5DHPA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 67
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhpA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhpA01
2I2DA 1Y3HA 5DHSA 5EJIA 3V7YA 3V8MA 3S40A 3V8PA 5DHRA 1YT5A 2I2BA 4DY6A 2Q5FA 2I1WA 4L02A 4V24A 5DHQA 2P1RA 3VZCA 3AFOA 5DHTA 5EJFA 2BONA 2I2AA 3V8NA 3V80A 3PFNA 2QVLA 3T5PA 4WRRA 1SUWA 5DHPA 2I29A 4HAOA 2I2CA 5EJGA 4WERA 1U0TA 1Z0SA 3VZBA 3V7WA 5EJHA 2AN1A 1Y3IA 2QV7A 2I2FA 3V7UA 2JGRA 3VZDA 3V8QA 3V8RA 1Z0ZA 1Z0UA 5DHUA 1U0RA
chains in the Genus database with same CATH superfamily
4CCYB 5AXCA 2BJHA 1JG2A 1ZC3A 2DHDA 1IPFA 1BXGB 1ITZA 1RRFA 1ZQ1A 4PBTA 3JQFC 4Q1FA 3TR0A 4LEIA 1RYDA 1QVVA 2PGAA 3PVCA 4WIAA 2JFYA 2AE2A 4WOKA 1K0FA 2ZSAA 1PW7A 3JD4A 4KR9A 4M1QA 3TQOA 4DNXA 1UXGA 1UEJA 3L93A 3ZIAA 3QFSA 5U1PA 3AW8A 1YTLA 4M46A 3RPEA 3ZWAA 3A32A 5BMVB 1PGPA 1H1LA 2R00A 2PZKA 1LDEA 2C42A 1Z36A 1LPAB 2AC2A 2UVPB 4M8SA 3BJEA 1QHXA 4IJMA 5LFAA 9LDBA 1KI4A 2P90A 1TC2A 3L4EA 3LVRE 3MAGA 2CLDX 4NG4A 3TVTA 3LQ1A 4L5YA 5EFZA 4DPMA 2DFKB 1IC6A 2DBRA 2PKQO 3QVWA 3AUUA 2JQLA 1U7VA 4B81A 1PJRA 3AFMA 4EHBA 4I14A 1Y1RA 2J4DA 5EHQA 3BTVA 5EKTA 2H59A 2F6RA 2WU8A 3JZDA 2H4WA 4PZ0A 4H9GA 4UUAA 4AXBA 2I66A 3UFXA 1VLLA 3R4CA 3W79A 5ARDA 2PL9A 4YDSA 3CUKA 2QN8A 2O57A 2SICE 1IAQA 4XDZA 3UXEA 2YVLA 1N0IA 3O4FA 4GOJA 4RH3A 4HNQA 2HXYA 3EQZA 1ZINA 2WWHA 4GZMA 1LBQA 1CUIA 1P9LA 2GI4A 2DH5A 4YMUA 4UU7A 3PWKA 5JZ9A 3DMYA 1J4LA 2VA9A 2Z1MA 2A5LA 1B16A 1L7RA 3GVCA 5CM2Z 4HO1X 5GQSA 1E1QA 1Q92A 2K6GA 3DQQA 5E9JA 4YCBA 5K51A 3VC3A 4DV2B 2C9DA 1R0BA 2ZDQA 2Q2NA 3GGOA 4DV7B 3IUQA 4KO4S 2C5SA 2GJ4A 2R87A 3F7MA 5L45A 