA 4GOKA 3LFHA 2C9MA 3QX9A 1MB2A 2IZ7A 1MNQA 4P36A 4QQ8A 4BBAA 2ZE8A 3NANA 2DG2A 5KJEA 3RNOA 4N6GA 5J23A 1NAIA 3EEIA 3IS3A 3OZCA 4GQAA 5F7OA 1BDMA 2CZQA 1OVGA 5CA0A 3TSYA 4WX2B 4NE9A 2VJNA 3OIVA 2BF4A 4QPDA 4H1UA 3G9TA 1QQ5A 2WILA 2YJTD 3TQOA 4E5SA 5KTPA 3T7CA 1SCIA 3B9QA 3O8NA 4G1UC 4XDHA 3VTFA 1LNZA 3E6AA 3QLEA 1H5NA 4BE4A 4PXSA 4KVGA 3F7TA 1PG0A 3GRYA 1WLYA 2PG3A 3JQ7B 4GMXA 4PONA 4TQAA 4AWAA 2XGOA 3RVJA 2G83A 2NVBA 2R751 1OGYA 1O94C 2P27A 5JYEA 1KC1A 1WQ4A 3BIXA 1P1BA 3M6MD 4RTLA 5AJTA 4RNCA 4RKQA 1GAQA 3A77A 1Z22A 4BZWA 1E6EA 1X3SA 2P41A 2GN4A 1KJYA 1XZQA 3GJ5A 2CB9A 2QU7A 3RVMA 5B6JA 1SBHA 3IOMA 1Z74A 2MOKA 1UT5A 2AGVA 3PHJA 1JLLA 1W1UA 3W2TA 4CR6A 3FF1A 3S6JA 1HSOA 3CKKA 4DDHA 2BJHA 3DAFA 1U8TA 1E2EA 2Q46A 3VTZA 1VGVA 1G20E 4OL0A 1CIVA 3I9KA 1ZNWA 3H16A 4WCDA 2OFFA 5HGXA 1I24A 2X9NA 1TC1A 4PZDA 1W36B 2QRGA 4YRRA 5DM2A 4OJNA 2C2KA 3I9V6 4U0JA 2Y05A 4ZQFA 2IXGA 1JKIA 3H2IA 4JC8A 2Q5OA 3U9SA 4ESHA 5F2OA 5B1IA 4L0CA 4MSUA 1IEWA 2QMUA 4YCBA 1AB6A 5JRDS 4TLEA 2V7TA 2O7NA 3HR4A 1DNPA 2ZOSA 1UCFA 1ZM4A 2AR7A 2J41A 3Q98A 4LS3A 1GGEA 4AU1A 2VZLA 4DIEA 8ABPA 1J2YA 4XCVA 2RI0A 4R84A 2KX7A 2BOVA 2RAVA 5G0WA 4O3FA 1Q0LA 1RACA 4BB5A 1ESZA 3CLSD 3HB9A 2PAAA 2DXIA 3WMEA 1W0KA 2XT6A 2UU9B 5H5JA 1ZUNA 3L0YA 4YA6A 2AFIA 2NUTB 1XYYA 4L3VA 4LXTA 3N2ZB 4HGRA 5IMSA 4HLDA 1P33A 3OF2A 4W9MC 3LH5A 4JI4B 4NFSA 2WFMA 4P0PB 4II3A 2HXGA 1BN6A 3TEFA 1IQRA 1OXUA 2EDAA 3AKDA 3E5RA 4DCGA 3S81A 1ZN9A 1R9GA 1J0AA 5DIZA 4GMGA 1BS1A 3D43A 1NU8A 2A9PA 2BGGA 4JCCA 4CV0A 4ND3A 3LPCA 3DD5A 2P9BA 3LT5A 1X1DA 4FLFA 2PXCA 4L02A 4OXQA 1OJ7A 3D3WB 3HHPA 5EINA 4CM5A 2ETXA 2FNAA 4RLSA 5JY1A 1PZEA 1ZMTA 4ZI7F 4K28A 3EIUA 3KPWA 1GGKA 3WC4A 2NX2A 4D4MA 2YZKA 5KWVA 1DX6A 1NFQA 4TYQA 1YQXA 4NFLA 3U61B 2A5FA 1O0SA 3ILHA 2QM8A 5E9QA 4HAXA 4ND8A 1FSZA 1I3NA 2AYZA 2ASVA 3HPRA 3KK0A 2OFPA 3RC9A 1VL0A 2H85A 3KKNA 4GSKA 3U44B 4JXXA 3FHLA 1FK8A 2QRPA 3GY0A 721PA 3UMZA 7ADHA 4N0PA 2ZJ0A 3CPJB 1Y6GA 1GSAA 4GECA 4OIMA 4M37A 1EWYA 2RH8A 3T3MB 1FFAA 1S8OA 4HL6A 1X6VA 1U2DC 1C3OB 4NBUA 3NDIA 5IC5A 3DSHA 2A78A 3M5PA 4B8ZA 3T38A 2IGBA 5IDYA 4BNNA 1BX1A 5TS3A 1OH8A 2AS0A 5DN9A 5L3RA 3NORA 4L07A 3WYDA 2RDMA 2IU0A 4TKZA 3RE1A 2H07A 4LE2A 3T7JA 1YZLA 2GLTA 4JUIA 4P7KA 4OI0A 1KH1A 3G8DA 3E7WA 4QDXA 5H16A 5DKFA 4ZIRA 2PGNA 4BZPA 3QBTA 3D64A 3FGOA 4H16A 5G4KB 1OBCA 3M3PA 1OC2A 4IHAA 5CGQB 3EZYA 1HLFA 5JG7A 4BO1A 4NU6A 1DC8A 3QOYA 1WBJB 3GZ4A 4G56A 4JYCA 1EVJA 3KZXA 4Y0VA 4L9AA 1NBME 3LIIA 4MWOA 4ZXPA 4EGQA 1MJSA 1A88A 1DJLA 3TE6A 2QD1A 2YDYA 2ZUVA 3RYFB 2B9VA 4CV2A 3BJIC 2GF2A 1DRWA 2JCXA 3VH3A 3JRNA 2IX3A 3AY6A 5EXTA 1RXSA 2YZ7A 3FX2A 4LRTB 4YCLA 1KDYA 1M0WA 2QUJA 2QMQA 2CXNA 4PTZA 3ZHBA 3ZCQA 2EKBA 3N6XA 1C3LA 3RKRA 4CMHA 3B9RA 5C4MA 1V9LA 3S2SA 5ICGA 2UXCB 1PHPA 3GUCA 2VZ9A 3SM9A 4YUAA 2RC6A 1FYWA 2WKWA 2UZAA 3N3BC 2XWJI 3ADOA 1QBKC 2JARA 2P11A 1VMEA 5LVAA 4MVXA 4PLCA 1J2UA 4DXAA 4F3KA 4MYSA 2XKKA 2WICA 5CTAA 1HEUA 4US1R 5CT4A 1AHNA 2N3ZA 4AC9A 2ZYUX 1ZBQA 3NEYA 4C0XA 3WBFA 3K72B 1N5LA 1PWHA 1ZLXA 3D3WA 3DWGA 4M8LA 3GCXA 4MW1A 4QQRA 4ZC1A 1NKSA 2HDOA 1NXPA 4DV4B 2HQRA 3VU9A 1UXOA 1DEVA 5LA6F 4HUTA 2Z2XA 3ND5A 2Y1WA 3WKBA 3RU9A 2X13A 2PZKA 4TV8F 4YPVA 4DILA 1ODLA 3KTFA 1Z5ZA 3OBIA 1T8SA 3BB4A 1A8UA 1PR4A 1PR9A 1PEDA 3M34A 5I7OA 2I6FA 3P2EA 3PA6A 1A95A 2H06A 4I66A 4HV4A 9GPBA 5KU7A 3ASUA 5EIBD 3I8SA 5T8KA 3ZE6A 2BHSA 3L8YA 4IDAA 4DM3A 3CUWA 2JLUA 1B6SA 3VXKA 3TTSA 1FMFA 3SK0A 3FNHA 4HLCA 2JJQA 5BNZA 1NNSA 3LKDA 4H31A 5FEMA 4BX8A 2FUCA 5AH0A 3A28A 2VDJA 4U6QA 1VGQA 4NJEB 1HE8B 1JJ7A 1QGAA 2VCHA 2YV3A 3DWFA 2GN9A 2OBYA 1X1RA 4LTMA 5ALZA 4DCNA 