5DHPA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
molecule keywords NAD kinase 1
total genus 67
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhpA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhpA01
2I2BA 3V8QA 1U0RA 3T5PA 4L02A 5EJIA 3V7WA 2QV7A 1Y3HA 5DHQA 5DHTA 3S40A 2I2CA 3AFOA 3V8RA 1U0TA 2I29A 5DHSA 1SUWA 2AN1A 5EJHA 5EJGA 5DHUA 2I2AA 3V7UA 2I2FA 3V7YA 2I2DA 4HAOA 2QVLA 3PFNA 1YT5A 1Z0SA 4V24A 2I1WA 4WERA 3VZCA 5EJFA 1Y3IA 3VZBA 4DY6A 1Z0UA 1Z0ZA 2Q5FA 5DHPA 3V8MA 5DHRA 3V80A 3V8NA 2JGRA 4WRRA 2P1RA 3V8PA 2BONA 3VZDA
chains in the Genus database with same CATH superfamily
4OQNA 3NHJA 2Y1WA 3VM6A 1H5QA 1GPBA 1R6BX 2CNNA 2GJ4A 4NU6A 5TVGA 4EG3A 1G2PA 3AT1A 3ND9A 4ML3A 4N3CA 3OKPA 1S2OA 3KEOA 1V9SA 4YR7A 1CQXA 1ZVVA 1YQXA 2J3JA 3E18A 1YR2A 2FN3A 4M8NE 3L7BA 2JCYA 1KSGA 1KJ9A 1L1RA 4Q39A 1F8XA 4TV9A 4D6PA 5K4GA 3COVA 1OUMA 3KZXA 3DMRA 1BYUA 3RRNA 5AFSA 2IUEA 1SC9A 1J8FA 1PV4A 4D9IA 1AXRA 1Y6RA 3ESZA 3FH0A 2AL7A 3ILYA 3GUCA 2G4CA 2XTJA 4JZKA 1E1NA 1BMTA 2YASA 3IMKA 2I2BA 1X42A 5CFZA 2UYHA 1XMIA 3C3PA 3F8TA 3PPWA 4P93A 4ND6A 3SVZA 3UWOA 3E1GA 3QE9Y 1T5LA 1Q12A 3SWWA 2ZIUB 3EW7A 3SDBA 4ZDKA 1PL8A 1EH5A 1T5IA 3OIWA 4CR7A 3MW8A 1SBNE 5IHPA 3JQBA 3ZCPA 4KN5A 1JPJA 1PX2A 1S2DA 3QM1A 4TS9A 5LNK6 1JMKC 1SMKA 2LXNA 3T5DA 3P52A 2IC5A 4LS3A 5AK4A 3NTOA 2GZAA 4N0EA 5EQDA 1BC5A 2PE5A 2CJXA 1J90A 1GGFA 3QFHA 4AQDA 4BRZA 3AVYA 1FSSA 4FBLA 3AJ9A 4WY8A 1JQEA 2OQIA 4DDTA 3GQSA 1Z3CA 3IEUA 2HLDD 4UHJA 3I6BA 4GR5A 4AG6A 3QFSA 2E7ZA 4CCSA 1KFEB 1P5FA 2JFQA 3ZWDA 4O5OA 4BN4A 5JH7B 5J63A 1FTYA 5BW8A 4WZBE 2Q4BA 4G81A 1H2ZA 4FSXA 2XW6A 1P8JA 5C8YB 3P8ZA 3Q7EA 2IUUA 4LW8A 3VAZA 4G26A 3WO1A 5A5DA 2BDEA 1VG1A 4Q93A 1ZUWA 5F98A 3CUSA 1C0LA 2IPMA 3TX6A 3H83A 1FJGB 1ZAKA 3LQ4A 4PGAA 4WCFA 4DTIA 1C9DB 1T15A 3ORRA 4CKWA 4DV7B 3H2KA 4LZPA 3R76A 3TXXA 5LOVF 3EQ7A 3I9NA 1OFUA 5E6UA 2D54A 3PJGA 4AMYA 3ZDRA 2L17A 2HO4A 4FCCA 2G09A 2WHPB 1Y3FE 4HPWA 4NF2A 1PEYA 1D04A 4FB5A 5JO0A 2BFCB 2XQVA 2C1XA 2W00A 1YZHA 4WCVA 4EA6A 4MI3A 1JFFA 2D1SA 2SICE 4HEQA 2W6IA 2XRYA 2FSIA 3ROEA 4EKIA 3TGLA 1K8QA 3KC2A 4JQOA 4DANA 2XMGA 2EP5A 1F06A 1XRLA 1Z12A 2GZMA 1PDOA 3ADPA 3LX4A 3NBFA 3TD2A 1AK9A 1LV7A 5EHXA 1ORRA 4RWZA 4EECA 1QWOA 4EOGA 2MTBA 2J7PA 3DMDA 3R0IA 5HFNA 2WZDA 1RKXA 1GV0A 2BR3A 5FHRA 5C52B 2JIOA 4B0PA 1W8DA 2YHBA 3OTOB 2FPLA 4I9HA 4XQGA 4E09A 5ULLA 2AR0A 4HWSA 2AFFA 5F7JA 1A5SB 1X9HA 4LX8A 1AHNA 1HT2E 1QO0A 1XD2A 2AQHA 4L8VA 1HT1E 2JFYA 3W9BA 4BP9A 3F73A 5LDHA 2EDAA 2PBZA 2XE8A 2PZJA 3IKVA 4JUBA 3B12A 5E1BA 1MGOA 3PS9A 3UMFA 3HACA 3OETA 3EFOA 2CXRA 3DZIA 4Y1FA 5FTMA 4BGVA 4LFBB 2YN0A 1QU3A 1DWOA 1E2EA 1MVNA 1QRAA 3Q11A 4IDPA 4DJTA 1E96A 1ESNA 4ZXFA 3QWBA 3MCTA 3RYFB 1M83A 5KSZA 4GKKB 4YJ2A 5DF1A 2EZ4A 4Z4QA 3EF1A 4RVSA 1SPBS 4BMDA 4OHYA 3FB4A 5LUBA 2XMRA 2WJPA 2LGJA 2G6TA 3DM9B 4H6PA 1ZGGA 2GNPA 5F64A 4YGYA 3RUCA 4B31A 5ITWA 3FIUA 3U56A 2OK7A 1ZOIA 4E6EA 4EGXA 2DYKA 3VR5A 1D0SA 3WP1B 1G19A 4JJ6A 4EO4A 2PD4A 5FFFA 1P7CA 2Y0BA 3U80A 4QTXA 3WHKA 1XNGA 3L7KA 1I2BA 3NVDA 1TJ3A 2WYOA 5F52A 2JK1A 4M37A 4MARA 5JS2A 4XM0A 3HVUA 4WZBA 3SGLA 1C3EA 3HI4A 1OX6A 1OA0A 4L8FA 2HK6A 5MGNA 1OT5A 3GFFA 4ZYUA 2R2GA 4MA4A 1HG1A 1CR2A 4WNAB 4CDNA 2QN6A 3IESA 3E3LA 4HY3A 1SFRA 2FYTA 2XCTB 4LCJA 4ER6A 4UCQA 1RI4A 4ZVRA 1PLLA 4WESA 5E3IA 1EK1A 3K0SA 2EBHX 2XBLA 2NT4A 2CVOA 2IEAA 2VJDA 4H7JA 2ZR8A 4CLRA 4AUNA 3MGGA 2A58A 2NZWA 1NOIA 3L0PA 5BV2P 1UKBA 1G3QA 3JQPA 1QVZA 1GG2A 3R7BA 3QK7A 4YRAA 1J56A 3OEHD 4TV9F 1L3CA 2HJVA 4GC5A 4JLJA 4DEVA 2BMFA 3KLBA 4EK9A 2KSQA 4EAQA 1QU2A 1R0CA 2YC2C 4TZ0A 3VYTB 4TMFA 5M34A 3B38A 3G9QA 2H59A 2QPTA 4OIMA 3IT2A 3V2IA 1WHSA 1E1CB 3BVPA 3FAKA 3MUOA 4AF6A 3EXHC 5DWDA 3U60B 1C3OB 2C3MA 3P4XA 4IIJA 3X1KA 4KSCA 3JZAA 1RQ7A 4FHDA 4ZVUA 2W4MA 2POCA 5REQA 4G8CA 5HK9A 4QXPA 2WIJA 3I9MA 4NEHB 4UVHA 3PJEA 2HLNA 1E61A 1KETA 4WCFC 5J1TB 3T3IA 3VRHA 3FOFC 1VI2A 1RRPA 1DKLA 4JB2A 3EGDB 4EZBA 5BR1A 3MCVA 3PRHA 1WZNA 2JGJA 2REQA 4M1MA 4RL6A 2RI1A 5EIAA 3ABSB 2B1QA 2ZPAA 3KOMA 3L6CA 1NMXA 5GM1A 1IXYA 3RG8A 5IBCA 3MPOA 3TB4A 4WN9A 1ODIA 3SX0A 3ZCUA 5HWSA 5AQEA 5EJEA 1VPDA 1H8ED 2RC5A 2WF7A 3A31A 1X92A 3I58A 3L7MA 3VZQA 4BE7B 1G38A 2AC7A 5BOSB 1MC8A 4J3JA 1TJNA 1GQOA 2A5DA 1LFAA 2DGDA 2Z8YA 3MD0A 3PE6A 1WCIB 5EAIA 2PQ0A 2PV7A 5EP3A 1R3UA 3VISA 2UZ4A 3UUFA 2A3NA 1XEAA 4BWGA 3FZEA 4CMJA 4NQZA 1B6RA 2DF8A 3HI6A 1B14A 3IAM6 3WGLA 1QPZA 1JILA 2QW0X 3HKCB 1D2MA 1SCDA 3EMBA 5EY5B 3BIFA 2BHRA 3X1XA 4BJ1A 5EXXA 1Q17A 1W9MA 3SFVA 4EIWA 6GPBA 5JCZA 3OICA 4JP8A 1N3IA 4B74A 3RSHA 1SELA 1Z2PX 4FOOA 4YV2A 3DYVA 3D81A 4NV3A 1JA1A 5ALQA 4YUZA 3GG2A 1ELOA 1E4VA 2QLLA 2Q07A 2Y6VA 4DRYA 2CL0X 121PA 2GAJA 3S2GA 5C5DA 4KN8A 3LQ1A 1U31A 1A9XB 3BXGA 3N0RA 4IJQA 4HVLA 1HNXB 1XCBA 2PEZA 2VDUE 2DPMA 2BP7B 4FYIA 2VJLA 4JP2A 3LOUA 2C2KA 1C4OA 4B79A 2F9MA 2C29D 3D43A 1L2TA 3SKVA 5IFKA 2PKQP 1KMCA 4HDOB 2YX1A 1Z3IX 3A1TA 3DDZX 3I9KA 1J8QA 2FW9A 3ZD7A 4PR0A 4QGHA 1PYDA 1CRWG 1QHGA 4GM0A 4D3YA 2B8NA 1U0LA 5T4HA 4YP1A 3LY9A 1SOAA 4MV5A 2XDQA 4LZZA 