3I01A 1G3GA 3L7LA 3H1GA 2FK7A 3QW4B 2GFHA 5DYGA 5IZCA 4W8GA 4NJMB 1JJAA 3ENWA 1X14A 3D6AA 1FFXA 5D7BA 5DN6A 3TDNA 4LDQA 2DYKA 4DPLA 2NZ2A 1A71A 5DHPA 2GPAA 1U2EA 5GM1A 4AMZA 5I7SA 1EB9A 2HIMA 4BRUA 2W83A 5FNVA 4MUKA 1XQ9A 4IQGA 1TQ8A 1WCYA 2C0QA 3MK31 2RGXA 4UHJA 3G1TA 4X1IA 3DLHA 2BUBA 4C43A 2C3OA 4ZDJA 3L9WA 2Y99A 4P82A 4CV1A 1G8PA 4UQPA 5JH7A 4OP3A 2UZ1B 1YMQA 3O38A 2OGTA 1MAAA 4JMLA 4R1TA 1IN5A 5KTKA 4E30A 2QLTA 5JLAA 3E2MA 3VJRA 2WD9A 2JIPA 4GOOD 1AZWA 4OYHA 4BEWA 4JWKA 1TYCA 2R2GA 2E4ZA 2ECOA 3PEVA 4QDKA 2AJCA 3RV4A 1RQ7A 2FH5B 3NYWA 4GOLD 3BZWA 3ZU3A 4X6YA 1I7DA 3O75A 3KYBA 2GN6A 2DHQA 5EP4A 2GAJA 4M89A 5L7TA 1W76A 1Z5GA 4EBBA 3WK8A 5DE3A 3EVAA 2NU9B 1SU8A 4AKEA 1EFKA 1QZ3A 1Q21A 2QYTA 5FTKA 3GCWA 4KBGA 2QK4A 2WAXA 4D6PA 4PGMA 4PNZA 3FFTA 3ZC3A 1S9HA 1E3SA 2I55A 3S7TA 1OU4A 3KALA 3COZA 1VA5A 1JDNA 3TOSA 4EUNA 4FR2A 1ISFA 1JEQA 1NUQA 3HCWA 4LYFA 2C4NA 4ESHA 1WS6A 3BHMA 4RVHA 1QU3A 3OKFA 2Y9MB 1XD2A 1ECLA 2YYAA 2OGSA 3F5DA 3HGMA 1LSSA 3RVRA 4I1OA 2BF4A 3IHWA 5DM4A 5BYJA 2QRZA 4BFTA 1S3FA 5KDOA 3ZD6A 4OFXA 1D6MA 5KCZA 2VK2A 3BHJA 4C5BA 2VJQA 1X38A 2XOKD 3DGEC 2VI5A 1XP8A 2GTPA 3EFHA 1JALA 4UVIA 3P27A 2I1QA 2Q1SA 2X9LA 1D03A 1JXMA 1RSZA 1YVDA 4TTPA 3V1NA 1SULA 2OP0A 2MMGA 2HK9A 1ZUD1 2IXGA 3MWYW 4R83A 3W1WA 3R7LA 3KUUA 2GCIA 3RFFA 2LGJA 3HR4A 1GZSA 3C7AA 4XWWA 4N3BA 1KZHA 2YMQA 4LOLA 4AYTA 2OBYA 3G2MA 1RI3A 3FKSD 4V2UA 1EFDN 2NSLA 2Z9BA 1FFWA 4WBNA 1V7CA 1A9OA 1BWSA 2H1SA 4TT3A 4DMMA 2XBUA 3GY0A 2DR2A 4ZOEA 4BJ3A 4JCOA 5ABPA 3PNVA 5IDQA 4LJRA 2FN4A 4N03A 1LPOA 4KPEC 1QVZA 2J08A 4IZIA 3JARB 1UKEA 4GI5A 3OSZA 4PZAA 4Q5IA 2O3TA 3UJ3X 3VR4D 4DJFC 