5I47A 4Q1VA 3HJHA 1C3OA 3NHSA 2QAGA 2CE2X 4G6ZA 2ZCUA 2GS9A 4CV3A 3MT9A 1E2PA 1CU1A 3GUZA 3SBXA 2R8OA 3WHIA 1R16A 1TYBE 2FW6A 2FYTA 1FUUA 3QLVA 3RKSA 2LKDA 1OBVA 1P45A 5EHQA 2KI5A 2RE8A 2X15A 2JIDA 4XPIB 1VTKA 2GCPA 1QHXA 1DKQA 1LS6A 1Y7IA 1GGNA 4G9EA 4K03A 1L5VA 4BNKA 4IWYA 1Z34A 1U8ZA 1ZD4A 3HVHA 3L0CA 2JHCA 1RWNA 4JLBA 4OQLA 5G4KA 2LCIA 1XLUA 4Y18A 3TQQA 4E7PA 1BE6A 4KPGA 1UBFA 3RSCA 4ZYVA 2DQZA 4PAGA 1VSQA 3B8EA 3E7XA 4CLOA 1OTHA 1R15A 3KYCB 4KQMA 3D2BA 5K3SA 2GN0A 2OT3B 2SBTA 1VJRA 1YKGA 2PS9A 3HJRA 4ESVA 4TROA 3CNNA 4YYZA 4QJ3A 3LA6A 1KSGA 2AMLA 3MTIA 2V0GA 4EUEA 1G0NA 1PGPA 5D01A 3OETA 1FYVA 3SJCA 3NQ41 1Z15A 4ZI3A 4AO7A 2EDCA 5IKEA 5HSGA 4EGAA 3IT2A 1UJ5A 1EGMB 3BB3A 3K0EA 4TXNA 4X92A 3BXEA 1E3TA 1OKKA 3DTYA 3S44A 1BMDA 3IQEA 3PK0A 3JASA 1XCLA 1GQQA 3F46A 2GB4A 4RVHA 3UNMA 1Q21A 1T9DA 4MMZB 3TL6A 5H3CA 4LHSA 5C8YB 1EUYA 2PZFA 2QTMA 4ZYTA 1YZNA 3U2QA 1M2FA 3IHTA 5JWOA 3JV7A 2GNOA 3RAEC 4KODA 2I8LA 1EVQA 2VH1A 1A69A 1PS0A 4AP6A 1D6SA 1DBWA 4UPDA 4HDKB 5DMHA 2ZQZA 3P26A 1ISRA 2XNDA 1NNI1 2O2HA 5C46F 3B52X 4IJWA 3DE0X 4LCEA 3G79A 1J8YF 2N9UA 4FFBB 4KI0A 1CHDA 4DM7A 3NXSA 4CPDA 1ID1A 1KH2A 1ZN2A 2FOXA 3GEIA 3HSSA 4BATA 4F11A 3V1UA 3O2JA 4EYEA 5HIKA 2AUMA 1PO7A 3OHSX 1TT5B 3EWNA 4ID9A 1Z0DA 2Y4OA 4XJTA 1D4AA 1WG8A 5DBGA 2GZRA 4G0ZA 4MZDA 3EF3A 2V4MA 5ALDA 2YOHA 3TPZA 4RBNA 4KPEC 3BERA 3BT7A 2DY1A 4CIWA 4AY5A 1BHJA 4BP9A 3FVVA 2PRYA 4ZTUB 1QYRA 1UDRA 2C5BA 3O5AA 4MDHA 4F4DA 2ATEA 2R6JA 1ENOA 1JH8A 4K46A 2VJKA 4KFSA 4NJEA 4UATA 3SEZA 4QASA 1UBLS 3EQ6A 1BXRB 1K9VF 5L6MB 1OXKB 1C80A 1DC5A 4XWYA 4JI8B 4EG8A 4ETWA 2EW8A 2WF7A 1A2KC 3V2IA 3OZXA 4KO2S 2VDOB 5HCUA 2ZUSA 3JAWB 1U0OC 3HA2A 3ZOKA 2XSZA 4US2R 4X20A 1HBJA 1P6QA 1OGIA 5IXYA 3DMYA 1HFKA 3JZIA 1Q22A 4D74A 3DL0A 4MAMA 3EW9A 1PJTA 3JYOA 4DV3B 1B76A 2HZ7A 2VYVD 2J48A 3K3PA 3K35A 4YALA 4ENWA 2XGSA 4BFYA 2ISCA 3LQKA 3TW8B 4FW8A 5DCYA 5EE3A 5E3JA 1G8GA 4L74A 5CX4A 2A0XA 3ZI7A 3OZGA 1VPLA 2GTHA 1AKNA 2PH1A 3ED5A 5E2IA 4XEUA 1BW9A 4X41A 1NMSA 3LT4A 4NAUA 1YQWA 4EOGA 4QJ4A 4RTJA 2TS1A 1YR1A 1NBWB 4NULA 5E4TA 4AM8A 5K0TA 1Y6FA 3P9XA 2WU8A 3A1NA 3HM2A 3PUZA 4IV8A 5AIAA 3ELWA 1NVGA 4HEQA 2HCFA 5AVXA 4H3SA 2ZIXB 1P5HA 1ECCA 1RWMA 1T4DA 2QZPA 3O93A 4HFJA 4I8DA 3NM5A 3RHFA 5EJ8A 4FNOA 1MVOA 4GNRA 1ULSA 4D97A 3G85A 3W90A 2PQ2A 3VR6A 1JN0A 2FEKA 4GVPA 3TOXA 1CF9A 1MX5A 3KWJA 5C8YA 2W58A 2PX2A 3T54A 2Q7DA 3VYWA 1Z7GA 3EXHB 3VPYA 1U5CA 1SD2A 3HGMA 3CH6A 2X8WA 3SIRA 1M6VB 1I2ZA 2P35A 1KZGB 1SOMA 2AB0A 3RAFC 1WZEA 4P7JA 1G6KA 3FSJX 2BM0A 4HDKA 1TYAE 1FS5A 1KKMA 3DUWA 4ALIA 1ZMOA 1DPGA 3CUTA 1O08A 1NRJB 1KTVA 2J1LA 3EUEA 3QXGA 3AKEA 3R5HA 3ZDRA 5CP8A 4A6EA 5FO1A 2KSQA 2JC3A 1RYNA 4FB4A 3LT0A 1CETA 1E2BA 2RSLA 1TT5A 3FPAA 2YJZA 3LBHA 4XUCA 5JE8A 2FPGB 1ZUWA 1IIRA 2BV3A 3OZFA 4YAUA 3BL6A 1W36D 3GBSA 1Q1AA 3E27A 3Q85A 3RUEA 1WUKS 5JADA 4RE5A 5F1OA 1D0SA 4FDMA 2J3QA 4G0UA 4GYKA 3L05A 2OZPA 2J9XB 1WPXA 1ADFA 1WU7A 5DYGA 1ZM2A 2TMKA 5BOVA 2FUEA 1BXRA 3KKOA 2H1VA 4D9KA 3QLVC 3IV6A 1EYZA 4ATNA 1ZN8A 1TTQB 5BVGA 3QWBA 1TI7A 2IS4A 3VO1A 3L4BC 1LTQA 3JAWA 5AK0A 4D02A 1Q7GA 5COBA 3OIUA 1L5HB 2HMVA 3DEFA 3ZTWA 5EQTA 5ED4A 4LV8B 3T3GA 1LLDA 1ZINA 4DQVA 2DSTA 1P1IA 1T1EA 2YIDA 3AF4A 4B6GA 4KQCA 2CFSA 4WNIA 3W4KA 3HUTA 2AJDA 1E9RA 1P18A 1M34B 3ZWBA 4EO7A 2ZTLA 1JQLB 1AKUA 2ZRDA 3IAHA 2ZIWB 2CDAA 3CZRA 3G1TA 4DQKA 2IH5A 2VDPB 1CHNA 3HKCA 4I4IA 1VXRA 2O3QA 4AK9A 5AVOA 3OX2A 3AUSA 4KAFA 2E4XA 4FILA 1KARA 1G8YA 1AKTA 2CVZA 3DF7A 3FNGA 4M8IA 4C2TA 5FTMA 1CXZA 5EZ6B 3AXSA 3HFSA 3AVUA 1GL6A 1KY4A 4QOIA 2EJBA 3AWIA 3EGXB 2WJHA 2X8BA 1DJOA 3PU6A 3ZWKA 2J07A 4CRWB 