3EXHB 4FEEA 1P5JA 4Z86A 4DCGA 5J3JA 5JJIA 3W5VA 4PBRA 1Q0SA 1VJDA 2FEPA 1VI5A 3DEZA 3B7PA 3TM5A 5IC4A 2R9VA 2HR1A 3CWQA 1A2BA 1CX9B 1KKUA 2F3UA 2WJ4A 3AFOA 3V8RA 1G5FA 1KI6A 1W0JA 1U7OA 2EBWA 3BFJA 3U7IA 4AJ9A 4DCTA 5E2AA 1GA6A 1U0NA 2QZ9A 3KVRA 3LH5A 4J0GA 4M8SA 3UXYA 5L51A 1TK2A 1JG6A 2FQXA 4DC1A 1UBHS 2YNMC 4Q02A 5JZ9A 2V0NA 1BD3A 1BGXT 3EEYA 3IQXA 3FHOA 3NWBA 3P2OA 5JOQA 1QHHB 2W6JA 3GLHB 3COPA 3KQWA 3MGKA 2D2VA 2B8WA 4IVQA 5ELMA 1QO0D 5KDOA 1D7OA 1P0FA 1FRQA 1KGSA 3OPXA 3R8FA 3DLCA 4UDYX 1MR1A 4DCNA 3CF4G 2ZATA 2IA5A 1WRBA 4YDQA 2V59A 3PB3A 2QMYA 3CKYA 1ENZA 3OTGA 4UQOA 5C53B 3LQRA 5HYVA 1V2GA 4CLOB 3ZH9B 1FYEA 2F43B 2VF5X 4Q00A 2HF7A 2R751 3USCS 4EX7A 4ZOEA 3FVWA 2X76A 4XI9A 3KS9A 2DFVA 4UFNA 5AHXA 2FSHA 2GJ9A 1LUAA 1Q5PA 3QLUC 1N6LA 2PZKA 2CMDA 1CUSA 3GJZA 4AXXA 1Q21A 3H2IA 4MIEA 3KZMA 4PSVA 3GLKA 2B4RO 3K4PA 3TSZA 3V8NA 3NXSA 3GI1A 3DQQA 2CVFA 2EOAA 3KOYA 4FOLA 4OUDA 2VRWA 3QE0A 3T7RA 2Q1TA 1F5SA 2J0UB 2AG5A 3DEKA 5CH8A 4QNNA 2GF9A 3PNOA 2C61A 2XCSB 5B7NA 3FVVA 4KGVA 2REBA 4YMWA 2CNWD 2IOQA 4PAOA 2PJRA 1T8UA 3D7NA 4GG1A 3A6EA 1KHTA 3ZNOA 4RJ2A 4RJKA 1T1JA 2VPYA 1H1TA 3AXTA 4F8YA 4IJ5A 1Q3KA 1RWPA 1U7PA 2NNWB 5AVVA 1L7DA 2Q4TA 1ZHHA 3OT1A 4BQOA 4IY1A 2DAPA 2ORYA 4OXXA 4UC0A 2QRMA 1J21A 1BWSA 5GMOA 2XB2A 1FXUA 1X9GA 2IDZA 1D0VA 4TVOA 1V95A 5EL0A 5G0TA 2Y2VA 3QEAZ 1PWYE 2JASA 5AK3A 2YRWA 2GCPA 4DY6A 1DG9A 4B80A 3QSGA 4LXXA 2F8TA 1Y81A 4KAJA 4RU1A 4XVQA 5EE5B 3JWJA 4H9GA 1RLMA 2AWOA 1KERA 1KI2A 3KCQA 1U7XA 2XVMA 1T29A 2P9FA 1G18A 3PEEA 4HWGA 5J4VA 3JQ8B 3NHPA 4BNWA 2JGFA 4MDEA 1ONBA 3Q1KA 5JY1A 3L92A 1CHDA 3DF9A 1YO6A 2QRQA 3LP5A 3OE1A 3IE0A 3DAFA 3TEJA 3SR4A 4BX8A 1CT9A 2VQEB 5TQ2A 3EQ8A 3BMQA 5KYGA 4OGLA 1TK3A 1U2QA 2AMFA 4ZQGA 3H0KA 4ZC1A 3SBDA 1VMEA 1Z5GA 3UFXB 5CCEA 3IP9A 1OJ7A 2Z4TA 3LY5A 2B99A 1JYFA 2F3QA 4Q9IA 2KB4A 1OV4A 5LP6B 3OUZA 1I7QB 1IMOA 3DE0X 4TVKA 2O0LA 1N6NA 2WV9A 2QENA 2QRKA 3Q87B 1S1MA 1YJXA 1VHLA 4H6WA 2WNHA 2I67A 2JD1A 3TRFA 2R84A 2QQ5A 4S0ZA 2XVXA 2Y6UA 3QYAA 1Z0IA 3N0WA 1W93A 5P8WA 4RE5A 1Z8HA 4PSDA 3A14A 3HVIA 3LUKA 5AI0A 3ZX4A 1R10A 3IBYA 1E1KA 1JQKA 3K5WA 1UAYA 1AX9A 3AHDA 4NSNA 2GTHA 1YVDA 4J6FA 1BROA 2JA1A 1ENYA 3OIVA 2PUBA 1QYXA 3D3JA 3CISA 1E4YA 3EUWA 2WWWA 4EENA 3GLIE 5BORA 3B1JA 2QMUA 1U6JA 3OCCA 4GKVA 2O2HA 2GYYA 5JZBA 1A1VA 2XYVA 2P75A 3DXZA 2IPOA 4BECA 3FYHA 1HL7A 3FOBA 2IJGX 2PTGA 2LP4Y 3D6JA 4P36A 4ZAVA 4UM9D 3L3BA 3T94A 4INZA 3SQMA 3IJPA 4KSBA 4XWOA 4J2OA 5K1ZA 4MVJI 5DU2A 5JZVA 1R0LA 3N2YA 4DT1B 2QD1A 1OX4B 5L7YA 2HSDA 5G4LA 1J0CA 4DCVA 5LOVA 2G82A 5JFGA 3HSKA 2BELA 4X93A 1LNQA 4ENRA 5F2NA 4UFOA 4V3BA 2NAPA 4UTZA 5LQUA 1A5ZA 2PIEA 3GCDA 1NSYA 3C3BA 1F12A 1ZVQA 2ZUUA 1E7WA 1SPXA 3W06A 2RJOA 1L0BA 3I52A 2ZUSA 4CQLA 1NW6A 2AEJA 1Z6ZA 4A92A 1WMDA 2GYWA 1PSZA 1I7PA 2UAGA 3PLAE 1P1JA 5AICA 2Q5FA 1QGUB 3EMKA 2V7EA 1CUUA 4W1QA 1E8DA 2BV3A 2ONYA 3U7EB 4F5ZA 4JLWA 5ESDA 1Q1NA 1ZWLA 2WNIA 4QUAA 2BWJA 3DLPX 1E8NA 2OHIA 3THXB 4H31A 3NUZA 1BWRA 1U0FA 1MNAA 2F1HA 3AI2A 1RJFA 1GPAA 2QPLA 4F4UA 1F38A 4EH1A 4JYBA 4PBSA 4MVWA 2KFUA 1P1HA 1Y6QA 2ZSBA 3IC5A 4FIZA 5IEJA 1SZPA 2C78A 4HNQA 4P5EA 2HU2A 2FOXA 2XTZA 3EHEA 1E77A 4P4LA 2NZVG 3ZQ6A 2CYBA 2GD1O 5AHKA 1LSJA 1UC5B 4F04A 3RHSA 1OASA 1X0VA 4EY3A 1XHEA 4MR9A 5HUJA 4KR2A 3D4NA 1GQQA 3T3GA 4RKEA 2G4LA 2OV2A 3BHNA 1J0AA 3CPEA 1U04A 4C4RA 3L8MA 3T9EA 1XX6A 3UAOA 2OCLA 4CMGA 4EEZA 4K86A 4TMKA 1MXFA 3VKFA 1Y34E 4IDBA 5EG5A 1RVV1 3IPRA 4RJTA 1HFWA 3BKXA 2IITA 2Z83A 1DG1G 4IIXA 1E9BA 4Z1OA 3KKQA 1W1UA 3LOPA 2XNDD 1TZCA 1YZGA 1SXJA 4C7MA 4ZK2A 2H00A 3MRTA 4Y2SA 4WBNF 3N5CA 3IR7A 4OOEA 3HK2A 1J70A 1CUVA 1W4ZA 5AVXA 1V4BA 2AK3A 4IM7A 1BWQA 3R7WA 5J4KA 4L8GA 1MDBA 1O96A 1SN7A 3W2IA 1V5IA 4DPLA 5C34B 3LKDA 3VNVA 4M89A 1F8YA 2ZUVA 5JV5A 4BFXA 2XE4A 1T8PA 4Y67A 2OC9A 4FXOA 1E63A 1Y6GA 4ZEMA 5A9TA 1YACA 3T12A 4G1MB 1EP3B 3F7OA 2A9PA 3BH7A 3RV3A 4Z49A 4GW3A 2FF7A 2H4HA 2PX0A 3N2LA 4JLPA 3P9PA 1QK3A 1SVMA 1UP6A 2JLXA 3FE2A 3AF0A 2Z2IA 3FKJA 4B8YA 1SQSA 3TGWA 3BBPA 4NBNA 2GFIA 4DUPA 3IR5A 5BPHA 3H3XA 5JWRA 2Q1SA 3B6ZA 4K6GA 2WD7A 1QZUA 3QNUA 1E2UA 2EJUA 2WYIA 4L73A 2ZIAA 4ITRC 4LGYA 4UCWA 5IVIA 3S2IA 2C83A 2DUMA 3D7LA 5FBHA 2XDQB 1LVGA 1AN9A 3BZUA 1MDFA 3ESDA 3JAKB 2HA7A 3PTZA 1GFSA 4NECA 3RJZA 5F2OA 4D3XA 4DNQA 3MMPA 2E5WA 1GTG1 3BMCB 4JD5A 4GHWA 5IZCA 3FF4A 3NDJA 2VTDA 2ZRNA 1JHMA 3G5AA 4K6OA 3RAPR 4N9QA 3N8NA 2D3TA 4IIFA 3FX2A 5BNZA 4K0KB 1O5TA 1AQUA 3UY4A 2VLBA 4PPQA 1U2GC 3RBAA 4OX9Y 1RS0A 4I1OA 1RWWA 3PQFA 1J1IA 1Z73A 4NBLA 3EK2A 1UBFA 1PO7A 1MENA 1TU0A 4MVXA 1ILEA 1HQYE 1OPRA 1QUEA 1YIAA 4BQPA 3NTUA 4TLMB 3CVOA 4MQEA 2JLYA 4RH0A 2HXGA 4JKOA 2NU7B 5HDBB 1TEZA 1RKBA 2AJTA 1G6GA 1AKRA 3N74A 1QMPA 4W7SA 2YZ7A 4RD2A 3PGJA 4BFUA 4X24A 1ND6A 1Q19A 1SC4A 2EQ5A 3AESB 1NY6A 2QI9C 3HKCA 2PY6A 5K09A 5TPWB 1DKQA 3HS3A 3QP9A 1F6WA 1FUEA 2H9AA 3R5HA 4U6NA 5B1HA 3UMJA 2K7FA 3GBPA 4EKNB 4LBVA 4R2WA 3S29A 4QGFA 4E5YA 5B6IA 1INLA 3PWSA 8MHTA 1SKQA 1Y8RB 3TKAA 4PHHA 1V7PC 1MO6A 1DBQA 3H0EA 4NJEA 4OJTA 5MGBA 2P9CA 2WM9B 1KZGB 3QFFA 2JVKA 3B3GA 