4NBWA 5BWOA 2NYAA 5KOJB 4V39A 1UAGA 5CNMA 2EAUA 5TQJA 1KFEB 1QFMA 1A04A 1QHHB 2I0FA 3ILSA 4Q3DA 4B4KA 4YX9A 2ZQYA 4ARVA 5KBYA 1Y37A 4BTEA 4MYRA 3G8DA 1MXHA 2DFDA 3NWOA 3CCCA 3VHRA 3RTCA 1W6RA 1PWYE 2GX6A 4PNPA 1ADCA 2Q4EA 1KTVA 3I45A 1F2UA 1LQTA 3HGQA 5AHOA 4ZCRA 4Y2RA 3BSWA 1GNSA 5JIBA 1TI7A 2XNDD 2ZAIA 1SA0B 3KC2A 5B7QA 4HAIA 1OFIA 5TPWA 4Q15A 2WE7A 4ZRNA 1T91A 1D2GA 1QCZA 4PRKA 2GPTA 4YACA 1L4FA 4I36A 2XCIA 3PQ2A 5BNWA 5FOQA 2B99A 2FZLA 2FW7A 1SBIA 3RLFA 3AF3A 2SHKA 3I39X 1DUSA 5B7NA 1RYYA 3GZJA 3RRBA 1JLMA 1UM9A 3FOBA 1FU8A 4IVNA 4NPCA 4TVSA 1U8CB 5BR4A 2C2WA 3NBYC 2AW3A 1E8NA 3F98A 5ITZB 4MKFA 2IVFA 3GQBA 5L3RA 2YUTA 2QM3A 5SV2A 5TVKA 2ZI6A 4ZCPA 1CZNA 1K6EA 1I36A 4PCLA 3ND5A 3HC7A 1HQKA 4HN9A 5ESXA 1QG0A 3P0IA 4NARA 3IQXA 5E2IA 1P4JA 3MFYA 4GYJA 5COAA 3ZD9A 1AKQA 1AO3A 2EP8A 3RTDA 4QOFA 5BW5A 4DR5B 1WB6A 4P0QB 4YMLA 3FPGA 2PUEA 1QU2A 3J81A 1NW9B 4I5FA 4P53A 4HT3B 4BOYA 3NBFA 5FWXB 2IPOA 3DLPX 1SY7A 1LDGA 1UMBB 1W0CA 3RTAA 3ES9A 2OTCA 1PJSA 4NYJQ 1QHSA 1C30A 4P32A 4AKSA 2C95A 4RCVA 1SVMA 3W1VA 2YMPA 1LBSA 1EHYA 1PD1A 4KW7A 4INZA 1SIUA 3MOSA 3PFFA 2CSUA 4Z54A 1XAIA 2QN7A 1UT6A 2ZIXB 3C6KA 1IQPA 1I80A 2ZJZA 3GG2A 4NS1A 4DZZA 3FTFA 1BN7A 2H1CA 4QEZA 3ENQA 4AG5A 1KZ6A 2NZWA 2JB9A 5AM4A 3T34A 1H0SA 4M6WB 4IDQA 2OV3A 3B6EA 4RETA 1JJFA 3ZU4A 5C8ZA 1G16A 1H2AS 3Q3VA 3CEMA 3ORFA 2RSLA 4WH0A 5BURA 4O2BA 5HE9A 1A7UA 3NIDB 5HSGA 5NLLA 2ZSJA 5BR1A 2N75A 3BGWA 3KPVA 4CU5A 1CERA 1EGMB 4V1CB 5LJIA 4HEHA 5FLEX 3GAZA 1MFPA 2V3VA 1H4QA 2I4OA 2LIPA 1Z6XA 3FHLA 4DUPA 3QVGB 3S3TA 2R86A 1Q1AA 5E7MA 5JXHA 1RZ3A 5F9MA 4KE7A 1WMDA 2V0NA 6CHYA 2R68A 1MVLA 2Q4DA 2EQ5A 3DCIA 