3FMVA 4ZMSA 5L3QB 1RFLA 3M83A 1W94A 3I04M 4G89A 1JLRA 1N57A 1RCTE 2ZIXA 3LFUA 4CMEC 3HUDA 4BMSA 4TSKA 4WESB 2A33A 4XGRA 3T35A 1KU0A 3DXFA 5H70A 5BWLA 5ITZB 3BVPA 4AECA 3N86A 5EEGA 2VNAA 1F3LA 2BKLA 4Y9UA 1P3JA 4JAVC 1OYOA 3ZVMA 1YRAA 2KLHA 2WQZA 2VP4A 4YLGA 3EXHA 2PRSA 1H66A 2A5DA 4WCVA 4X63A 4MKFA 1ZM9A 2IP1A 2RK6A 2Y1KA 3A6KA 4Q6WA 4YJ2F 2OC4A 3GIWA 4IIFA 4MR8B 4P83A 4YO7A 3BH0A 5A3QA 1DQRA 1JUDA 2HJHA 2PD4A 3E05A 4GI2A 3WQHA 1AQ6A 3VA4A 5I4CA 4BAGA 4TYPA 1Q15A 4ITVA 3LDAA 3RS3A 2VUHB 2XTMA 4UUBA 1PR1A 2RHLA 3HL4A 3L84A 4XD7A 2Q1YA 3RW9A 3SLKA 1EX9A 3GLHA 1M83A 2X6RA 3WSVA 1MIHA 4QREA 6LDHA 1E7QA 1C9YA 2A9JA 1CC1S 2FSFA 3IP7A 4WZAA 1YT5A 3I52A 3IOCA 4IWNA 2GRAA 2BFPA 4JXJA 4MMXB 5BR1A 1YVUA 5KVSA 1KJNA 3DDWA 4AG5A 4D4HA 4JXZA 5D85A 5TE9A 4BTEA 3QTTA 3HEAA 1F7UA 1H42A 1I5RA 1LPAB 1SKYB 3X44A 1QRAA 2OVFA 4L75A 5LZ2A 3SC2B 1R00A 4RZ3A 4TMWA 1Z8DA 3OPXA 1YS9A 3DG9A 2AQHA 2HSDA 4LJAA 3U1TA 2IXBA 4NCXA 4ANFA 2JHPA 2FDXA 4FDVA 2O8CB 4M8NE 3M6LA 1FLAA 2DZDA 1J23A 1YUNA 3W7AA 4IIHA 4DIBA 1R5BA 4UTNA 2NYAA 2OD9A 2ADFA 1J6UA 1D4OA 3IQIX 3N2IA 2QN3A 2PX4A 3MCAA 4M88A 4I55B 5CDSA 5L3VA 3H6HA 4YRAA 1T5TA 4JQCA 4UTOA 1UBGA 2V96A 5J1SB 3U37A 3UJ3X 5IT0A 1YJXA 1SXJC 3A6ZA 3FKSD 3VHLB 5JJBA 5KYGA 3WZ2A 1M34A 4YCJA 2YIJA 2G07A 2P6NA 3OLXA 5COQA 1EXVA 4J0FA 4EI8A 4FYJA 3DF9A 3G9UA 5BR4A 5KTRA 1W34A 2WAYA 2RKWA 1M10A 3BHJA 5L7WA 1TKBA 3MTDA 3WBBA 1O0CA 4WA7A 3TLJA 1FQKA 4GO1A 2W6ZA 1LK5A 4KE7A 4OJYA 4JKIA 2OM2A 4I4LA 4QNMA 3WI7A 2NSHA 1LJ8A 4O2BB 3WK6A 1IHXA 4N82A 3QPWA 4E5YA 1P4HA 1JSLA 2QTFA 4EVSA 3BE6A 3ECCA 5L3QA 3LPLA 3VGJA 4A0HA 4GT1A 4EYGA 5REQB 1YD7A 2R1VB 4BJHB 4AJKA 1EFAA 3U7IA 4OB7A 2VFAA 1GCIA 4WESA 3X1WA 1TRKA 2ZSIA 4I5DA 1P0PA 3OUTA 4HQLA 2CJFA 3RU3A 1SQ6A 2R68A 3W8EA 3R7WB 5BSTA 3I92A 2FZEA 3QH4A 3W3ZB 5DYNA 1BJTA 3RYTC 3B6IA 2O5VA 5FI5A 4MV9A 4MWEA 4A8HA 5ALMA 5BSFA 3QJYA 5LCXA 2IY8A 2Z3ZA 3Q12A 5ANRB 2ZR9A 1CKEA 1A9TA 2O4CA 1JRLA 4OEHA 2J3MA 2P91A 3DA8A 4UZFA 1ZGHA 1Z4OA 1QRDA 4QQNA 3FTEA 3BQMB 3ROTA 4YV2A 5JDCA 3BTOA 1I6MA 1SFRA 4A36A 2XQGA 2NXEA 3PX2A 3T95A 2EGUA 3QKWA 5JT1A 2KKLA 1OAOC 2H48A 1WRBA 3AOEC 3HGQA 3OEHA 4B4UA 2VPPA 3EDCA 3HU3A 4MO9A 2XSZD 3H8SA 4YV7A 1DXQA 4A5SA 4YV1A 3K0BA 1WDKA 3ONNA 3ONFA 4GLOA 1TQ4A 1EDOA 1XJ0A 1CLUA 3I9LA 4JBIA 1I1NA 3NHUA 3PV0A 2CHVA 2IKQA 1QUFA 4FWIB 4II7A 2ZZMA 3GFBA 5G3ZA 1OFTA 3OQOA 2FMKA 4A91A 1FNCA 3H2ZA 1I9GA 1V8PA 2V7GA 3B5JA 1Q0SA 3KQMA 3WZMA 2J46A 3ZGOA 3LP8A 4BNIA 2XHZA 1BC5A 2XMPA 1RPNA 3IR7A 5FA6A 4CIAA 2FQQA 3OCJA 2GF9A 4H7IA 3EXIB 5P8WA 1EE2A 1K7YA 1E9AA 2MSLA 4I55A 4NEHB 2ZSUA 4YRLA 1KJ8A 1YR8A 3TUIC 2DH5A 3OLVA 3PNKA 2NSLA 3EGVA 4XE5A 3ZWNA 5CA0F 1KXZA 1Z8HA 2W90A 3OQVA 4CT4B 3R3SA 1VCMA 4QGSA 4E21A 4B3MB 3FAKA 1NI3A 2UVDA 2Z08A 1KBQA 1PR3A 2OESA 2ZKLA 1ZOSA 1MZKA 3OMLA 1CZLA 2AEJA 5EIFA 4ZYLA 4GLBA 1QUEA 3ZHQA 1S2MA 1Z33A 5AWFC 3VR6D 4BRWA 2AW3A 1JXOA 2RGNA 1GY8A 3JD4A 3F98A 1XVLA 2CK3A 1YMUA 2JIQA 5DT9A 2XWSA 1LRJA 4O2BA 4CNQA 1UQRA 3RROA 4EFDA 4OHXA 1GHTA 5IFLA 2GN1A 2A1UB 4KPUB 5FUWA 5IP5A 1C1HA 1RBQA 4P5DA 5FUYA 4DMMA 1JHXA 1XI2A 3FOAA 3VISA 4O8ZA 3RWBA 1QWOA 3H3JA 4YMWA 3TTVA 2JGLA 1FSFA 2R1VA 2O1WA 5CM2Z 4EEZA 1T34A 3BHMA 3O8LA 1XCJA 3MBKA 3PNBA 4NY1A 2OGWA 3STWA 4Z7JA 4X65B 3PEWA 1R9JA 3SWWA 1QVAA 3V4LA 5C5EA 3R7WA 4JYMA 1D2NA 4M76B 4EGSA 3KEMA 1X7GA 5DWQA 3H7AA 2GM3A 4ENRA 2EQ5A 4JBYA 4L5IA 4Z1MD 3NRJA 1J00A 1FSSA 4F5ZA 3VPCA 4ERNA 2DYKA 3EDMA 1OV6A 3HXPA 2J0UB 3PYLA 4B74A 5HQTA 1KEUA 3EJ6A 1R4MB 3O9VA 4O25A 3ORSA 4NZOA 3BIWA 4PPYA 2CMKA 3V8VA 3OSZA 1C81A 2C04A 3KJFA 1IBLB 4LJYA 5EQFA 4E0BA 5TF0A 1MEOA 1SXJE 