2FN4A 3NYQA 4ZOCA 5IXYA 1H0HA 2QORA 3O92A 1NBME 4Q3NA 1DDGA 3UJHA 2V1UA 3IBTA 4A26A 2IL1A 5CB4B 3MS7A 2ZOSA 1C7ZA 2B1GA 1ADJA 1K9SA 3C3EA 3KJGA 1EFHA 1WSBA 2ZAGA 3DOOA 2Q8PA 1R3DA 1WF3A 4FHZA 4GAEA 5CFMA 1JALA 3O74A 3V2HA 4BNDB 4RZ2A 4NYIQ 5BMOA 4QSHA 2UYCA 1N6IA 1G8YA 2C88A 1MC1A 4PZDA 3D7RA 5CLIA 3MT8A 4ZEOA 3HC7A 4OYRA 3SK0A 1TECE 2CV0A 3EPRA 4JN6B 1A88A 1J9ZA 3KBOA 3VPFA 1SQ5A 3DLAA 4Q18A 2VK1A 1VGVA 1A8SA 5H5JA 4GGOA 1CY1A 2JCSA 1FNDA 3M6LA 4RPKA 3DV0A 3QG1A 1BH2A 1GZHB 1UF9A 4Q3LA 4CLRB 1ZM7A 4TKUA 4ZDIA 1NXXA 4XCXA 1JBKA 1B0UA 1ZXXA 3FNQA 5DM60 621PA 4IJWA 1GTZA 3LX5A 1SCQA 3OQVA 2XCQA 3QVKA 2BZ0A 3W7BA 2VHCA 2CMHA 3H9UA 4LTDA 1C30B 2Z09A 3NQ41 3P4YA 4KIUA 3KTAA 4KRXA 2IF2A 4I50B 3GOHA 3M8KA 5BUQA 2IT1A 4YNBA 2Q2VA 2RGCA 3CV3A 5CT6A 2O2CA 1TAHA 3DTVA 5HCIA 4AK9A 4B2YA 2P5UA 2JLZA 3LS2A 2Y4NA 1DWPA 1KHHA 3TWOA 5IK2D 3SC6A 2JI6A 1FTGA 2QSZA 2Z3WA 1YUMA 2VP5A 3TVDA 3SIRA 4HVCA 3NTQA 4FEYA 2G40A 4OSOA 2H7CA 1LLCA 1XU4A 4BBZA 4JUDX 1D2RA 1NWHA 1D2AA 2GPNA 1P33A 1SC3A 1WV0A 5HQTA 3K0EA 2C3YA 4GP7A 2Y1LA 3KZKA 4QDTA 2XQIA 1PG5A 3PNLA 3PHJA 2UU9B 3AO0B 3WYEA 2H1OA 2BISA 4BVBA 1L4LA 1SG9A 4DR2B 2O8EA 1TFRA 2AZTA 3HY4A 3MQ2A 3TPFA 1BSVA 4L3WA 2PKYX 3Q3GE 4ARZB 5IZCC 4YAIA 2BBWA 1Z8FA 4KODA 1LBEA 4AJLA 5C8YF 1AF4A 1KK2A 2EIXA 4X8OA 2C9CA 2QX6A 5CNKA 1P2UA 1G6OA 2VEOA 5IJ9A 1FNBA 1WVMA 4AY6A 4AMBA 1V37A 2IV7A 3T0GA 3JAKA 2IEYA 1XK6A 3DQPA 4OHFA 4Y9TA 4COOA 3V1NA 5EE3A 1X7GA 1P6XA 3U16A 4YMGA 4ICIA 5AKGA 3QVVA 4H0NA 2H57A 1EEXB 2DJIA 4W5RA 4MW5A 4I5DA 4PWZA 2FG7C 1Y1QA 4XAQA 1IOLA 1NNLA 3DTYA 3I04A 1J9GA 2VBCA 3SS8A 5K6TA 4YJKA 3V48A 2H63A 1VYTA 5BQPA 1YRLA 2P6RA 3GUVA 1JR4A 4H7PA 5IKEA 4FHCA 4A6EA 2F9FA 1VDMA 1TPYA 4CTNA 3KQOA 1NDHA 1AM4D 1EP9A 3ODGA 1RKQA 4EP1A 1VTKA 3MJCA 2XTNA 2W2XA 1KH1A 4G41A 4N3AA 3DR5A 3GLRA 4P3NA 5E38A 5JD5A 1VE6A 2QNBA 2WHPA 3VR3A 1QXSA 1QVVA 2Q5EA 4FZVA 1KFBB 3O1LA 3QVMA 1WU7A 2AXEA 2KQUA 3CUTA 2AF4C 3IUEA 3MFYA 5IM5A 3LPCA 3TE6A 4IFEA 5CFOA 3SSNA 4TT3A 1Q1EA 4K8OA 4LCBA 1NR5A 3QV1A 3K1AB 1MRZA 3PF8A 3ZE2B 5F77A 3SX4A 3EGOA 3OC0A 1HZZC 3QJYA 2ZS9A 2AVDA 3RUIA 2I1LA 5DYYA 3T54A 4DIKA 2D6FA 3GDGA 4E6PA 1DL5A 3FJYA 3RIGA 3A6ZA 1XPRA 5FKJA 4NCIA 3P20A 3HCPA 4DGQA 1DB3A 1E9SA 3T4UA 2YHSA 2ZU6A 3PD1A 4RFLA 4UPVA 2VDMB 1FMCA 2B30A 3RREA 2Q3EA 3NBXX 4KO8A 3HA7A 4IJVA 4BLVA 3PTAA 3L7OA 4QHTA 3G2HA 1KO4A 2IKQA 2RCYA 2QF7A 1EXWA 1VCOA 1FP6A 2DM6A 2R8PA 4I1YA 4OQLA 3PHIA 1O0SA 2Y9MB 3FMPB 4GYYA 4FGKA 4UFPA 4RVUA 2WHEA 2REOA 2ZWMA 3I09A 1F8GA 2HTFA 3FUUA 3VDRA 5JDIA 3OQMA 3R7NA 3ID6C 1YXMA 4KZPA 4G8DA 2RHCA 1UBOS 1K3FA 2ICAA 3K0CC 1GGEA 4TYPA 1Z4OA 2ALJA 2OC4A 4CT4B 4QG3A 1UK9A 2BUBA 2Q9AA 1EFVA 3V33A 4C04A 2B34A 1J2RA 1SIUA 4MPJA 4KZKA 4C4TA 1YC5A 1IWOA 1MQAA 2H2AA 3DBVO 1Q57A 4N1AA 1KAQA 2W6OA 1XZJA 4P4SB 5ALRA 2GWHA 2ZKLA 1P4RA 1ULBA 3H5NA 3PPYA 1S6YA 4P4GA 1J0XO 3DTTA 4XD7A 3EGXA 4GPTA 2W2PA 4KDEA 1L5LA 2QN2A 2Q2WA 1VGQA 3D8TA 3EH2A 3OM8A 4CETA 2Q4DA 5DGXA 1ESMA 4RHFA 1NMEA 2GRJA 2B20A 3ULKA 4FDVA 1LI7A 1O89A 1ZNYA 4CR8A 2FSUA 4J91A 1WB6A 4M55A 3TQHA 2JAQA 1I3LA 2I91A 2BEUA 4BMSA 1JHYA 3E8MA 3D6MA 4XDGA 1GNPA 1JAIA 4K6FA 4X7RA 2W2QA 2INGX 3F6EX 2ZRDA 1D1TA 4KBFA 4KI0A 5C1DA 4EHIA 4BDSA 3VFDA 5E95A 4JR0A 3R9XB 3SEFA 4DA7A 2IIVA 5AUPB 4LEIA 5FP0A 4QDUA 1CC1S 4LIPD 1CF2O 2J87A 2X3YA 2NO1A 3FLBA 4N6NA 3NBQA 5JBQA 4X00A 1YRQA 1FP2A 2LKCA 5TF0A 5AUNB 4JI8B 4FGJA 2LCIA 4AKIA 4GYWA 2WB4A 4OX9B 1ULHA 2FA9A 2I0FA 2BJVA 1EUCB 2H2FA 1NRXA 3I37X 3IUJA 4LJ4A 1NJSA 2HN9A 4P1ZA 1V8BA 1KO8A 1XCMA 4DCOA 1ADCA 3MT0A 1KZ7B 3ZHZA 2J0SA 1K6EA 3DZDA 1MGPA 3OU7A 4WNIA 5EWLB 1CWUA 3OEYA 1OB5A 3NEPX 4KNVA 1ZISA 3D8BA 2H85A 1FUIA 2FRDA 4OFWA 5FPHA 3N2EA 3P32A 1W5FA 3FNEA 1XD9A 4WECA 1R27A 3OIGA 1R1DA 2G6BA 5I8ZA 2D1QA 5I7FA 3V8BA 4J2HA 3DONA 5DW0A 1WULS 3ZD9A 2C92A 1C1HA 2WIKA 2CZQA 3ESBA 4JJIA 1YIDA 3TDNA 1SXQA 4XWWA 3CKMA 1U94A 2L69A 2VSOA 1IEWA 5F5XA 1H9BA 4LRXA 5JQGF 3HXLA 2WP0A 1GUAA 1D6NA 4Y0AA 3EVFA 5ADWA 1CEYA 2Q9UA 3IV9A 1MA3A 1U3VA 2EZTA 1RHKA 1NKTA 2LR0A 2YUIA 4GZ3A 2E37A 4UHDA 4UU0A 2B69A 1FYXA 3UA4A 1ECCA 4YDHB 2R6CA 3A6GA 3W2FA 5TMPA 4ON9A 2CLCX 1W30A 2VKTA 1EK6A 1M74A 5FB3A 1MOPA 4JLUA 5IPFA 4R9PA 1T9KA 2EFJA 2I7XA 4MAFA 1I4DD 1ZIXA 1ZBQA 2BM9A 2PMWB 2WM8A 1S0UA 3BXXA 3K96A 1M2HA 1BS1A 2HI0A 2YV5A 4S24A 1ZZGA 2O7NA 1QRUA 3FVQA 4L4ZA 2EP7A 2NUAA 2ZIWB 4POAA 1FCJA 3O90A 3ZI7A 3KR2A 3D4OA 2YWFA 4MYTA 1JLRA 2VP6A 4IILA 4EHKA 1M75A 1P60A 3LWDA 3W78A 1I5OA 1R0SA 3E7WA 4QU0A 5AK6A 1VHQA 1J22A 2O0JA 5BQFA 1ZN7A 3R4CA 1GEEA 1D1PA 1I9GA 2BBSA 1ZKMA 2C9ZA 4GSYA 5I4CA 3GJ4A 2WSBA 1NXQA 3II6X 4XDHA 2FWMX 1Q1QA 1U8FO 4W9RA 2BLLA 1B26A 4OHMA 1TUBA 4G0OA 2OV6A 3P9SA 3CZ5A 4BFWA 5DISB 1RYYA 1A4XA 3P5SA 4X61A 3DS8A 3WL8A 3ZWKA 4LOKA 5EINA 2WA2A 1L4BA 5F73A 5KOIA 3A58B 5AKEA 1Q84A 1V5WA 4OGWA 5DGCA 3AONB 1KI9A 2I1QA 1Z62A 3NGLA 4QUGA 5BSTA 1T9GS 3LBIA 2A92A 2W6QA 2WJJA 3E84A 1IIBA 2GN1A 4KXNA 3UC9A 1JHOA 3B70A 3ZN2A 2HRBA 1JA0A 4JDPA 4CG3A 5FX2A 2FETA 1N0IA 3JQEA 1N8NA 5JZOA 2O3QA 2VDWA 4GICA 3DXFA 