3IESA 3LLUA 4P93A 3ZOZA 1YV9A 2DGDA 1K88A 3N7TA 3I62A 4YPOA 4YRQA 1F12A 3DOIA 3OF5A 4IUCS 3DD1A 4RPGA 1XJ5A 1GQ2A 1KJIA 2E4YA 1COWD 1C4XA 1O6CA 4P6VF 1MAHA 3HCFA 4ZYVA 5DNWA 1CY0A 1ZVQA 2AFIB 1XUOA 2AYZA 4HY3A 1NLFA 1Y0BA 2JGIA 2BFDA 2C4MA 2XYPA 4C7OA 4NPHA 1J4AA 1ZGGA 4GBMA 1TYEB 1DQZA 3AHJA 4A03A 2IHJA 4RULA 1L4BA 2OBBA 1F2VA 5I7OA 3RYTC 1EA5A 3ZNQA 1L5FA 5CM9C 1P6QA 1NIJA 2VAWA 1CR6A 3FSRA 3QQPA 3U7EB 2GNPA 2O48X 3NOQA 3QFFA 1F8YA 2XHEA 3KUCA 3L7IA 4H17A 4N3AA 3JQ9C 3RFTA 3ZZMA 4DIOA 4DJEC 1JR2A 2X4LA 1I24A 2EL9A 2WMDA 1XEWY 3ZWNA 2X23A 5AVQA 1T29A 4YMTA 1DKUA 2KWIA 1JMKC 4B48A 1U7FA 3ORQA 3QPWA 4AP5A 1TL7C 1VCOA 3FN4A 5LIRA 5HXAA 5CNJA 5AVYA 3KQWA 4G4JA 5K8TA 3O8QA 4U0JA 2O2DA 3OZAA 1BFUA 1WB9A 1R6BX 2PBZA 1Z56C 2PRZA 4GPD1 4E22A 3BX1A 4LJ7A 4N0QA 5DYNA 2I8LA 1QTNA 1T2DA 2BMFA 2WUGA 3E7DA 1RJ9B 1HZZC 2GK7A 2A59A 1A97A 1JVBA 3AUTA 3EYWA 5CGZA 3UJHA 1KMHB 4NNPA 1FJGB 2HJHA 4ZI3A 3U44B 2GK3A 3AUJB 2KSQA 3C87A 3ODPA 1N9GA 3CUEF 4M86A 4BGUA 4B17A 4BNJA 3VNVA 4YUAA 2OBXA 1IXKA 1JIKA 1TGYA 4DBVO 4MKRA 4BLPA 3NDBB 4I46A 2OZVA 2INGX 1K86A 2YJTD 1RQRA 5I9IA 2GNOA 3I23A 3ONEA 4O8CA 5TE9A 1TW3A 1U3WA 2GK6A 4HH1A 3C6ZA 1LGYA 2VC2B 4PAQA 4I5IA 5EWJA 1J1ZA 1IBSA 1XLWA 2BGNA 1I7NA 1MOPA 3STWA 1P5RA 1UBMS 2QZZA 1HDZA 1W47A 3LC2O 1YZ3A 4NIMA 3FX2A 3S2SA 2PGXA 4H1UA 1E66A 2B83A 4JHXA 1FQJA 1TUBB 4J0QA 4DTIA 4N0EA 3NT2A 3GGPA 1PFWA 2XQVA 4B76A 1W30A 4C03A 5C1BA 1FDUA 2V8OA 1JHAA 4DANA 4DG5A 4XRRA 5EQFA 2OBFA 2V7QA 2W2PA 1R4NA 3FWKA 5EVCA 3UHPA 2AMVA 1TJPB 3OEWA 3KQOA 2X40A 3RG2A 2WD8A 3N2ZB 2FSVC 2W8BA 3ZHXA 4M1MA 1RJFA 2PWAA 4MA5A 5JD3A 5IW8A 2Z2IA 4Q9HA 1JI0A 