1OWLA 1VL1A 1ZHFA 2B8JA 2FZVA 1RC1A 2QRVB 3ENVA 2DY0A 4U7JA 1I4TD 2IOQA 1BU8A 1MZVA 2JAWA 2WE8A 1Z12A 1HRKA 1VE6A 5EP3A 5CG2A 2LC1A 3R3HA 3OQ1A 1USGA 1XV5A 3GVCA 3IPXA 4Z3KA 5ARCA 2Y6VA 3UJDA 1S9DA 2QTAA 2IYLD 4W99A 3C8HA 1IN8A 1K8XB 1TVKB 3KJZA 2DTXA 2OZKA 2QRJA 1CR4A 1G41A 1JR4A 5B1HA 4BZZA 4WD3A 3HXMA 3IR5A 3QE9Y 1DINA 1ZW6A 3KEGA 4OQEA 2B2XA 3ABIA 3AR3A 3LCJA 1MO4A 2B25A 2CCGA 3R3WA 4WINA 5E9JA 5FPTA 1QF7A 5F76A 3HVKA 3KPJA 1QJ4A 5TPWA 5LDDC 1RXIA 2G0AA 5L45A 4QOEA 3DZ8A 3EXIA 3EWIA 2ZBDA 3WXBA 5FWXB 3BXZA 4QYTA 4EY4A 1EI9A 1H2HA 4DMCA 1M5UA 5B1DA 1GU7A 3OOYA 3TAUA 4RVUA 1RXCA 2EFEB 4I4NA 4CKBB 3NVAA 1R6TA 2Q3JA 4LIPD 3T1QA 1HFJA 2OBNA 2QL6A 3LUJA 4B3DA 2O6HA 3IMFA 4CG1A 1X1SA 3WB9A 1KRXA 4B84A 3DBHA 1H4TA 2XCLA 3GWZA 3IB3A 3KYDB 4BNGA 2JLAA 3MJHA 1RFGE 1OTXA 4M0MA 3EIFA 3WRXA 1CEYA 1MRZA 4MI9A 4P31A 3GLFA 1RQ7A 1Z88A 2A1UA 2WJAA 4KPUA 2VSYA 2QTVA 4UMEA 2A9OA 1FX0B 2JVJA 4RXMA 1SD1A 3GJ0A 4URXR 3SF8B 3PDUA 3W9SA 4N48A 4H9GA 1DP4A 1QTIA 2MINB 3DVQX 3ZWOA 2GPAA 4MUIA 4QAQA 2B98A 3G8AA 1XC7A 1IBMB 1PT5A 1U81A 4FHZA 4Q4CA 1OW3B 2VH2A 2Q3LA 1XEFA 5JR3A 1NU6A 5BWOA 3DQZA 3D1LA 3SZLA 4H1TA 1AGRA 2V5AA 6AT1A 1I4EB 5E3HA 3RSHA 5ERYA 5EJ5A 5M2QA 4AS2A 1HZZC 3DAOA 1ESMA 4Q3AA 4X64B 4R7ZA 1USVA 1WMEA 2QR2A 1K2WA 3P27A 1H9AA 1PCXA 3QXCA 1IE3A 1R4MA 1EXMA 4LSWA 3BD6A 3PJEA 4KI7A 1YRLA 1N2CB 2I7TA 3SEQA 3BDAA 1NNLA 1K2NA 1JE1A 2GSWA 2P9YA 1JDUA 3PD0A 2A6PA 1G2IA 3O26A 3Q9UA 4GXTA 3PHGA 2QRVA 4MPTA 4PIPA 5NLLA 3U3RA 4B44A 4F8JA 4AY4A 1P81A 3EF1A 4EG6A 1K3TA 3CBQA 4K9LA 5DN6A 1SVIA 4EJSC 1VJDA 3FPEA 1JZSA 1RQLA 4IGFA 4LISA 1I3LA 2HREA 5HKOA 3H6GA 4RZQA 5I7HA 2H11A 1QG4A 4HSGA 3EPPA 4PWZA 4TLDA 1MCZA 3L82B 1RKBA 3PUWA 4HQFA 5FTKA 5IX8A 1Y5IA 5ECYA 5JSFA 1YRHA 2RGUA 2VTDA 3E1KA 3V7UA 3N8HA 3X1MA 4EH1A 3CX8A 5LQDA 4ZALA 1TQ8A 1U0EA 1LX6A 3DVRX 3PC4A 6Q21A 1X1TA 3TPCA 2BIFA 4MUJA 3RANA 2PUHA 1KC3A 4A0QA 5KQGA 4FEGA 5DM0A 3BFJA 5HS4A 2OXFA 5FWXA 1FP2A 4GDFA 1G5FA 5J40A 4C7VA 2H1LA 1OLUB 1M67A 3LY8A 3C7KA 1R37A 1SUBA 2PFGA 1EUZA 1F5SA 4F6RB 1IBSA 4RCVA 1N6RA 4H1HA 3MGAA 3D6UA 4RD0A 2H18A 3NB0A 1R10A 1L8OA 1QOPB 1JVNA 4FOLA 5BOSA 3QX3A 4XWOA 4HATA 2PJZA 1Q1QA 3OUZA 3GLHE 4FOOA 4QGGA 4C6SA 1HY3A 3VFDA 1YOVA 2GUGA 1CUHA 3WTCA 2GETA 2FA9A 1D4ZA 1UODA 1AKVA 2RIRA 2P40A 3ETNA 3BKWA 2HEGA 3IALA 3OTIA 5M5BA 2UZ4A 4X8OA 5EMMA 4IVQA 2WF6A 1OBFO 5CNIA 3RT9A 3SJUA 1LDEA 3O94A 4DLTA 3DO5A 2AG5A 3NI2A 1BVYF 1GUAA 1GLNA 1QYCA 1RQXA 1XTBA 4EX7A 5A04A 2YC2C 4ND1A 3SF8A 5B64A 2QP4A 5G02A 1UBMS 2Z58A 2MINA 2EHDA 1PNRA 4KR7A 1WY5A 1Z6TA 1T0UA 2BUCA 5I7WA 4H59A 1IZ7A 1Z2DA 2NO4A 3AEXA 5AJZA 5E0KB 1GFWA 2B1QA 5ALXA 3WRVA 1FJXA 1IYZA 4TTAA 1A50B 4WLOA 4UUAA 3REGA 1ABBA 4RGBA 3LSYA 2R6ZA 5BV1A 4PXYA 1AN0A 1KK0A 1D03A 1AB5A 2ERYA 2FQ1A 5CTJA 1U7ZA 4IOJA 5AVQA 2GDJA 3LIPA 2UYYA 2NZ8A 3NCHA 1HGXA 2G04A 2PUJA 1XU7A 4N9WA 4NNOA 2JGRA 4S1WA 4E22A 2PLFA 2X2OA 3WLOA 3V2HA 2JI8A 3ZOZA 5T6MA 4EG7A 1U7VB 5H0IA 2WD9A 3R7NA 3AIIA 1U7FB 1EAMA 3B8HA 3CRW1 5FL3A 4CM9A 2HIHA 2P9TA 5AW4A 1BMFA 2JIZA 4Z9XA 2X6TA 4LSZA 1Z75A 4YT5A 2FUG1 2O3TA 3UMYA 4MV5A 1DBPA 4RZUA 3KJIA 1RQGA 2PEZA 2COEA 3W8FA 1U2ZA 1AHHA 3KD2A 5FBZA 4D5GA 2BMWA 2D00A 2JAUA 3X1ZA 1T4CB 3A9SA 5KOJB 3EWSA 2G6TA 3QVJA 3DAYA 4KRYA 1C0IA 4OBBA 3OLYA 3QWFA 5BSKA 3WBKA 1GKUB 1MQSA 2UAGA 1EESA 5DSTA 2PDAA 1C2TA 2D5IA 4MS4B 2HIAA 3VNAA 1SMKA 2WZQA 4CLHA 1K3FA 4EFKA 3ZGLA 4EPRA 4MRSA 4U63A 3EYAA 1SBNE 1FU8A 3T34A 4HVLA 2R6FA 1JJFA 4RORA 2MR6A 1CZHA 3STVA 1WUJS 1E9VA 2C4TA 3GOQA 3UHPA 4D9BA 2FMTA 4NWIA 2ECPA 1OLUA 2OKCA 3ET5A 3KEFA 4ZOAA 4ALLA 4DAEA 2I3ZA 1P9RA 2ZBQA 4QUKA 