4J1QA 4YYEA 3WKDA 4E4YA 1O97D 1I1OA 4F84A 3KFLA 2G72A 3AEKA 3FRHA 4C29A 3H7IA 1ZR2A 3ZV3A 2AOTA 4CM4A 3O5AA 2OVBA 1I13A 4F6LA 3AIIA 1UADA 3PWTA 1FMLA 4G56A 4LF8B 4E2WA 3KR9A 5E0KB 2H2HA 2V0CA 1W581 2C8LA 2JDID 1D3AA 2HA3A 2WTAA 2NYUA 1C0EA 2OXEA 2QTWB 3A2NA 1AMOA 2YQ4A 1TLTA 2Q3HA 2W2TA 4FC7A 4FW8A 4MGHA 4Y30A 1ZK4A 1C8KA 2O4CA 5AOBA 2D5LA 1WY7A 1A2KC 5H68A 1E5DA 1T0UA 1S8NA 3RBVA 3V7FA 5ERYA 4A6PA 2PT9A 4UDOA 2D2IA 3JATA 4UQLA 5JS8A 3MB5A 5AKLA 1ORIA 4ZK6A 2PUCA 5JTTA 4ZI7A 2M32A 5SYAA 3K7EA 3ZGYA 3G82C 1OZGA 4IQ0A 5IANA 2BGWA 5KTKA 1XZLA 2HMTA 1E1QA 2RHOA 3N2KA 4UAUA 4EVRA 1JU3A 2J0EA 3WFJA 1A9XA 4I19A 2WQ6A 4S0XA 3VO9A 4DV3B 2NVWA 3ANSA 4OJQA 4KI7A 3V1KA 1JR3D 2OZKA 2GR9A 2QN8A 3KKZA 5SICE 3P1JA 2G80A 1K2VN 3BA1A 3T99A 3T3MB 1RPAA 1G7SA 1CZNA 2GBLA 3BEOA 3IODA 2QE6A 3IALA 5K8IA 4JI0B 4OM8A 4DJFC 2CHQA 4D9FA 3PXDA 4NE9A 2FSGA 4J0CA 4HAXA 2N47A 4HT3B 1M2WA 4EF4A 3ZGZA 1VRVA 2HBRA 3CNEA 5GONF 2Y1CA 3WNVA 4XEHA 4O2RA 1KH3A 4G0PA 1K68A 1V1RB 1DLIA 2DPYA 3AGQA 5ALFA 8ABPA 3REFA 5DLQC 3BMQB 1RJEA 2HRDA 1E7QA 3AZQA 2M98A 3B48A 2V5AA 2C5HA 3SZMA 5ECWA 3MLAA 3IEXA 4N3GA 3QMVA 5E9QA 3OCVA 3FLMA 3IUBA 2WJ6A 4YB8A 1X39A 1B1AA 5JSKA 2AG8A 4YYZA 2GFHA 5E7IA 3VC2A 4LRSB 1W8IA 4LV6A 1K8YB 1V48A 1DU4A 3NHMA 3Q72A 2GAAA 5KHAA 3WLHA 3ZDEA 4FILA 2QD4A 3OM9A 4PZPA 4RANA 1NJGA 4YJ3F 1USVA 4R1UA 1NQXA 4LZNA 3I5XA 1TMGE 4G4IA 2B25A 4QQNA 1KPIA 1GYQA 4HNUA 1JXAA 4LE1A 3WSVA 1ZD1A 3D0OA 4I0WB 1E0JA 1OU4A 1P0QA 2JFWA 3OOHA 1KE2A 3ZJTA 2M6LA 2VZ9A 3MINB 2KLHA 2QTHA 1OFIA 2QROA 4CVNA 2BIFA 4CQMB 2BRFA 4DSOA 2AF3C 4U7TB 3OCXA 1G4UR 4GL4A 3UV7A 2FPKA 4FYPA 2C2OA 3FOWA 3PEFA 4TRJA 4EYQA 2A0FA 1ISPA 3H13A 4MLCA 3Q3CA 5FJJA 3ZNQA 1CJTC 4ZCIA 2PS0A 3DHYA 1E4OA 1TRKA 4MB6A 4P5PA 2WD9A 3NJ8A 4PLPA 3UJCA 4P31A 4X45A 1YNOA 4EBBA 2J67A 1UQTA 3EFHA 1PQ4A 4H1VA 1HYEA 2BMJA 2QR2A 3H1TA 4NFHA 1G3GA 2F48A 4AKTA 3E9QA 2GS9A 1OCEA 5BSHA 1E64A 3DG9A 1EDOA 2CLDX 4UUQA 1LI4A 1PDWA 1B3BA 1R16A 3EFBA 4IDCA 5DOZA 3FYSA 2ZI9A 2A0UA 2FZCA 3H1GA 1CUGA 1Q2XA 3Q41A 1JMVA 4J7AA 4JBHA 1OXMA 4D4MA 4RK7A 4L02A 3KYDA 4P58A 2BFBA 3ET4A 4KO1S 1DE0A 1P1IA 2QUAA 1TGVA 3GYBA 3LZDA 3N7TA 4KQKA 3NM5A 4CL0A 4EHDA 1I94B 2NO0A 2GZSA 4W5HA 1Y8QB 3FCOA 4KACA 2MT9A 3MB8A 1K6MA 1POXA 4BTEA 5BYBA 1GQSA 3GRUA 1EX6A 2JLUA 2IHBA 1A8QA 5J2UB 4UDNA 3QEMA 4GGMX 2HKIA 2CJYA 2P2DA 2V7BA 4AUKA 3P71T 2PH7A 1X1SA 5D3QA 5FAXA 3RU2A 4M1EA 2OORC 4C6HA 4B6OA 5FXMA 3D0KA 4D82A 3ZXYA 1NNEA 1ODKA 1QONA 2QG9A 4BKUA 1E99A 2BHSA 5SY4A 3PFFA 4RHYA 2DLNA 3O8OA 3VJKA 4CHGA 3K8OE 1YVEI 4HNGA 1GPLA 4WOCA 2VCEA 3LFUA 4L28A 4IVRA 4D4KA 1UFQA 1X77A 3QG5A 4BO4A 3R6WA 4JT4A 1E2DA 3HX1A 3TDMA 3OP1A 5IAKA 1Y9AA 5LYJB 4BYMA 1G2IA 1IJBA 4KQFA 3VHXB 1N8SA 3ZDDA 1XCPA 2YVQA 4IIGA 4I14A 4DYVA 3HMKA 3EZYA 4Y2RA 4HEA1 1SOVA 4MP8A 4GL2A 1PVDA 2YMMA 1N5RA 4KIWA 4S1WA 4AICA 4B44A 2VF4X 3LZ6A 5FLXA 1JDJA 4KTTE 4ZAGA 3AYZB 3FYTA 5CIYA 1K3NA 4P7FA 4E5UA 1QP8A 5CM8B 3D6VA 3AW8A 1CB7A 1P0PA 2EFGA 2IHYA 1L7EA 3W5IA 1VBKA 4FZJA 2EFHB 2UUBB 1KEUA 4JXKA 3IXLA 4KP7A 2I8AA 1CDEA 1GT6A 2ACVA 4ND5A 1ZUD1 4Y6PA 1HDCA 1SCBA 5CT5A 1L6RA 3I0MA 5TEWA 1JZTA 3WMRA 3OMXA 1G60A 3NHAA 1Y8AA 3CEAA 4XSVA 4U2CA 5EXEA 1GVNB 5KQSA 2I3ZA 1RIIA 1VCIA 4C0JA 5JI3E 2DH6A 1ML3A 3E53A 2JLSA 3Q8LA 2DUNA 4G4SP 4H6XA 1WW2A 2KYRA 3H2HA 2DBVO 4L22A 3UNMA 3K92A 4CL8A 5I7RA 1IRXA 1DFGA 2UZAA 4KFUA 4RE6A 1YQTA 1AXGA 3K0AB 3WDLA 7YASA 4FDMA 5MFPA 1DJMA 4L08A 2RHDA 2Q6LA 3OJ0A 4FB4A 1CZLA 5DNAA 2MHCA 3IXMA 4PYNA 3WWPA 3MDBA 1CRPA 1VE3A 5DGIA 3HXMA 4X1KB 4DC0A 1XZDA 1FU4A 2OMEA 3CF2A 4FM9A 3CKKA 2G08A 2R8ZA 2RGWA 2X0NA 1VPWA 2GZ3A 1HTWA 2P90A 4YRCA 5FOTA 4A7PA 4A8PA 3UBTA 1RWKA 4DLPA 3TZLA 2C0CA 5KVAA 2C3OA 2QYOA 2I54A 1MK2A 3CPSA 4RYDA 4CKCB 2NTNA 4F0JA 4TT8A 3I23A 1S7GA 3AVOA 2BBTA 4FE3A 4RNDB 4BO2A 2GZRA 2ZRMA 1LSUA 1MO3A 5T41A 4TMVA 5LBIA 1VCHA 3GAMA 4K88A 2J6HA 2WLTA 3CWCA 3ZZ0A 4CM6A 4E11A 3QEMB 1QTIA 3V1UA 2CHVA 2XWBF 3PXAA 4RPHA 5FBVB 4JB8A 2I4NA 4LRYA 1CUJA 1NXWA 2Q3FA 3EOZA 3JD3A 1E98A 1GZ3A 1XAJA 2Q5QA 2HWYA 2XQGA 3B2EA 3L4EA 5ESRA 4ND4A 3RC9A 1ST2A 2NZYA 4DA4A 3N7AA 4UBMA 2C4MA 4JI3B 1CJCA 3ZQJA 5JC1A 5KVSA 3ZVNA 3G5LA 1NC1A 2NVUB 1F60A 1YQQA 2FN8A 3MJVA 2ZWVA 5K0SA 1QNLA 2ORIA 3RUPA 1MTOA 2PPLA 3TZEA 3UNXA 4B3HA 3BORA 1MQSA 5A6SB 3ZTTA 2GPBA 4XCQA 3W6OA 5EWMA 4YAJA 2NSJA 4Z7NB 2JGAA 1RACA 1Q3TA 4FU0A 3IIEA 4X95A 5B4TA 4ALIA 2L0XA 3IV6A 2X8AA 2Q62A 3FFTA 3FPGA 1KMNA 1U0GA 1TC1A 3INNA 4PZCA 5C31A 5LU8A 1ENPA 2ZM6B 5DNVA 1I32A 1QTRA 1EFUA 4OXRA 1S7CA 3I73A 4L50A 2A2ZA 5CT9A 4R7GA 5KYNA 3EXFB 4PVDA 4WK6A 3I5AA 4KJZA 4M1TA 1CVLA 4OK5A 3SFTA 2HMYB 5C8XA 3K5HA 2IYVA 3OAAD 1XRQA 2I1WA 3VTFA 2FPUA 3TR5A 1OLXB 3RYIB 2XD9A 4IX9A 2E85A 2O57A 4RD0A 4Q7EA 5K2MA 3VU0A 4YHHB 1IY8A 3S55A 3ELUA 1KJZA 3LVRE 3R20A 3OZIA 2HA6A 4FDUA 5CR9A 3KQNA 3TNJA 2DRIA 3LT2A 3MNFA 4P7JA 4AJJA 4KQ6A 1WX1A 3AF4A 2BH9A 2ZUCA 1T4MA 3MYYA 4GX1A 2QBYB 2HADA 3CEPB 3S2ZA 4WACA 1NE2A 1C9KA 3DUFB 2PX8A 2LD4A 3NBKA 3RVMA 3ZY2A 5A02A 3UHOA 2QQGA 1EX9A 2H5EA 1CUDA 1U7TA 1JLKA 2XZTA 