4RZ2A 1Y89A 1Z06A 3IVGA 3ACBA 2A4MA 2PO5A 3PGMA 2BGUA 2DBVO 4HLUC 4XWTA 4XSHA 4E5SA 4KKVA 2PSSA 1NX9A 4RY2A 2J0UA 1BROA 2H3HA 1F06A 2ZYIA 4K6HA 4LBZA 1YA8A 5DK4A 3GYGA 3I1JA 3PITA 2CYAA 1C50A 2EKDA 5AM0A 4I6JA 4GUDA 4CTJA 4D3FA 2R79A 3W7AA 1M3SA 3L1IA 2O5EA 2M1ZA 5D2CA 4BQPA 3DT6A 3V9AA 3FNHA 2YWDA 1DBVO 4K9DA 1VP9A 3LVQE 4UDOA 3FI9A 1W96A 2C98A 3A36A 1DC6A 2G9RA 4MDHA 5FOXA 3HB7A 3UHOA 4F93B 5IANA 5C5EA 4GR9A 1NKSA 2X9NA 3B3FA 4A8HA 2HCJB 4RVUA 5JE8A 3HO8A 1IDOA 4BLVA 1QP7A 1FFHA 2YHUA 1DD1A 1RR6A 2ASVA 1Y4DE 4UMEA 5DLEA 1G60A 4ZU3A 4I2NA 2F3QA 1RMQA 3KQQA 4J4BA 4MW7A 1C3VA 1LI7A 2D0DA 2ZE8A 3AF4A 2W0SA 4DLZA 4DVJA 5J4LA 3WMXA 3OFNA 2HCFA 4UASA 1ZK0A 4PANA 2ASEA 1JB1A 3EK2A 1TVEA 2LD4A 2GD6A 3I5MA 1GFWA 1XEXB 3AP1A 3H18A 2ZI3A 2PIDA 3G1UA 3PE3A 4DRXA 5K2OA 5PGMA 2H17A 1E5XA 1RLOA 1Z38A 2XMBA 4AQ7A 1QWTA 1YU6A 3LHFA 1AY0A 3RC9A 5J4VA 3LZ6A 1S8NA 4K7JA 1P7CA 5KTTA 1NVFA 4PSUA 3QLTA 2Z2XA 2HA5A 3F74A 4S0XA 4YIHA 1M1NA 2FG6C 1VJ0A 1H2HA 2GBLA 4YVFA 4EYOA 5T8KC 2PNFA 4ZEMA 5BXQC 2JZCA 3SLGA 5I51A 1KU0A 4JLKA 5AUNB 5B1YA 4ZGGA 1FC0A 2R1TB 3L82B 4I55F 4KWHA 5AVKA 2ISCA 1Q44A 4NMHA 1FTNA 3A3PA 4LY3A 1EFLA 1V71A 3JYOA 3DLBA 2JFOA 3GUYA 4TMYA 2QV7A 5LYJB 4YRNA 4P80A 1N2BA 3MNFA 2F2TA 4FXPA 2ONKA 3QENA 3N2EA 1YVRA 4S1NA 1OAOA 4QECA 4WT7A 2HLNA 2DKNA 2UYCA 2HA7A 1OF1A 3GNSA 2XZPA 3O8OA 4FGLA 4V0SA 4X7MA 4AMVA 5A4FS 3IE1A 1TAUA 5EGNA 1I10A 3EW9A 3F8WA 1VG9B 3G7NA 3R5TA 3VNUA 3KUDA 4X91A 5F4BA 1TTTA 2Q9AA 1AZSC 5IVDA 1YDWA 3VC2A 1H9BA 1NNI1 1IXRC 4TRRA 4U2FA 3TR5A 4W5HA 2ZI4A 1NRWA 4KAXA 3ZHUA 2CHUA 3UK6A 3WWYA 4CL0A 3B1FA 4QA9A 3OOYA 4EM6A 4MR7A 3WWEA 4TRJA 4QVIA 