2VAWA 4M1QA 3ZV4A 3KEOA 1YDHA 1TFRA 1ZITA 1EUQA 4E07A 5IDVA 4G4SP 5HF6A 1WEHA 1VG8A 2HO5A 3FPJA 3RBZA 3CRVA 4A8JB 3F6EX 4EJ0A 1G8HA 2O7VA 4ND5A 2WVAA 4R1QA 2DBZA 1IC6A 3I28A 4QCJA 2IYTA 5BRAA 3ZYCA 2GNPA 1NV8A 5EYPA 2V0NA 5HUJA 3C7DB 1N5OX 1WB9A 4DUYB 3ZDYB 2LIVA 3ZVKA 4UU7A 5JNLA 1ENYA 1J8DA 3ZDEA 1UAGA 4DEVA 5AVUA 1QIMA 3GRUA 4NOLA 5JBIA 1OAKA 3IVGA 4IDCA 4Z3DA 1Q0UA 2P2YA 3SQMA 3HABA 4JEHA 5A4FS 1BOFA 4UXIA 1VOTA 2MSKA 1J1IA 2HH9A 4N0EA 4RPLA 5HM8A 4EZIA 4K1XA 2C7GA 4AI6A 4YX9A 3HEMA 3MJVA 4LRWA 2P6UA 2XNHA 4L15A 1MAVA 3OAAD 4U7HA 1FA9A 1CDZA 1EP3B 1U7VA 4WCFC 3PE4A 3F49S 1JYFA 2ERCA 2XVMA 3GA5A 3H0EA 3LK6A 4K26A 4O4IB 4QUJA 4UEOA 5C18A 4EYKA 5KJ6A 1EHCA 1U7FA 1DJQA 1YSCA 2CY0A 4P2BA 3T9CA 1FLVA 3Q6IA 4UHKA 4YJGA 1RS0A 4XWKA 2PN1A 3AW8A 4HMPA 1Z2OX 2JVIA 1JPJA 3AH8A 3V8BA 4ACAA 5B7PA 4X85A 4YRCA 3DL4A 1FFYA 4M8SA 3G2HA 4M9RA 1Y9DA 1F8YA 1DWPA 4RSMA 5DNEA 3QQ5A 4OOEA 3RSZA 5KOJA 4PZUA 2W2QA 1X9IA 2OCAA 3AZQA 2HQBA 1KP2A 1CJVC 3MAAC 2AMYA 3HXKA 3UF0A 3T1YB 1TLFA 1HDGO 1WY7A 3UJ8A 4FFRA 2JQIA 1QO9A 4PLYA 3SGLA 4MS4A 4R2LA 4Q34A 2VDVE 4OHUA 4QOFA 4PAMA 4R2XA 3EIOA 4XUDA 2DR2A 2R5FA 4R3WA 5C8YF 4XFKA 1UMDB 1SUFA 1OXXK 2VRCA 4IUDS 3OIGA 1Z0JA 1C4WA 3SX0A 1R18A 1YS1X 4LV5B 1U9IA 2G1LA 1QR6A 3EUWA 3I9OA 4HNUA 4REMA 1C7JA 4ZWNA 3ZHTA 3DT6A 3MT0A 2W8ZA 2FFRA 3FMOB 1IY8A 3T1OA 3BFXA 2O8NA 5JQWA 3PR2B 1KIMA 4M99A 4RHTA 2GJ4A 2VJYA 3K31A 4XDZA 1PSDA 3WG9A 4QFMA 3ADCA 3O8QB 3LTEA 4HD8A 1PYDA 5JERA 1YBHA 2PRIA 4UTRA 5FHRA 3I9NA 2FQXA 4V2UA 1NN3A 1O6BA 2JEYA 4N39A 4WY5A 3LFTA 3AFHA 5A02A 4CMJA 5DXFA 3WWDA 4B6RA 2W4IA 2BFNA 1PTJA 3R5JA 1NWCA 2BI7A 3NYIA 4QDKA 4XARA 5CPBA 1X2EA 5AJYA 3BMNB 5EFOA 5ESXA 5YASA 1YIOA 5DGHA 4ETNA 5C35A 3WYGA 2WYHA 1ORDA 4S1NA 3R40A 2N1MA 2WKSA 2ZE7A 3ZJ4A 3VKVA 4RTKA 1YR3A 2Z1NA 3L1JA 2MT9A 2QXYA 5DLDA 3QEAZ 1MMFB 1NVWQ 3OIFA 4B3FX 5AESA 2HMSA 2HRDA 2VDLB 3HDQA 4RSGA 4IQ8A 4OP1A 4TKMA 4WGGA 3PITA 3KVOA 4ZREA 1JB9A 2ES4A 5AW5A 2R00A 2ZR8A 3TLGB 3V4OA 5EJ7A 2PUAA 2HK9A 1SEPA 1KQGA 3JCZA 4FNGA 4RGVA 5BW8A 2Y1XA 3DAHA 1WV1A 1QFJA 1XRJA 3I4LA 2QV7A 1AC5A 4LYJA 3A4VA 1T9GR 2WU4A 2BE9A 2DFKB 3CTPA 4DLWA 1RXEA 5E0OA 2I2WA 4KR2A 1U8UA 5T4EA 1D09A 2IOFA 2WSSA 4J16A 4GFDA 4NJMA 4BO2A 2QD4A 2CHUA 3EA5A 2H1FA 1NX9A 6YASA 4PGAA 3OQHA 5JAHA 5JISA 3GLFE 2IX9A 1A1VA 2GN2A 1MGPA 1S8FA 5BT8A 4EI9A 3KB2A 1LSJA 2BKVA 4LXUA 1D1TA 4PG4A 3P71T 3W1EA 1G3IA 1K4YA 1WQ1R 1FP7A 3EA4A 1J97A 3N8GA 4TMXA 4RVFA 5FRDA 5BUCA 4WKPA 4QU0A 4KFUA 3ID6C 1AKRA 2H92A 2OCPA 3UA3A 4UNIA 1D2GA 4TL6A 2FPXA 1KI4A 4L6CA 2PRKA 2JFBA 4UZEA 5GVSA 4JWKA 4OCZA 2B5OA 1XTJA 3KUKA 2Q3EA 3OZAA 2ZSFA 2ZUWA 1G9XA 1NLFA 1T5LA 4ECAA 1CQZA 2YYAA 3CUVA 4ZHSA 2GCOA 5KTKA 3GLGB 3DMHA 5DM4A 2DULA 1ZX1A 3INNA 5BNTA 4MYTA 2AG8A 4MB6A 1VL2A 4CQNA 5L9AA 2OAP1 4GOLD 3C3EA 3AJDA 1MIOB 4H35A 5IBRA 1EFVB 3VR4H 4F4FA 1Z38A 3KSZO 4LOIA 4ZU1X 2DUJA 1SQSA 3VBCA 2O8BA 1DKOA 2QK4A 2BUAA 3NP9A 3PQCA 4JA2A 3HWSA 4O29A 1L1FA 3ROPA 4XLLA 2XRMA 3M2TA 4P8RA 3IP5A 4CHTA 4DZTA 2Z4SA 3ESQA 1C9DB 4RS3A 1AM4D 1LCIA 4G4IA 3JU3A 3QPDA 4R2MA 4JI3B 2K87A 1EVZA 2AJTA 4RE6A 4J76A 4IGIA 3IO5A 2O2YA 3BMNA 4L5CA 2G7MC 3H5OA 1FIUA 1P9LA 3QMWA 1W4RA 1NSTA 2Q1TA 4ASUD 5KKNB 4F97A 4C0QC 1P4AA 4HUJA 1XHFA 5DNCA 1WBBA 1L5FA 1ZPDA 3CMMA 2P6PA 3E9QA 3IR6A 3Q40A 4MVJA 3FROA 5FORA 2BCEA 3ZH9B 2EJWA 2ZUCA 5DASA 3VHXB 2HEIA 3A36A 4RV5A 3DOHA 3I83A 1PF7E 2I3BA 1T9KA 1VBNA 3BSSA 3KWLA 1G1MA 3K1JA 3TLGA 3ZWVA 3BH6A 3NAGA 3WTBA 1G55A 3V3TA 3EVAA 1ICEA 4IZHA 4ID3A 4OD0A 2X8JB 1RRFA 1W96A 3VC3A 2FOIA 1RTKA 4P84A 1RC8A 4ROTA 1JQ3A 3QOFA 3G7UA 3B1JA 3ZK7A 4JIMA 3U16A 2PYDA 