3OQ1A 5AOCA 4DIOA 5BT8A 1VSVA 4PIMA 5C5CA 3ENKA 3A9SA 4JS0A 2ZPTX 2PGOA 4GWGA 1O0CA 2QXUA 3TE7A 1EG7A 3S8EA 1VJTA 2BGGA 1DC8A 4NCBA 3HFJA 1C41A 5CPFA 3AEYA 3I01M 3A36A 3QVUA 3WL4A 2PKEA 3RJ5A 4NZZA 1KGDA 2PUFA 2WUEA 1VL1A 1PJZA 4F21A 1JKXA 1KMMA 1FFBA 1VXRA 3VQTA 5B2EA 4RVCA 1M2NA 1X94A 3UF0A 1TCVA 1WUKS 4E3ZA 1KJ8A 5K3SA 2OPBA 4HWTA 5K0JA 3QHQA 2PRIA 2FZ5A 5G40A 5B55A 5COBA 5F35A 4GXNA 3SC2B 3A9RA 2QRNA 3HGMA 4BKOA 4HNAB 3SJZA 3T0IA 2JGIA 4I6JA 1WCXA 1C8BA 3O4VA 4S35A 1UDCA 4I8IA 5CITA 821PA 3GBSA 4LOLA 5LXTB 2QWXA 1A8IA 1PJ3A 1TT5B 3UGJA 4EHNA 1MO4A 2KPOA 3PI6A 2CWDA 4IINA 3EZNA 4O4HF 3U39A 1RTTA 3WL5A 2QYTA 3D9QX 3A3YA 2FPPA 3VPBA 1AKQA 3QU4A 2WIAA 1S3FA 2I55A 3UATA 4Y2TA 4HZUB 1DQZA 1JDTA 4BNNA 4CLDA 3UMVA 1J4QA 5KYUB 1CUHA 1CZRA 1BXRA 3JR7A 4PNZA 3ZOKA 1VSQA 2ZJZA 1G64A 1M6NA 3AU9A 3FTCA 5DDIP 5DWQA 3T5CA 5J23A 4M9CA 4MUYA 2YN4A 2HSJA 3C85A 3FCSB 4YRRA 5AXBA 1NFFA 2H92A 4ETNA 4WJKB 1FE8A 3JQ9A 2YIMA 3ZZ1A 3AEQA 5BQ5A 3ZWVA 2C57A 4CV2A 2VTKA 3PE3A 1IXZA 4IGIA 4EVSA 1Y3BE 3TPZA 4HNAA 1O4WA 1IVYA 1CUWA 3H4IA 3DD5A 5EHQA 3W4IA 1DC7A 1EFPB 4KBGA 1G7RA 4JP1A 3HLKA 3AVWA 3GYGA 4GRIA 2X7JA 3CRVA 2CC2A 2HJWA 4BV3A 3Q3IA 1DPGA 2QK4A 3G0OA 1T0PA 4PM4A 3T06B 3UMCA 1CVIA 4ZI2A 3IDAA 3FVRA 3T5GA 3OCYA 1V47A 3EXEB 4DMHA 4TRMA 1Z0AA 3QBDA 4JUAA 3SJ7A 3VAYA 1W96A 4C7XA 2ARKA 4BY9E 3OWOA 3CLTD 3W4JA 1QDEA 5KX5B 2GARA 4REMA 4ZDWA 5JCJA 2VC2B 4AP6A 1EJ6A 2I6TA 1RE1A 5JCXA 4XSHA 4HRAA 4K3UA 4XPIB 1QAMA 2GJAA 2VP9A 1R0ZA 4IF4A 4UHKA 3Q9UA 1KWKA 2XWPA 3V4SA 5AVTA 3NWPA 2AMJA 1ZH2A 4YDSA 1K98A 1EA7A 1U2EA 3NBUA 3PFGA 2X9VA 3B3FA 1E9AA 4YONB 3ND5A 1QIEA 3WOVA 4AKHA 1N2CB 1V1MA 4KLAA 1ORWA 5CA0A 4DFDA 3F2VA 3VSDA 4XW2A 3CZPA 4CDRA 5IJ0B 3AF6A 4C0AC 2BCJQ 2Y0PA 1BD4A 4LYGA 3N28A 2M1ZA 1WO8A 1H6DA 3TXAA 3UXHA 3H04A 4ZCLA 5G2OA 3TTTA 1JVBA 3GP8A 4DGSA 3E1SA 4YJHA 4MWEA 1ZC3A 1GPUA 3OSZA 1U5AA 2IODA 5T67A 1WQ1R 5BYJA 1OLOA 1G8KA 4ZCMA 2QL9A 1H5UA 3TCKA 3KJIA 1CUBA 4KYTA 4UXHA 1FFGA 3VOSA 1NVKA 4C14A 4HAIA 3KUUA 4WH0A 5ERXA 5AIAA 3NXKA 5EJ9A 4ZZ0A 3R3VA 1GPKA 2EL9A 1LNZA 1P6UA 1UOOA 2NV2B 2PLWA 4O59O 3U4GA 4BLRA 2VTBA 3COZA 2LCQA 1IYZA 3ESCA 3PK0A 2BKAA 5KPJA 2AUTA 5KPDA 3TW8A 4OUDB 5FOXA 1ZFNA 1XB2A 2X2OA 3V2UA 4BNLA 2EHJA 5CD1A 1Y37A 3NFYA 2GERA 3Q10A 4D4LA 1RRVA 1V6AA 2GN8A 4CLHA 4RH1A 4CMCA 5CBPA 2FJUA 4JK3A 5D3KA 4O02B 3IVAA 2GD2A 2BTOA 2IYQA 2FZWA 4D80A 3WGUA 3V7NA 3B20A 1DTWA 9ABPA 2VYVD 2H48A 3BEDA 4LOAA 3HLYA 4DCCA 3I9LA 2OZLB 3L77A 2FZ4A 4LISA 4MS3B 2CBXA 2JCBA 4Y2YA 1KHUA 4K40A 4RD6A 3NHBA 3IPXA 1GKKA 2GHTA 2KI5A 4RZQA 4TLCA 4UCXA 4O4IF 3V1MA 4YK7A 4B1FA 2FUG1 4PG5A 1D9XA 3M5CA 2GAFA 2LRHA 1XAGA 4PRZA 2QW1A 3EIUA 4Q1VA 4C4PA 4DSAA 5ALUA 2WFLA 3NC0C 1EFKA 1K7EB 4WQMA 2B5VA 3AHHA 1ZD9A 5A1JA 4LGMA 4PPFA 4DTCA 1L3BA 3E22B 1MPTA 1TM7E 3Q1LA 4ENSA 2WLSA 3UMGA 4R1MA 1YAHA 1WDKA 3O3CA 1NJ1A 4AB1A 5NULA 2PZGA 1KI6B 3OE5A 1F5NA 1QWSA 1TXGA 4BV9A 2X4GA 2F6RA 4YAWA 3TLEA 2FWRA 5KJ6A 5HTOA 3ADDA 5KOHB 1TTQB 4FI3F 2A5GA 1ZONA 3SIPA 4E5PA 1XZGA 2HQBA 4ZICA 5C7OO 5CLFA 3IVRA 2VJMB 3P19A 4Y3UA 3I8OA 3ZHUA 2G0TA 1D2HA 3IQEA 1HRKA 5AVKA 4EKGA 4YBRA 4I55F 1EWYA 3CUWA 5D1NA 4DBLC 4E1BA 3T1HB 4OHPA 4J3FA 3LGAA 3GVIA 5DLYA 1HQKA 1VJ1A 4LJAA 2HA0A 3F5DA 4XJSA 3I4LA 3B2QA 2ADMA 3FRIA 3TG8A 3B85A 1XA0A 4J0DA 5DNUA 1UODA 1ULTA 1CSEE 2FZKA 2J9FB 2PX4A 4U7GA 1NW4A 3TNLA 4F6RA 5KNBA 2CB0A 1Y4SA 3HYTA 3TS1A 2FQQA 3NANA 1UEXC 4IKPA 4ZAFA 4R2JA 2FFAA 3GLHA 3ZV7A 4HWPA 2YFHA 2X0JA 3T61A 3I6UA 2ZCVA 1P2BA 3V7WA 4GOOD 1GGKA 2RB5A 2Y0EA 3FYUA 1KZYC 2X8LA 3DMTC 1JLLB 2WWFA 3LP8A 1RU3A 4CNBA 3R6LA 4PAWA 1KNQA 5CXXA 3J81A 3DFFA 2C94A 3QITA 1A9QA 4EMTA 4ARVA 5ARCA 4P4SA 2ZKIA 2ILTA 3CWZA 4NG4A 2DECA 2GF2A 2YJ3A 2FU5C 3INGA 1IK6A 3IV7A 4P3XA 1GRVA 4M8KA 4UZEA 3FPJA 1UFRA 4WXRA 3RSGA 1NDUA 2J7PD 3BKWA 3ED1A 1E2LA 5JVDB 1H69A 2HU5A 5DLDA 2C4TA 3GU3A 2EJTA 3VVCA 3U6KA 1QIKA 1PNTA 1TI7A 1DX6A 1L4MA 1LWNA 3MRVA 4IDOA 5DJ5A 4FYWA 4XWAA 3TECE 2FV8A 3WQQA 4CTKA 4JLSA 4CEHB 1I51A 1PNOA 2GZHA 4IF6A 4PZUA 1TAGA 4WN9B 3CMCO 3UPUA 4MRSA 1A5AB 4J76A 3DC7A 3ADCA 4HDRA 3GN1A 3WIBA 4EJ0A 3I6YA 4KXUA 5FBQB 4BU0A 3TBFA 4S05A 1XRSB 5C51B 2P11A 3OOJA 2GX6A 2OHJA 3TM4A 1NRJB 2VJPA 1CY2A 1E0DA 2HDOA 2R68A 2ZG6A 4O2AF 2C2XA 4XQ9A 4QTYA 5J9FA 3WTBA 1TMYA 2FQWA 4JKYA 3JWGA 3RADC 5T8KC 3BRWA 3QLVA 3ZCRA 3C15C 4TV8A 3ET5A 3D0QA 1N57A 2XUOA 1NIJA 4MYCA 4U9IS 5H80A 3I0ZA 1GL6A 1YB4A 5JAQA 3ZI0A 1KQ3A 1G41A 2PD3A 2WF6A 2XTMA 3HG7A 1GGJA 4PPNA 3WLSA 2X9QA 5B1DA 3KVYA 1N7JA 3AL2A 1GR1A 2NADA 3MERA 2D3WA 1EXDA 3ENZA 1RC8A 1SEVA 4ZVQA 5GWXA 1FRZA 3VDNB 4E70A 5L3SB 3T4XA 1NP7A 2F3PA 1T4BA 2XIJA 1QYDA 1YONA 5EMMA 4MKGA 1O2DA 4HZUA 2EZ9A 1G21E 2I71A 1KC1A 1KO7A 4EABA 4NR0A 5DRYA 1HQCA 1QHEA 4YT5A 3AJEA 4PRKA 1X7DA 3QOYA 4IQ4A 3ZHQA 4F2WA 4F9FA 3STWA 1AQNA 2G9QA 1TT5A 1JJIA 3KE8A 5LYJA 4QDZA 1ZOLA 4FSDA 3REQB 4R9NA 4TS4A 1RZRA 2GLTA 2A9KA 3RSCA 4UVEA 1MOQA 4XVUA 1G0NA 2H17A 4R1NA 3DEYX 5F7XA 4ZAZA 5ECYA 4Y8VA 1E1CA 2A57A 4C88A 4OGGA 2ZB4A 3HU1A 2K2QB 5HZHA 3RK4A 2HV9A 3O9VA 