2REQA 1SMKA 1V96A 1F9EA 2AEJA 3K31A 5AVVA 3DGFC 2H92A 3D59A 4KODA 5BT8A 2C03A 4QT0A 3AWDA 4XJTA 5EQDA 3NWJA 2B5WA 3MMSA 4ESEA 3D6HA 3QE3A 1QH8A 3OLZA 1FSPA 5AH0A 1I3CA 2XDQA 4MI1A 2PE5A 3UCFA 2O2SA 2VBCA 1SGWA 2JLWA 2QE7D 3E4CA 3N53A 4PG8A 3FYTA 2QGFA 4DV3B 4G1UC 4WFJA 2HWYA 4YEDA 2E3JA 1E2KA 3GRAA 4ZT3A 1I9GA 3DFUA 3KJZA 5JI3E 3Q87B 2C2HA 3DYVA 3A6KA 2JAQA 2RG7A 1YQDA 1Q84A 2FDCA 4MWOA 5JSFA 4O4HA 3K3PA 1ICIA 2IKSA 1ZGCA 1GA6A 2V3WA 1IMOA 3M6FA 3UMVA 2A9VA 2IIVA 2JAHA 3IOMA 2AG8A 1OR8A 2C77A 3RH0A 2X9VA 3VX4A 4F84A 5GV7A 2QX8A 5KQRA 1SXIA 4R3WA 3EAGA 5DTJA 2XA9A 3FJ1A 2NG1A 3MINA 3O93A 3RKSA 1FDTA 4AY6A 1NONA 3B6IA 2HKIA 4I9HA 2QW0X 3IMCA 4TYPA 1SXJD 4DCJA 4DLSA 2LVBA 2I1VB 1G8GA 3H5LA 5B7GA 3B13B 2BRFA 3X1DA 1XK7A 2EFCB 4G0VA 3FMPB 1U7PA 2ZANA 1O03A 4U3JB 1GPLA 1M7HA 4I99A 1IEWA 1RBYA 4IG4A 2GN1A 3MWDA 1ORWA 4OKNA 5JFTA 3CRMA 1F8XA 1GU0A 1TAHA 1W5TA 2ZRJA 2M98A 2OZLB 4IINA 4MRPA 3WFZA 3AVXA 2ADFA 2MYPA 3EQ6A 1YQEA 2NU6B 3LKVA 3ZVRA 1GZ3A 1RPJA 2VN8A 1WY5A 5ILGA 1Y3HA 3WLHA 4F2GA 1J21A 4Y6PA 1BQ4A 3MJRA 5DBIA 2PT6A 3ZHRA 2X0IA 2IYYA 4M1SA 1L5GB 3DVRX 2MSLA 4EPVA 1OI4A 1PTJC 2B5VA 3PKJA 4JIGA 4Q3NA 3BBPA 3KSMA 4KAFA 4RFVA 3VHXA 2NVWA 3WGVA 2ZCJA 1RAAA 4PLTA 4QTUB 4ZVMA 5DBFA 3W78A 2VPQA 1D1SA 2YIJA 2QB5A 3RS9A 2EERA 3CH7A 3RYIB 3L7OA 2YJNA 5L4NA 1LSJA 1YR3A 5ERXA 2RC5A 4L6AA 4H1WA 3LC0A 1FVOA 3HBJA 1A69A 4HFNA 4ZOQI 4E07A 2J9FA 4MPJA 4D5GA 2CVQA 2WAYA 4AICA 2BJVA 3IP8A 2PNJA 3UQZA 4B3BA 5A6VA 1T3ZA 4AJKA 1H85A 1IXYA 1PBTA 2IXDA 2EEPA 4EG4A 5ECWA 3C43A 2H54A 4E4TA 2JAPA 2Q1WA 4QQRA 4ARBA 5BN4A 5MGBA 4MJLA 3PNMA 1NJ5A 2G4CA 4FFOA 3SLKA 3WYFA 2ZRLA 3FOCA 