3UVEA 1C3JA 1H2BA 1YTUA 3HO8A 4M7OA 2G9QA 3COJA 3FZEA 1UBOS 4I19A 3JRWA 3QKRB 1QAOA 4IV5A 4U2GA 4TLMB 5AK3A 3W7BA 4N6NA 3WY9A 4YJ3B 3RKUA 4RHCA 1Q17A 1U9YA 2W00A 2AN3A 1PJBA 4M1WA 4X6YA 1IONA 2KM1A 1TW3A 2JK0A 2JW5A 4GMKA 4Q4HB 3FDJA 4CQMB 1E1RD 1ONNA 3I0NA 2Y0CA 1XL0A 3QF7A 5DLYA 5FD8A 3JQ9A 2H29A 4ECEA 2CHEA 2VH5R 1QQ7A 2P90A 1H93A 4RETA 5ERGB 5T6BA 2VNHA 1AH2A 1Z2PX 4ML3A 2GM4A 1QJCA 5BSRA 2II6A 5I7SA 3GXOA 1JSCA 5ALNA 3HBFA 4MTCA 1J42A 2WSBA 4RYLA 3PEEA 1TAUA 1ZK1A 3T5PA 1I14A 4D25A 5I9SA 2VT2A 1CV2A 1L5YA 4FCVA 5J4LA 4G0QA 5CUQA 2ST1A 1COWA 1EFRA 2YXLA 4PYQA 1D5CA 3S7TA 2X5KO 1QP8A 2Q50A 4ISCA 4R5MA 3GLGA 3WGNA 5LB4A 5K3EA 1NF8A 2ZBPA 4DV2B 2X4GA 4DR6B 3LYHA 4QGBA 4WW0A 5HM6A 2R7KA 3MJRA 1XK7A 1MIOA 2ECOA 1F17A 1EFVA 3G89A 4IFIA 3B1WA 2IHVA 4XQEA 1H65A 4Y1RA 2EBHX 2YYYA 2B92A 2D74A 2Q2NA 2W8BB 1C4KA 1DAIA 1WCWA 3M5WA 4INPA 4LJ4A 3FNRA 5B3AA 1B14A 3I62A 3F71A 1Q0PA 1B41A 3U4CA 1YE3A 1N33B 1KVUA 2Y1OA 5BV7A 1JHVA 1UEXC 4JFRA 6REQB 1YZYA 3NBYC 2ZJ7A 3Q7PA 4ZK2A 1JQKA 1SHZA 4I3HA 1L8LA 1OH6A 2FW1A 1M1YB 1UIMA 1K6EA 3K5WA 4B5KA 2H2FA 3EXFA 3GD7A 1K98A 1U9CA 2Q0QA 1WETA 3QGMA 1ZH4A 3VNQA 2JJ8A 4EUNA 2HT1A 2C20A 3KNZA 3AF0A 3SE0A 1YJ8A 3KYBA 1VI2A 2P1DA 3CWCA 2DFLA 3FD8A 5C32A 4F9TA 2QSYA 5D1NA 2GXSA 1LF5A 3ESZA 4I55F 5D3MB 1OX5A 1N6NA 4BB0A 1N6PA 5B3JC 3MS4A 2C9ZA 1UKBA 3ZLVA 3NAQA 3TMKA 2G77B 4PZEA 3RU2A 2ZGVA 4DNXA 4P3NA 2FWRA 2X8JA 3SIPA 4EA9A 4FHGA 4TTTS 4HX5A 5HZGA 5LIPA 1XL1A 3KAPA 2JHFA 4JL5A 3CEAA 3SJ7A 2VK2A 3F5DA 2QT1A 4L4UA 3Q6NA 3VPXA 4CIXA 2RH5A 2IU3A 2QM0A 2O2JA 3QKRA 2FLKA 1LSOA 3UC9A 4GOXA 2RCNA 4O2BF 1G8SA 3ZHSA 5AD1A 3P9NA 4FN5A 3T1TA 2XYPA 5GJBA 1YJBA 2IPOA 1V7QA 4Q4HA 5EZYA 4D4IA 2X23A 1QZTA 1L1EA 1WEKA 1Q19A 2DTDA 4K9NA 5CK5A 4B8YA 2CF5A 2NTYC 1C30A 1KIFA 5IPFA 3G23A 4BFLA 4HBGA 2WHEA 5CFMA 2P5YA 2C57A 1HQCA 4L8GA 1HOXA 2B2CA 4DEYA 3ZE0B 4EFMA 3BAZA 3OG9A 4MUAA 1ULUA 2Q9UA 3MINB 4KCGA 5T4HA 3NETA 4PR0A 1FX1A 1QCCA 4QD3A 4Y1GA 3W2EA 5GONB 1SXPA 3W2IA 4D5EA 3MUEA 2RGAA 1P7WA 4FLMA 3ZJ5A 2AEEA 1IN4A 5GIOE 3UMMA 1ZJ5A 3B3JA 2OCDA 4OL9A 1KQNA 2XNJA 3NJRA 3HA5A 2V1XA 4D9VA 4EBFA 3QV1A 2JCYA 4ZCSA 5AKIA 3NONA 3VSCA 4GRDA 1BCRB 2PGXA 1PX2A 1QWTA 2W8BA 5TR9A 3KFVA 4UBMA 1RLMA 2NADA 3KS9A 4G2TA 4DQDA 3CPHA 1G8JA 3O1HB 1UK8A 1O57A 2ZUDA 3HZZA 3QYFA 3QLUC 5ITSA 1EWRA 4FZ3A 4BFXA 1ISPA 3M4XA 3OFSA 4JX9A 1AGNA 3N5KA 1P8AA 1HE4A 4S1VA 4YAWA 3S2ZA 4C20A 1F8FA 2HMUA 2OV6A 2PGIA 1FCJA 1M1YA 3I9FA 1Y81A 3PTZA 1CJTC 3BOSA 4PHGA 1SBIA 5JO9A 1K7CA 3WOVA 2OXRA 4B7CA 1GM5A 1NLZA 3L6CA 4P4UA 3BSWA 1ZIDA 1EK5A 1T6NA 2A4KA 5B30A 1UPUA 1JEOA 3HBMA 4ZT3A 1DX4A 3DS8A 1XVVA 4UHJA 1SCJA 1RU3A 1SVOA 4RUKA 1KEVA 2P9ZA 3MPOA 4GKBA 3TTXA 2MDTA 1V6CA 4Y2TA 1J39A 5D3MA 5D86A 2AXQA 5DU2A 3ZY4A 5BWNA 1LB1B 4WEOA 2XMGA 2YV5A 2XEDA 3JQDA 1KFEB 4L57A 5TC4A 4QU5A 3SYTA 2AZDA 2IYXA 2KB0A 2PT5A 1PVVA 2I3AA 3ORHA 1ZGZA 1I30A 1WTAA 3MT7A 2JAHA 1F7VA 2SECE 1E3EA 4YNBA 4MW2A 2G9VA 3GRRA 4OOFA 4ON9A 3WJ1A 3FCEA 3PXGA 4S1PA 1E96A 3VDMA 4Q66C 2O1EA 1E9FA 3TJRA 2X1HA 3EOAI 4BQPA 5CJPA 1Y8ZA 3EFBA 1L7NA 1Z5WA 3GCGA 1H22A 2RH9B 1ZC4A 3LQ1A 3PRKE 3TXXA 4N76A 1T5HX 4P35A 2H08A 4IRMA 4WN9B 2P65A 3FNBA 4IGKA 4M9SA 5B53A 3NDRA 3GLIB 2IHZA 3U19A 3BL8A 5E50A 4L5YA 5L4NA 1P9NA 3SHVA 3QJ5A 3CSSA 2VO1A 2J45A 4E2FA 1SCNE 4EYOA 4PX5A 2G8NA 3I5MA 1PWXA 3FPHA 3LU1A 4QEKA 3RO7A 1U7OA 1E4YA 2JA2A 4R1NA 4YP0A 2Z95A 4ITRC 2QX8A 4AO8A 2QD3A 1H4VB 1QR2A 2PGAA 3JSAA 3ZV7A 2VUIB 1NVFA 1N2XA 3CLUD 3H05A 4ENVA 4ZARA 1Y9EA 1DWUA 1DJNA 3R4VA 3TW0A 4BX2A 3HUEA 1XVAA 2GAOA 2HSJA 1E2UA 3E7FA 2A0KA 1JIUA 3E5NA 1I9CA 1U28C 4XAQA 2NQ2C 