3PNVA 2XZLA 2PKCA 1NR1A 4LF9B 1BCSA 4WOKA 1KBZA 4H1TA 1ZVMA 4XUEA 3HM2A 4ZV9A 1TW2A 2JANA 1KQPA 2DT8A 2CZGA 3HP1A 3LGSA 2VLIA 4AZWA 1PBTA 4PAQA 3QUSA 4O0LA 4P86A 4WGGA 1Z5VA 1UIRA 3F0TA 5LBUA 1KEEA 3VDMA 3HYLA 4UE3S 3I39X 3O8DA 4K87A 4ASUA 5A5VA 3C6KA 2X3FA 4F60A 1EWRA 3M4NA 2GLXA 3MWEB 2QG6A 2M6KA 3VVBA 3Q8KA 3RC8A 1GA4A 5KYYB 4U9HS 3M7IA 5AIBA 1M6VB 2FZLA 5CDFA 2FZEA 2GBCA 1N5JA 3O6VA 1V16B 3SZUA 3DPSA 6ABPA 4MJ3A 3NOOA 2DBRA 1HQDA 2XZOA 3FOZA 2ODNA 2O54A 1U7HA 1TO1E 4OQFA 5LQMA 2HCTA 5B58C 4NDAA 4OLJA 2OD2A 5FF9A 3JSXA 3WG9A 1T2EA 3OURA 4Y6RA 5KI6A 3PTLA 4JL5A 4EHLA 3AVXA 2VI5A 2FG6C 3AJAA 5LP1A 1CZKA 1CVRA 1XC7A 3FUCA 3JAWB 4JVNA 2EATA 4RD1A 1ZNWA 3WYAA 3ETDA 1NU6A 4A36A 1UOEA 3HN6A 4QHSA 3HQ4O 1ESEA 5I7VA 5G0UA 3IOCA 3BE4A 3QMWA 4TKUB 1K75A 1PL6A 2ROQA 2DE0X 5JYDA 3V1YA 5LZ4A 4RKWA 3TQSA 3CXUA 1AOXA 3EG9B 4L6IA 1QYVA 1VL5A 2QGNA 2Y1XA 4ECAA 5B3KA 2NSHA 3HL0A 1U0TA 1Z8DA 1IFXA 1T2UA 1XCOA 2HQOA 2O8NA 4PCVA 1MX5A 1DQRA 2HZ7A 4L4SA 4C3ZA 3Q9SA 3MMSA 1AUXA 1K8ZB 3NHYA 2I2FA 3PL5A 1JG7A 1VB3A 5KNDA 1U8UA 3HO6A 2V7PA 2ZBEA 3SQNA 3B6JA 3FHCB 4GKAA 2VH2A 1T2NA 4ZAWA 1TA0A 1J2JA 3M81A 2FZGA 4P3PA 4EM6A 2PLNA 4X1KA 2AI2A 4I4IA 3A10A 2PM8A 5FV7A 1L8QA 5HXAA 2NXNA 2FKAA 1JFVA 1M2VB 2HREA 3LA8A 2A0WA 2QRZA 2B21A 2ZANA 3E5RA 3E9CA 4GQBA 4MUEA 5GJBA 2GO7A 1SXJD 2UUPA 3ZWXA 5C5IA 1Z5NA 2WG0A 3KQMA 4EF5A 3WISA 1MZPA 2O8EB 1HDRA 3B60A 3PO8A 3ESQA 1N2HA 3ZOZA 4DG9A 2NX2A 5C80A 4D0RA 4PNHA 2JBAA 4UUBA 5JQGA 3EVDA 4JXJA 3JYPA 4EGQA 5SZJA 2P4SA 4GPAA 4GNRA 2JI9A 2POQX 3HCOA 4YO8A 4H08A 5KYVA 3TCXB 2P4UA 4ARIA 1Q6ZA 5WRFA 1H6BA 3KV1A 3W5CA 2XODA 4F85A 3RAJA 1SXPA 5EJ4A 1W36B 3TFOA 4QQKA 3MWFA 2N46A 4B46A 4BXOB 1Y6ZA 1YB1A 2IELA 1Z39A 4RJJA 1N5OX 3HP4A 3TL3A 4WXYB 5EMJA 4ZEXA 3PUZA 4LXTA 4MYSA 2GASA 1EVKA 2LIVA 2X9LA 1M1XB 3N59A 4I2NA 3D5EA 1H4VB 3WK4A 3RD5A 4AURA 1A4IA 1JAXA 1PAUA 2WZBA 3AK4A 3GK3A 2QE7D 3QE2A 5FWDA 3V42A 4PFQA 3JARA 1QBGA 5KYTA 3IHWA 1K8XB 4AT1A 4L4YA 1P9NA 1ZM2A 4PZAA 3WTCA 3IEIA 1NATA 1UMBA 3T8YA 3GH3A 3RANA 1N9GB 3DE5X 2B4TO 1DXOA 4BV2A 1UMCA 3G1UA 3DT6A 4KX5A 3A4VA 4MUIA 5JAMA 4TMZA 4B7ZA 4E2YA 3CBGA 1XALA 5LJLA 5F9MA 4DIBA 5KQGA 1AGPA 5LKRA 4FVTA 4LN1A 4OB7A 4DILA 2XHEA 4FEAA 3T9BA 1Y7HA 2OVFA 1ORDA 1LNSA 3ONEA 3UHFA 1NBIA 2DTDA 2FMUA 2VUHB 4HGOA 4YRZA 2XITA 1PR6A 4LBYA 4P54A 4WW0A 2OHVA 3KT6A 5IT4A 4PGGA 2CLIB 5ANRB 3KELA 2AFHB 3P9ZA 1LBQA 4Y2QA 3UAZA 4BMOB 4EI8A 3U81A 5IX8A 5BVHA 1AE1A 1GUZA 1XQ6A 4BHTA 5LA6B 1SA0B 3LWBA 1EUDB 4FUTA 3T4EA 1XZNA 1U9IC 4BO0A 3VR0A 3L41A 4MPTA 2ODAA 4F97A 1A04A 4LY3A 2Z1NA 4KOEC 1YUNA 2YWGA 4XH9B 4ATNA 4A73A 5KTNA 1EWVA 1G16A 1H0RA 2X40A 4MMZB 4WKPA 2P91A 5IG2A 2AS0A 4YN3A 4MP3A 4EFNA 4KAAA 4M0PA 3KXPA 2PBLA 3K9HA 1QYCA 1E1YA 3OI7A 1M8GA 1XTIA 2VPQA 4NJMB 6YASA 1FTWA 2G28A 3DMYA 2OORA 3CZ4A 3R3JA 1N2GA 2RJNA 3KPYA 2FI1A 4ZO6A 1QP7A 1WY5A 3AFGA 3TLAA 1OVGA 1PWHA 2OCAA 3SYMA 4O63O 3CH4B 2BYTA 1T8YA 4BCCA 4DC9A 2I6GA 3GJTA 4UTVA 1QKKA 3ZJ5A 2QX9A 4AROA 4B6RA 3WZ2A 3S1LA 1SKAA 3QPDA 4K9DA 5CHYA 1L7PA 5D3ZA 2I80A 4DIUA 2HWXA 2ZJ0A 2XCUA 3R9WA 1DJQA 2QP9X 1JN0A 4JXZA 3RRYA 3DKVA 2VUSA 3B6MA 1UPTA 3LIPA 4YCLA 4FDAA 4K28A 2X86A 1YJMA 1CUEA 3Q85A 4W1RA 4YT2A 3FHTA 1JR3E 4F6RB 3DZKA 1FLNA 1HT0A 2FW8A 5E4YA 4AJ2A 3V4RA 2PANA 2VWGA 1RXEA 3O73A 2AEFA 3RTAA 3WYDA 3KXIA 2L42A 3FDZA 1FZTA 2FEOA 1IULA 2N1MA 1U4OA 1V3VA 2F67A 1Z56C 3B9RA 4P08A 1ZK0A 1LZLA 1HNWB 3ANYB 3H9BA 2HAEA 2B83A 2OR3A 2P9TA 3O91A 5GGYA 3ZK8A 3L4BC 3H19A 3N8IA 1ZIPA 3ICPA 1P4AA 3I6ZA 1A5TA 1DTWB 3L6OO 1IAQA 2XUGA 2VDOB 2WJVA 3GD7A 3KETA 3G0BA 2G77B 4F38A 5A2GA 4NJMA 2IHJA 2V3WA 3BWDD 3KB2A 1IATA 1N5KA 4YRDA 1G8SA 5F3DA 4ZFNA 3LDHA 2YRXA 1QRRA 2O2YA 3KB8A 3ZD8A 5KU7A 3QX3A 4CV3A 5B7PA 1FFAA 1X7XB 4ILEA 3WRWA 2YOFA 3I3OA 1G55A 2FE4A 4R7ZA 3WK9A 1DCTA 1TIPA 4FP9A 1V5GA 2AKEA 4DLRA 2VQFB 2K2WA 3NHWA 4A8JC 1M2FA 1UC9A 2J9GA 1P9OA 4C4YA 3FETA 1E7SA 3AUAA 3HXOA 1HEIA 2CVPA 3MTIA 1FDRA 2HB6A 1FBTA 2WM2A 1CY6A 1NF3A 5IBQA 3WQRA 4NAVA 3GCWA 4FGLA 4R2KA 1L8LA 3WY9A 2YHIB 1C9MA 1XLVA 5DB4A 3UXEA 3IUQA 1YMUA 3LKVA 3NW9A 1O8BA 2X6RA 3D5TA 5EIBD 5DBFA 2QL7A 4JQYA 4GEKA 1KVRA 1YQ9A 2FTKE 4XPZA 3S99A 3HZOA 3STYA 4KJXA 2IZZA 2EZUA 5FWNA 4R0MA 2GEDA 1LS1A 1QK4A 1XDBA 3FWKA 3Q6IA 2VR1A 3B53X 1LPMA 2AOUB 2BFMA 2OSVA 4OY3A 4YCMA 4QOGA 3BG5A 3OZVA 4JVOA 5ALNA 3VA7A 1JRLA 1J39A 4A8JA 1X1AA 5HUQA 3F78A 4DA0A 4EA8A 4ENWA 3GCGA 4OGFA 1Z38A 2O7VA 1S9HA 4YRFA 2FXIA 2JRCA 3CNBA 4OPMA 1P0CA 3KHSA 1O94C 1Y4DE 4YAUA 5LQCA 2A5FA 5LOVB 3PXGA 3EZLA 1FS5A 2O0KA 1WDMA 2NSDA 4WBNA 4PLFA 1IG0A 3U4CA 1TRHA 4JJ7A 3FCEA 4JLBA 3W5SA 4G01B 2OHFA 3QTTA 3KKPA 3ZGLA 1R8XA 3GGCA 4N5IX 4EGAA 4CIWA 2OBNA 1OZAA 1SCNE 4WCDA 1Y1PA 2O1WA 1IY1A 2O6LA 3KPUA 4JUIA 4WUTA 3OX4A 1JPUA 5E3HA 3FM8A 3HDQA 4Q03A 3KXDA 3ZWBA 4C3UA 3FSGA 4ZU6X 5AD1A 1O9BA 2GK4A 1LX7A 3NHLA 5HTKA 4MWZA 6ADHA 4I3FA 4RQTA 3U7JA 2KB0A 4KPUA 4H7FA 3TFQA 3E0QA 9ATCA 2VBFA 3SEZA 1DRUA 1OXBB 1RCUA 1XKTA 1ZK2A 1R15A 2EL7A 2ZRKA 5I3ZA 2ZSFA 3D4IA 5F3WB 2ZZNA 3NALA 1E2JA 2WDZA 1K06A 3CEHA 5JDIC 5F2KA 1D6SA 3PR2B 1U6IA 5A05A 2RKBA 1DS6A 2ZJBA 2Q7OE 2BOVA 3M49A 4CYMA 2NPIA 1BW9B 3OJXA 3VNBA 4M0EA 1RJDA 2AKYA 2R1VB 1Y0BA 3ZHRA 3A06A 3C8MA 2R1ZA 4B71A 4KR0A 1YI8A 5IKOA 1APBA 1JEYB 3KQLA 3A4TA 5FOQA 1U7WA 3DE1X 3K6KA 2BMAA 4FFDA 4G0QA 4RA9A 2BKLA 2D0IA 1I3NA 4OHZA 5TDHA 5CX4A 4TWRA 4YAKA 4PCUA 4RHCA 4BFZA 2PUWA 1CJSA 2MOKA 2H0RA 1SUSA 2O2EA 2QKYA 3EYAA 3KL4A 5DZSA 4WK0B 4TXNA 4TRRA 2JEZA 2Y99A 3GMJA 2JLCA 2FX2A 2XNSA 1NI4A 3ONFA 4W82A 4ZT6A 4ZT2A 5JNVA 4EDFA 1QIGA 2OQRA 3AERB 2NTEA 2Y67A 4KQWA 1NN1A 3SKXA 1BKYA 3K1AA 1MEEA 2HJ9A 1VHWA 1AZSC 4KBYA 1ISRA 1QHNA 5E1DA 1UWVA 2GZ2A 3GEDA 5D6OA 4IVNA 1M76A 1WPGA 4R5MA 1EB8A 1FFCA 4ZARA 5EIXA 4QAQA 2OV4A 2C58A 4YQEA 2VNIA 3OVMA 5CBKA 1OFVA 2OBFA 5DNEA 5EJ6A 5A7HA 3INRA 3SD7A 1ZRMA 2OOSA 4EI2A 5ABPA 2JCGA 1RIFA 5FPYA 4JJKA 4GI2A 2VHQA 2WUDA 1RZVA 2YMPA 2ZDQA 4WSOA 4LQCA 1BCRA 2COUA 1UKAA 3HN2A 1T1RA 1ZIYA 2OWEA 3PG5A 1W2WB 2RIPA 1Z18A 1OH6A 1CQIA 4M1WA 2PUAA 2GRAA 3BCHA 4HPJB 4EARA 2HRZA 4BEVA 1QH1A 1ZXLA 3MIIA 2W9XA 1YDEA 3MUFA 1QTNA 4HB0A 4RLHA 2AQKA 2J5XA 1WDTA 3IMFA 4JGGA 1BQ3A 4F96A 4CU2A 1ADBA 2EWMA 5BYAA 5BP7A 3BMXA 2WWHA 1P75A 1GAJA 1Z6PA 3C3YA 3IIMA 5HA5A 5IEBA 1X2BA 4UUAA 4BLPA 1JDUA 1PQPA 5B37A 3ZDAA 2ZSAA 1DMRA 3R5SA 4KRFA 1JDBB 1VSBA 1YJQA 4M0DA 3LFTA 2VDPB 5ALSA 4DLVA 2VJKA 1A2QA 1HOXA 1YBVA 3BTUA 4LC1A 2XRFA 2J08A 4P0TA 5LMNB 3V3KA 1WSAA 1JR2A 2CGEA 3HBFA 1SHTX 4LSMA 4DRXA 1EUCA 1ZJJA 4XR4A 5DXAA 2GPWA 1PCXA 1MC5A 1G59A 3FR8A 2HNAA 4Z8YA 2Y3IA 3QU2A 4PO8A 5TE9A 4E13A 2QXYA 3KSDO 4YLYA 3QA3E 2WIGA 2W22A 3RS5A 4EJ6A 2QEQA 2IIQA 2YXPX 4F5DA 2PMCA 1N2IA 4NULA 3S8YA 4QYWA 1D8AA 2PRKA 3FMGA 3KR0A 3TKYA 4COKA 1RPNA 2RGNA 1W29A 2C5SA 3O4RA 3Q9LA 4CWAA 1AKWA 1RZUA 5DNYB 3UH1A 3TLZA 4KYIB 3HCBA 2KW5A 3DW1X 3LUFA 3NOXA 4JSYA 4OFZA 5FYDA 1EPUA 3FMVA 2WYWA 2QV7A 5G53C 1KK3A 3SYRA 2C2MA 1BVRA 2QU8A 3MWEA 4JU9A 3G5TA 1ZUIA 2K7ZA 4W7IA 3QF4B 4FLEA 4OHBA 4DQDA 1NVBA 3E3MA 3CCCA 3KRTA 1E9RA 1P61B 3RAEC 4HJRA 1Y5LA 2WJYA 3RV4A 5IF9A 1Y4ZA 3RF6A 2UZ1A 4NPCA 2YWDA 4JYAB 4BEWA 3TNFA 3MMNA 1P8AA 4G84A 4NYJR 5DVZA 4A3SA 2C4KA 2WVJA 1XELA 4HXFB 4QU5A 4ZGGA 5EOVA 4D81A 4P32A 2Y1DA 2VTVA 2ZWPA 2ZDHA 1BOOA 2ADFA 3FWYA 1TVCA 3HGTA 3QTLA 4FUQA 4AAYA 1P7PA 3FTDA 3KIPA 4H1HA 1VRWA 4YALA 5ALWA 5K3OA 1MIOA 2AEEA 3GMTA 4DIDA 2O8CA 5B57C 4F92B 1JVNA 2AQ8A 2Z1DA 1HYBA 3GAAA 2RKWA 1JIQA 5HG0A 4R1OA 3KZVA 1KSHA 1GTJ1 2Y8EA 4AJHA 3GT7A 5DYWA 4ESVA 1UBLS 3RC3A 4NCHA 4LJRA 1N3YA 1MV5A 3VHXA 4RTJA 2VHZA 2XVYA 4ETWA 1UJCA 4YCJA 5KAMA 2ZLBA 3K0FB 5A3VA 4IGAA 1E6EA 2JBAB 3LTNC 5TPZA 3CLSC 4RSMA 4CL2A 1OXUA 4GMKA 2X1MA 1I6WA 4B6QA 13PKA 4I5FA 3O8BA 4S1TA 1DLJA 3AR3A 3S5JA 3OPYI 1MX3A 1QH8B 4RS3A 4WK4B 2QVCA 4CM9D 1W4RA 1NBOA 1NUHA 2M6RA 2Z5GA 3KKOA 3Q3VA 2ZJ6A 3O4GA 4NMXB 5CMLA 4LRTB 5JD4A 1V4NA 1V7CA 2C8VA 3R0VA 5HS6A 3VVLA 4CKBA 1YULA 2YN2A 1CS4C 3K31A 5BSGA 1S8OA 5CGZA 3A2KA 5BNWA 1C7FA 3BWYA 4EY5A 1YS2X 2KBFA 3VX3A 2SKDA 4ARBA 2AH5A 1PUIA 2JF0A 1LI5A 3FYUB 5CW1A 2O50A 4RL4A 4C1BA 4EPVA 3K3PA 3I12A 1ODFA 2I4TA 3JQRA 4RF5A 4YTEA 4A2PA 2BTEA 3CSSA 3P7MA 1N0VC 1F4LA 4HAWA 5K3CA 5J43A 1Y5IA 3E7FA 3R7LA 4FFBB 6REQB 1U3GA 2DBYA 4CLXA 2JFBA 4RGVA 2IY7A 4NONA 2JRLA 4ENQA 3DAGA 2NUTB 4RHEA 5TS2A 1RT9A 4BX0A 3FFWA 2WILA 5JATA 1LC3A 3B1FA 3OWXA 1A76A 4LE0A 1V11A 5HKKA 2HIGA 2Q3CA 4R9RA 3DE2X 5E9AA 4IIJF 2ZRCA 1BG6A 1UKEA 5U4XA 3QUTA 4ZT5A 4PICA 1N0WA 4F06A 3RYCB 1NXOA 4R69A 5FORA 4BBJA 5CVTA 2MYTA 1G0OA 5MFZA 2DOKA 2CFRA 4KAXA 3NIDB 3I6IA 3ONNA 3VDXA 3WGMA 3ZIAA 3PVCA 2E6UX 1JGTA 2JJ1A 3FGNA 4RLQA 4MUFA 4NL4H 4D3ZA 5FOVA 1P74A 2JATA 2RHBA 3M3HA 2IE0A 1FMTA 4HF7A 4IIYA 4HPXB 2WUFA 1XDZA 4FFRA 5IVHA 1RDFA 1U81A 1WB5A 4NTZA 1FTQA 3AUJB 3T7AA 2GJSA 3C8ZA 4FJ0A 4WWHA 3D8UA 1KBQA 2PNFA 4LKOA 5AKIA 4D4IA 3S81A 2A9FA 2PH1A 3E22A 4QVIA 4PYMA 1TVMA 1GZVA 3X1YA 3P0HA 3GCXA 4F9TA 3IAUA 2FXVA 4B32A 1L8AA 3BMCA 5AR1A 1XDWA 2WFLB 3LY7A 2FW6A 2ZTSA 1N9ZA 2HJGA 3OTIA 5JERA 1JKJB 1PN3A 1NBHA 3MBOA 3QLUA 1P3DA 1OOEA 3EXAA 3Q0TA 3I2IA 3P9YA 2A8YA 3A3KA 4L0DA 5HEKA 4AZ0B 1QB7A 3N53A 4A4DA 2XGOA 4N47A 5KYWB 1NJFA 2IY8A 3D4PA 1GZ6A 2PX2A 2W6PA 5I47A 4ARAA 5TLSA 3I1YA 4LWOA 3TBKA 3ZWYA 3FB1A 2BJWA 3JQAA 2VJMA 3H2SA 1N78A 3H5OA 3IKLA 1HMPA 2OCYC 1YOBA 4G3XA 1NI4B 2GN6A 1G2QA 2E48A 3WLOA 4EKEA 3S1SA 3CUVA 1RI2A 2ATXA 4EW3A 4DYHA 1VKJA 1PR3A 2IBSA 3WIUA 4GBED 4WZ6A 4DF3A 1RI1A 3GRYA 1TZMA 4E5NA 3DEAA 2FHPA 1SBZA 5B53A 2JLRA 4A6DA 1J2YA 1QFMA 5BRAA 1HE2A 3NU1A 1UQUA 1NVGA 1RCTE 5F1YA 1N77A 4HN9A 2CXUA 4ZIRA 3I83A 2XJ9A 3BMNA 1KI3A 1LY1A 1ACMA 3FA2A 4M60A 2XNCA 4PTZA 2X8BA 3QELB 3CYFA 3FAZA 4LV5B 2ZTHA 2IXEA 4Y6SA 3AERA 1FX1A 4JV5B 4GRAA 2EERA 4Q5IA 1H2YA 3GLFB 1IXKA 1BQ4A 3H86A 2QSYA 2ZJ7A 1NGSA 3PCXA 4M1OA 3PKZA 2IP2A 4L5JA 3RRBA 2OBYA 4GOND 1R5OA 1PWXA 1E5TA 2Z2ZA 5JHHB 4JFAA 4E3WA 1E3TA 2B92A 5H81A 3A25A 5INTA 3ZV5A 3RW9A 2NYVA 3QNWA 1FUYB 5ALIA 2XADA 2ZUDA 4HNSA 3UQYS 4M6WB 4E32A 1JHXA 1E2NA 3T7DA 3UJNA 5FQNA 4DR4B 1LCIA 1ZSYA 2Q4RA 3HADA 4J49A 1SVWA 1EU1A 4M8IA 3H5RA 3NFRA 3OO1A 4R2MA 1IEXA 