4J0DA 5L4SA 2E5LB 2YFYA 3THXB 4PZYA 2ATIA 3V6MA 4OMFG 3LTNC 3RVSA 1CVLA 2QYOA 2JAQA 2LKCA 2P2DA 2TECE 2WC1A 1FLNA 3EG5A 5F7JA 5B2ZA 4EENA 3MXOA 1IUKA 2R1UA 3DBRB 4X7MA 3QIVA 3AJ9A 1SIOA 5KTYA 4MVJD 5KWIA 4EB6A 1CG6A 3CT6A 2MIIA 4QNNA 1EFLA 2QQEA 1P7YA 3H9UA 1Z2EA 2KBEA 1V41E 1ZUD1 1DLJA 1BSVA 1LC0A 3RARA 2ZWVA 1VFPA 2W6QA 3TZ6A 5JNVA 2XYRA 5EIBC 1L3IA 1IAVA 2DBQA 2MSEB 5A8IA 1BS9A 1UF9A 2VWHA 1Q1EA 1UZLA 1V11A 3A2MA 3CCCA 1VP9A 3TRDA 1JEDA 5H3LA 3B1VA 5JU6A 1YIAA 3L6EA 4LTDA 5D87A 1KYIA 2BFFA 3NH9A 1J24A 3WWCA 1P2GA 3AZOA 2F8TA 1O77A 1O95A 3CF0A 4WFIA 5CK4A 3T5MA 4M83A 2H4YA 2WG2A 2M1XA 1TE2A 3PWZA 3ETJA 2AN5A 3HBLA 3MWKA 3K4QA 3SKYA 4H77A 3SBDA 4BRZA 3X2FA 1KP3A 4BQEA 4DSNA 4M4SA 2V7WA 3QITA 4WNAB 4PWYA 1Y1TA 5DBHX 2LIPA 1TK3A 4I50B 4JJAA 2HWUA 3MFYA 4KWHA 5KAMA 1G5IA 2GD0A 2ZI3A 2BGRA 3OURA 4XDGA 5A9RA 1OFIA 1W93A 5JI3E 4M7RA 1THMA 4NK5A 5D5HA 1NZJA 3CY6A 4UD6A 1YRYE 1WXDA 4Q9IA 2ZJ8A 3AY0A 3GQVA 2FMXA 3OKFA 3UWKA 2JJYA 4DARA 5K3FB 4M53A 2ZFUA 3SZOA 4A16A 1YHZA 4I5EA 2FZWA 4L73A 1W5SA 2YW2A 5JD6A 2XXBA 1U3VA 3AR9A 5DTIA 4C3OB 2D5BA 3WISA 3C6BA 3A6FA 1W5TA 2CBGA 3N6VA 2I34A 1U4NA 1EJ2A 1Y6QA 4YFVA 5F1KA 5AW9A 3UT6A 2LBPA 1HKHA 3ANLA 5JYCA 1Z5PA 1NYTA 1ULBA 1X1EA 1GKIA 3A1DA 5K0LA 5KJ1A 5JLJA 3KQLA 4TM8A 2GAJA 1HT0A 3BJRA 2X4DA 1P19A 3JYHA 2EG9A 4R9RA 3CEJA 4PSKA 5HTKA 3JQPA 1E59A 4N0DA 3OT4A 3WKAA 2UUBB 4TLBA 3FB4A 1V6AA 5SYNA 4BEVA 1BGWA 1UFVA 1ZNZA 3OJXA 1E6KA 2RAFA 3C45A 3NAZA 2CLCX 5G4LA 4CIVA 4ZZ0A 4Y9SA 3DITA 3S2EA 4IFTA 5KSZA 2N1BA 1VC2A 2H17A 3GRAA 5LP6B 2KB3A 3JWJA 5E6SA 2VHVA 4F9FA 3NASA 4Z2AA 3GFFA 3THXA 4UREA 4BDSA 1NE2A 2DCMA 2WKRA 3RYHA 3PUYA 4F5EA 1PBTA 4BKMA 1WSWA 5AOCA 3HKBB 4M1SA 3E9YA 2P77A 4MVYA 4YMGA 1NF3A 1VZ3A 1GPUA 2NSJA 2ZYSA 3IP8A 4NXNB 3UFXA 1KO1A 2NO1A 121PA 4C4ZA 1KETA 3HJFA 2QB5A 3E4CA 3WBJA 3D5TA 5CW1A 2XOXA 4B0OA 5J43A 1EM8A 2QRNA 1PYOA 4X1KB 4JIVD 1R2QA 1SG0A 3OPYB 1PHRA 2V7VA 4LX0A 2HPVA 1EFHA 1TPYA 4RDCA 1E7SA 2QGFA 2XB6A 5KYXB 2YASA 3LF2A 1FMLA 1GUZA 3LX8A 3PRJA 4LVCA 4UZSA 1U9JA 3VX4A 3ZVRA 2V98A 3U6BA 5BR8B 3V8QA 3R9XA 2P6RA 3GAFA 3E9NA 1GQFA 1DDGA 2HJRA 2VJDA 3TLBA 5K5EA 1JFFB 1R6BX 2HLPA 4UHFA 2XQKA 4GU5A 1ZBDA 1ML3A 2UVPB 4YK7A 5AW2A 1KMNA 1VKZA 3GFVA 3E2IA 1VMDA 5A9SA 1FUIA 2HLHA 3O3OB 1T29A 2JF0A 2Q21A 4QRIA 4RPJA 4WNAA 4I50A 4XFDA 4V0QA 3W2GA 1XRMA 4YC7A 1ZGBA 4Q1FA 2NAFA 1VE1A 1QOQB 3PB3A 4CQMD 4ENUA 1V3TA 2NSDA 2VP5A 1P75A 1T0BA 1YVEI 2QRQA 2CNDA 1C3VA 1YR7A 2H5IA 4BE9A 1B0ZA 2RJNA 2YWCA 5AXAA 2RG7A 3AFMA 2M9MA 2PLAA 4MHSA 4EP1A 1E32A 2AJBA 2B99A 2Q1UA 3DOIA 3VKHA 1CUFA 2XCQA 2ZQYA 1ETUA 2V7UA 4NONA 5ALIA 4G0NA 1XRRA 2REOA 3CINA 3PUIA 4PU0A 3EQ8A 4EQ6A 2IOHA 3CLHA 2OBMA 4G1BA 4RY9A 3SQDA 4GR4A 3P1JA 4DLAA 4DTCA 3ERCA 4OA5A 3A26A 2OYSA 1TD9A 4OGFA 4XR9A 5EZ5A 2YZMA 3IEIA 1XLTA 2F9MA 4KIWA 2ZAMA 3E0XA 4KR0A 4G1FA 4AJ4A 1I7PA 4NBVA 4HXYA 1ZRSA 1K0UA 3PWTA 5HDQA 3OQJA 4DBZA 3EVNA 2BR5A 1SQ0A 1XTVA 4MV6A 3ROQA 4ENQA 5BVHB 4GVLA 3A04A 1PGNA 5JDIA 5CEJA 1WUTA 1PSWA 1LV8A 1VSTA 2PUBA 3F7NA 3K2BA 2ROQA 4Y2QA 2Q1WA 2VF4X 3CEHA 2GD6A 1TQ6A 1VE5A 4GUDA 3V1NA 4FYYA 2WJ6A 1TF7A 3A6DA 4DDWA 3R09A 3PDHA 2AFHB 5IJXA 3ER9A 2BFDB 3V6LA 3ESYA 3LF1A 3RYIB 2WPNA 3HKBA 4IH4A 2GK6A 3PX7A 3TMAA 1VBFA 1SKQA 2LNDA 4RMJA 1SG9A 5FLYA 1KXJA 4Y9TA 2FEMA 3TCNA 2Q2OA 2YMQA 4G5OA 1YQGA 2B8EA 3UT5B 1OTYA 3DMNA 3EC2A 4FDAA 4W1SA 4X1KA 2WLSA 3K8OE 3NV7A 3OPYA 1NW5A 2C5HA 1O58A 3L0SA 3HG7A 3AUYA 2JAOA 1WXFA 3OF5A 1ENZA 1U02A 2HBQA 2AFRA 2JAXA 1K7EB 3G8CA 4KRXA 2B4KA 3IKMB 4K9QA 1W36C 3PI7A 2IXDA 3LQFA 2GEDA 1I3MA 4Q15A 2OGZA 3A4NA 5FQNA 4UTZA 1JFFA 1JA0A 1SU6A 3TIVA 4QTYA 4AICA 4B40A 1UBTS 1AUXA 2VXBA 5G1PA 3BDIA 2E4WA 5DULA 3U40A 3HYLA 4CV1A 3QSYA 4YXFA 3KSDO 1RWBA 1NM5C 1NUAA 1JA1A 2EXXA 1FFBA 1RZVA 2J5RA 4F2PA 5J5AA 5BXYA 5KCMA 4F6LA 3U6KA 1QYXA 2VPXA 4OXKA 3G2MA 3FDXA 2CHQA 3TRKA 3Q3IA 3L0DA 1HKUA 4E13A 3C1OA 1H2ZA 1KE1A 1II0A 5L6LB 2AJCA 4AW9A 1DGQA 3LVBA 2PA0A 2X0FA 1QHEA 3TF5A 1OWMA 3GNTA 1DQYA 3UGJA 5E7QA 1F2DA 1MT3A 4AO6A 2DSNA 1O2DA 2OV4A 3R44A 5CDGA 1JQJC 3SY8A 4R3UC 4JUBA 3ZW8A 4DNFA 3BK7A 5CBKA 6CHYA 5K3BA 3KZ1E 3CW9A 3BKXA 2EAUA 5F33A 2C7QA 1MABA 1ACJA 5BYBA 3BMXA 2XZDA 5SICE 4NMHA 2JFVA 2OCXA 3GLKA 5HGJA 1HURA 4TZTA 2I71A 2ID8A 1PUIA 2WG0A 1ENPA 2GFHA 1YFJA 1IJBA 1OR8A 3H2KA 4TWIA 1Y6RA 1US8B 2VAMA 3FJYA 5BVHA 3K0CA 2E4ZA 4UHHA 3QE0A 1ZOLA 2P2LA 2R7LA 1SKBA 3L6UA 4FUTA 3MWGA 2O0JA 3IGFA 3RJTA 2I3DA 5K7SA 3M4JA 1YJMA 5L3SB 5E2BA 2AG0A 5LSAA 3BWCA 3F97A 4GYWA 3KTAB 4L4XA 2Z30A 4GSLA 4NEGA 4F4CA 2OHJA 5FULA 1ITZA 2AMJA 4DNOA 4OMUA 4YREA 3WIEA 2HTFA 2AFHA 4PLPA 5K0FA 3AUUA 3B3AA 2BFDA 4O4IF 1WSDA 1TOAA 1LVHA 2XECA 4ZYYA 3HM9A 3LLCA 5GZ3A 1NUQA 2C59A 4JOQA 4XIGS 5JNWA 1Z82A 1PK9A 1O95D 3BRQA 3ONWA 3M9XA 4QTZA 3PXEA 4NNJA 3L1HA 1SC6A 1M74A 4WLUA 2OV3A 5AI4A 3UT5A 4OHVA 5FOVA 1DAEA 2XTJA 3E22B 1IJKA 1FDWA 4CIYA 4BAUA 1O3YA 4N9QA 4M87A 3PHCA 1EFTA 3DZJA 1DOHA 4OQYA 4Y30A 3OE1A 3QFRA 3T94A 3LY9A 4TTJA 3PDIA 3SE7A 2PM8A 3KD3A 2CSWA 5IW8A 1HFWA 1P2SA 3N2YA 4JBNA 2O07A 5EXXA 4RHFA 4JC5A 1YZUA 3EBPA 4TXHA 5DSZA 1WX1A 4BZXA 1XUOA 1Y4UA 1KI3A 4M0DA 3CU5A 4KBYA 4MS3B 4RU1A 4TX1A 4ZTZB 2HQ1A 2G0TA 3RFVA 1APBA 1VLVA 3D9QX 4FP9A 3JVUA 1UJ2A 4D42A 5B2FA 2WV9A 3ZHXA 5LBUA 2EBWA 3RIGA 4AS1A 5C3UA 4FEAA 1X7WB 2YVKA 1J4PA 1CS0B 3COPA 2W7TA 4DADA 2A7QA 3U7HB 3CF4G 3VPDA 3MHTA 1KDOA 3H9JA 2P8SA 4TVBA 1OLSB 4INAA 2GXUA 4II2A 4GMHA 1ZUHA 1TF2A 3DE4X 4JWTA 1VIMA 1GTG1 3U26A 1YUBA 1AGXA 2CVFA 3AG5A 4CBVA 1RKVA 1XTSA 1UPFA 5CHYA 1HH4A 4O0MA 2COKA 2DJIA 3F74A 3NHYA 2F90A 5F9MA 1TK2A 1XLTC 2ZM5A 1ES9A 4QU9A 2QG9A 5CX1A 3A06A 3SZGA 4RC9A 4KK4A 2XBUA 3FPFA 1E0JA 2V65A 4BLPA 2G40A 1KHUA 1K97A 1I2BA 1R3UA 2HK8A 4ABYA 3DYVA 5BSVA 5J5CA 1R4AA 4YQYA 1S5PA 3EASA 4E51A 1R5JA 2IOFK 4WXMA 4HR7A 4JBLA 2XDAA 1OB5A 5E2AA 3FLMA 4DNQA 4EF6A 1XPUA 4QPNA 4OHMA 4MVJF 3AIMA 1US8A 4X66B 3GZNB 2V6FA 4IVRA 2ZUUA 5DNDA 1RHKA 2X1LA 2XT9A 3UOTA 3RUHA 3CX4A 5U9CA 1F2VA 1CLEA 1AUQA 3KETA 3KXDA 3M1LA 3CO0S 4IKOA 2PS0A 2CNBA 4QTUB 1A9OA 2ODQA 1IBCA 2X0RA 3KTAA 4I46A 3UTCA 3RFXA 1D4FA 1W4ZA 2Q07A 2QVGA 2NQ8A 3KL2A 4KJZA 2PGLA 3M1YA 4JV5B 3YASA 5JXHA 1CUSA 2MTBA 2XUAA 2QM7A 4G0PA 2HM7A 1DRUA 1QH9A 2BPOA 4OGLA 4OJMX 4JP2A 4YJHB 3UB3A 2C5AA 4JLNA 1V39A 2FN9A 3L6DA 5F3RA 4R7TA 1N3LA 3S7ZA 2LRHA 4RMIA 4ZT6A 1JDNA 1M33A 3WGKA 4EF4A 1RYBA 2NTVA 3NHWA 4ALJA 4B80A 3QELB 1WULS 2E4VA 3E22A 4X94A 1IVYA 2PSJA 2PUWA 4PSDA 4F92B 2IFTA 4FOSA 1WWKA 1K8YB 2Y92A 3G6KA 1FXUA 4LKOA 4OI4A 2BBWA 1K7XB 4JSRA 1TEZA 2A0YA 1DQPA 1XA0A 4MYHA 1NZFA 2C99A 1E99A 2VWGA 1J0XO 2HPAA 1YZGA 2A0UA 2IJGX 5KOHA 1RDFA 1KVTA 4C6RA 4FIDA 3EGWA 2VQFB 3JVVA 1BCSA 1L3CA 4TLCA 3UT0A 1K5GA 1U5AA 4OQXA 1GPBA 4UFOA 4JLSA 4CYMA 1P2BA 4GG1A 4OMDA 5JAPA 1IUPA 2IPXA 5TX7A 1X7WA 5T57A 1ZCAA 2PQ6A 2FHSA 4KLRA 3NDJA 5TQJA 1E2HA 2RBGA 5CM8B 1PDVA 1YAJA 2ARKA 4BKPA 1KU6A 1RAFA 1F1BA 4G86A 4YRPA 1AUPA 1G64A 3M6AA 5DNUA 4NXMB 4AKTA 1JBKA 3FVWA 2VPIA 4G2SA 1ZC3A 4LNUB 1A9QA 1JG3A 2EF0A 4UXHA 3GAZA 2ZITA 3RGWS 4HPWA 3TXAA 1AX9A 1ZIYA 4HOYA 1U7HA 1OFGA 2DFVA 2RI6A 2OFOA 1KFKB 1OXTA 2VHCA 4KLCA 3SNHA 5K05A 1EQAA 4BQRA 4XWGA 4LYGA 1HR0B 4I4TA 1T3ZA 1OBOA 5C7OO 4KHZA 3RD5A 1G7TA 1YCHA 2KB4A 3EY4A 4J49A 4PLVA 3DULA 5LUBA 2WWFA 4F60A 4ZJZA 1Z0A