4C0XA 1QAOA 2JQIA 2W7TA 2SKEA 1E3WA 4Q9AA 5K8JB 2Q6IA 4MITA 4ZYTA 5TGDA 1AGXA 1LXCA 1THTA 5JMPA 3RS9A 2PZLA 1Y8CA 4RAQA 2XPCA 3ZU2A 3BREA 1CUAA 1UM8A 1T91A 1RRMA 3L0DA 3TTUA 3UHJA 4TUYA 1Z4NA 3OY2A 1NW3A 2JEOA 2RHTA 2JARA 3D2CA 3QI7A 4KH0A 4ME6A 3UN0A 4OQZA 4Q4JA 4O4JB 1R9GA 4R9UC 3S70A 5AW8A 3BF7A 3NT4A 1YCHA 4YRLA 1VL8A 3TQFA 3S7TA 4N8EA 3UNNA 5B5SA 1XIVA 2ZBQA 2JJ1D 1M8JA 5EPOA 7ADHA 1L5MA 1VIMA 1EVEA 2B36A 5BT9A 3L06A 1DRWA 4FT2A 4GLOA 2PS1A 5CAEB 3MGBA 1IPFA 4D8VA 5F9FA 1YSCA 4II2A 5ES4B 2FUEA 1DAOA 1I9CA 3SIXA 1FDIA 3G8DA 4BP8A 2ECQA 3JQ6A 4ZN6A 3V1TC 4Z3OA 3IT1A 1NP3A 1RWVA 3E23A 4D8YA 1JLLA 2YWRA 3B51X 2ZE6A 3V97A 2IP1A 1DEAA 3M1IA 1HX7A 4QTTB 1EVJA 1BEUB 1WPRA 3MTQA 5JLJA 2R00C 1KAHA 2YHIA 4Q9KA 2CL5A 1QGYA 2AN4A 3LCVB 3PNMA 4UBLA 2OYRA 3EJWA 3JWIA 4AIIA 3E48A 5IULC 2HHAA 1EEHA 2A9JA 2CVQA 4RBNA 3TLGA 3OZRA 2P77A 4MEJA 3GJ3A 5EHZA 3LUJA 2WYVA 3AH8A 4UJ3A 4X20B 2HL6A 4DUYB 1WR8A 4KQCA 3RFVA 2Q5IA 3GF4A 2ZULA 3F9IA 2ZUTA 1YQEA 1JE0A 3FSEA 1WCWA 5AJYA 4HFRA 5KOJB 1X7XA 4WZAE 3TLJA 2HRCA 2WF5A 1Q0LA 4RD4A 4BMZA 4QVGA 3TDKA 3C5CA 2HSWA 1Q74A 3DJFA 2DVMA 2PGLA 2OAEA 2QA5A 4QECA 3BIXA 3K2IA 4JI2B 2C4UA 1FY2A 1BX3A 1VOTA 3FCCA 4IDGA 4D3DA 3PXBA 3LT5A 2HGZA 3G23A 1XTUA 4PN7A 4OHVA 2IZ5A 3QKIA 1W85B 3SJBA 1UJ6A 3FNFA 3ON5A 4AFNA 3IX7A 1C1XA 4EG0A 4GEGA 3JZMA 2CKMA 4DKJA 3SM3A 4N41A 2VNHA 3BE6A 3W8FA 4U4AA 2B37A 3VR2A 4AO8A 1M5UA 2PJZA 4UTRA 3OQHA 3KQYA 2R96A 1HK7A 1ZD3A 3ILVA 2CHFA 4RV9A 5FEMA 3TD9A 1DARA 5FRDA 5CB4F 4BLTA 1FYDA 4I8XA 3LHFA 3AIKA 2G70A 4GOXA 4HO1X 4BNVA 3D8HA 1E8MA 4NFLA 3CRRA 3PGMA 1RWNA 2JJ8A 4X41A 4GYKA 1GR0A 3D2AA 4YHBA 5FPPA 4BZPA 2C5FA 1AZTA 2E9SA 3MWDB 3WICA 2ZWIA 2CNBA 1M34B 3VUFA 5JSZB 4JENA 3I76A 2WWXA 3TMYA 1X1CA 4W5NA 4HLUA 3LC7O 2RSLA 5BSUA 3TVYA 2J9XB 2IHTA 2BUCA 2CNLA 4AN0A 5BN5A 3BAFA 2Z2KA 2ZRHA 4LK2A 2PSHA 1E79A 2YOHA 4OV6B 1P17A 2ZROA 3UT6A 4WINA 5A4AA 1KRXA 2X2EA 3MJTA 5FPKA 2V7QD 1D8TA 2E4UA 1FU7A 4LJKA 4P7BA 1O6ZA 5EEGA 3RH0A 2HU8A 3KUDA 5LZ5A 1PJBA 3SDZA 3SMQA 2DEUA 4EPWA 3KAJA 1CY8A 5KC8A 1P73A 4JT9A 4IIDA 4X1IA 3OU6A 1X1TA 3S5UA 2VDNB 5HMLA 1E9EA 1S02A 1TYZA 3LA6A 4L1KA 3SYKA 3H9CA 2WZQA 3JQFC 1GIAA 2G8NA 3V8QA 1QQAA 3IRUA 1CYEA 1YS9A 3CURA 4DZRA 2IS6A 3OCUA 4PQEA 5JCOA 4R6WA 2PSEA 5JXIA 2VTBB 3GRFA 2BSAA 2WFMA 2P9BA 1YR9A 2Y77A 3DP9A 3JX9A 3NOVA 1TKAA 4RCVA 1ZEMA 4V0KA 5JNUA 2H54A 1Z2EA 5I8WA 3IH5A 3HKBB 4ZANA 3QWAA 4W5OA 5ER9A 4FNGA 3DVRX 5AM5A 3VR6A 2VDKB 3ROTA 1ZM4A 4MRPA 4B73A 1P31A 2BI4A 2JEYA 3VZCA 1NA5A 1TNDA 2YC4C 5D7BA 5HIAA 1SIOA 3OIFA 2PV0A 3H0CA 4MW6A 5IJZA 5C9ZA 1YJAA 1UK7A 2LZ0A 1N6RA 2Q27A 2A67A 2HBZA 1VZ3A 4BGDA 4PNPA 2QBYA 5BN5B 4PY2A 1SIWA 4ZQHA 2NVUA 4M9UA 1HDEA 1O6BA 1W73A 4ZYVA 1CULC 1G88A 1MX9A 3DO8A 3EWAA 1SCAA 3JYOA 4D8UA 3E82A 1M66A 3G2JA 4QPDA 2PFKA 2WDPA 1DTEA 3MWDA 4IP0A 4KCGA 1JFSA 2VSFA 4ACBA 3B8EA 3MTDA 5A71A 5IXSA 3OH8A 3OZWA 4MNTA 2XMZA 2QVBA 5GOTA 2F3RA 3SQWA 1OZHA 3DR3A 3QVOA 1I2AA 3C3CA 4JBWA 3F1KA 2BFNA 2REQB 2UV8A 4IICA 2Q46A 1L7NA 4IZOA 2ZIZA 2OCPA 4LSZA 3HZRA 3E05A 2EKDA 4QL3A 4Y9DA 4D79A 5AW0A 3OQNA 1GG9A 2Q3BA 5DGHA 3ZPXA 3D4BA 3OCZA 1B8UA 4K1LA 4RM2A 5AXDA 2G1JA 1ZH4A 3WJ1A 1UJ4A 3FPCA 3RPEA 2Y0CA 2JFHA 5C8VA 2Q3MA 3AVUA 3HDGA 3DL7A 5CLQA 2WA1A 3ABZA 4G1BA 4R8RA 2YS7A 3VV3A 3KL2A 1QK5A 3PSAA 5EHGA 2QQ0A 4QPZA 3VSAA 3D2LA 3BWMA 4ETIA 1MEOA 4A5OA 5CEEA 2GHRA 2C98A 4KSYA 5ELXA 3FUVA 4HXGA 4KXWA 3DFIA 1PP4A 2P67A 2FUKA 3U1BA 1DX4A 4PFKA 3EXEA 2W37A 3UQZA 2JHFA 1QC5A 1V7ZA 4B3MB 2GGSA 1OTYA 3HBLA 1I6LA 1USGA 3V34A 2PUDA 1KQOA 3WIEA 1L4KA 4EATA 1YI1A 2NO9A 3MS4A 4H1WA 4RPIA 1QE3A 3L0SA 3S27A 3GLGA 2V6FA 4HDSB 2AJDA 3HU3A 1TIBA 3NWJA 1XCJA 4HLUC 4BKPA 1M2VA 1K63A 3N5KA 5L3ZA 3U4QB 4DIMA 3OD5A 4ROTA 4WL0A 3E7PA 1GSAA 1N0UA 1G4HA 1NXVA 1USWA 1N2CA 2ENUA 2H5JA 2HCRA 3BD8A 3F5QA 3HJAA 3HKEA 5EPEA 2VA8A 3ZHVA 2CEKA 1G21B 2G5TA 4LGCA 3MGAA 4UEQA 4L76A 2ZE5A 1B43A 3M1AA 5E6RB 2VL7A 4CIBA 3AC0A 3N0VA 4DR3B 1TF5A 1P72A 1U8EA 1U7DA 5HCNA 4RF2A 4G0UA 3PT9A 1VKRA 3I2HA 3IVMA 3OFND 4C6TB 3DZFA 2GBPA 3K9BA 4NCAA 2VOJA 4LECA 1JFLA 1NJ2A 5FJIA 2R7KA 3JVIA 1C7IA 2TMDA 1KOFA 1OLSB 3L8CA 5BVGA 1C50A 4M0FA 1UJNA 4IFBA 3KXLA 3MTGA 3T1NA 1SHUX 4PXSA 4G0XA 3U3JA 4NZMA 4OAPA 3AWIA 4BVKA 4YIKA 5H8WA 3GEIA 2JFXA 3QVWA 5K0LA 1YVPA 2V6BA 1T5SA 2NQ2C 4DV6B 4HMQA 3NH9A 4KE8A 3ZHBA 1Z6TA 3H8SA 3FMFA 2FJPA 3RS4A 1JTEA 5EUMA 2WG2A 3K2BA 5H3LA 2CFIA 3DGFC 4NBVA 2DJ5A 1Q14A 5TGTA 3T3NA 1LB1B 3GJ7A 4GC9A 3I1FA 4WT7A 1E2IA 3ZJ4A 1L7MA 3KV3O 4C05A 3HVRA 3T38A 4HNRA 2QM7A 5J1SB 4MDYA 2YV3A 5IU6A 1VLQA 2O5EA 1UJ2A 3HP7A 4TM8A 5CLGA 5EZQA 3CRZA 1H0KA 3MVEA 5IW8A 1HZZA 1R66A 1FQOA 3QQ5A 1HM5A 2R1TB 1JTFA 1KVUA 5D00A 3OX1A 4G0MA 3QQPA 4L4RA 4RO0A 1W5AA 3JWEA 3NASA 1YMVA 4G8JA 2P0EA 2WJ3A 4N3NA 2YJ4A 3NHFA 4YH1A 3SLRA 5CYGA 2CDRA 2E21A 4LYDA 2P68A 1WHTB 1U8CB 4ZMRA 1XZQA 4OJYA 5LIPA 3S0JA 2GPAA 5AW7A 1SBTA 5CPBA 3IUSA 1E2GA 3C3XA 1EBBA 5BSRA 4HSEA 5L6MB 1WKCA 4GKBA 4EUEA 1H2BA 4RK0A 5TV2A 3PUXA 2IS2A 1MHPA 4IS2A 4JJEA 4UPEA 2I76A 3AV0B 1YI0A 1JEQA 1YZTA