3JAWB 1P72A 1R4AA 1V3UA 1ZYUA 3SNKA 2GZSA 3LBIA 3TINA 4C06A 4FYXA 1FX0A 2O59A 3N28A 3FCCA 3CNLA 3OTOB 1YASA 3GP8A 5CLIA 1PQWA 5ALKA 5B1EA 2UUPA 2HJSA 3PL1A 2WOJA 1AOXA 2WZBA 3VU9B 2W2QA 1RJWA 2HT6A 3M6XA 2ZPTX 3GWGA 2ZW9A 3QF4B 2WB4A 2C2YA 4R05A 4FTWA 1DV1A 3GDOA 1GSOA 1LFDB 3WYNA 1L4GA 1UFOA 2F48A 1E6WA 5E95A 1QG6A 3AY0A 1XLTA 1M8KA 3QVJA 5BNFA 3ZD8A 2GN2A 1EPUA 3PFCA 2UZ4A 3R8FA 1EWYA 1SXJC 2Z95A 4X71A 5HGJA 6GPBA 4DR2B 1KHXA 5JAHA 4H60A 2FPIB 1LDMA 2HRZA 3N0TA 2G09A 3BMCA 1VKZA 4KMRA 3W8EA 3PC8C 1QHNA 1K7XB 1T6XA 1W2HA 2DKFA 3IIIA 5KNBH 2F7SA 2OO5C 3ITEA 1UODA 2Y9PB 4OU4A 3R7BA 2C9CA 1O0BA 2BOVA 1EDOA 4YRAA 3VAYA 4WLUA 1KFJB 4ZCIA 4XYBA 4TRMA 3LYUA 1ZUNA 2F1JA 1GRVA 1UBNA 4OQNA 3B1KA 2ZS7A 3BZBA 3EASA 3S0JA 4ZHSA 3F6PA 3E1GA 4AJOA 1EZZA 3HRHA 3NC1C 2W2VA 2R5FA 5TEWA 2O8DA 3I6WA 3GXBA 4LF8B 2RJ3A 3T38A 2PU5A 2IUTA 3LPAA 1DCMA 1QB7A 2ZTMA 1LQUA 4KUGA 1YMVA 3U2QA 5J47A 2FW1A 3NWPA 2YYZA 7MDHA 5IC4A 2HOQA 2GLUA 2OFPA 3IQZA 3R3WA 2FPKA 3N75A 4L9WA 1M1YA 2WWRA 2C5HA 3M1AA 4GXNA 5G2OA 2M9MA 3RIMA 4YUWA 4CEIA 1RM4A 2P41A 2A8YA 2KLHA 3IE0A 4MQBA 2LDBA 5DGIA 1NWHA 3HMKA 4KVGA 3C1TA 4KPFC 5IN4A 5J63A 5DYWA 4J0GA 4IMPA 5AKJA 2VPTA 3LPCA 1K5PA 5KKCA 3ILXA 2EDCA 3U5ZB 5E4TA 3PG5A 4QSHA 2FPLA 2WF9A 3DOHA 1V39A 2C2KA 2DSNA 3DD5A 4HAYA 1EVIA 3T1OA 3MD9A 5FWYA 1SB9A 3GFBA 2WYIA 5DULA 2C82A 3PVSA 1HURA 2I3BA 1I4DD 3EVBA 4GOMD 4PQFA 4FJ0A 5D6NA 4CIAA 1GGFA 2QRHA 3N8HA 4DSAA 4JAVC 3IEKA 3C3YA 2HREA 3ZVMA 3MJSA 4L5JA 3IKLA 1VFPA 5JJIA 3UK2A 1JWBB 4QZVA 1T9GR 5FKJA 4FXOA 4EHKA 3F7NA 2B94A 2G3YA 2VCYA 2ZP1A 3FYHA 4NBUA 3AEZA 4NECA 4UEQA 3WB1A 5JSQA 1W85A 1WZCA 1LPNA 1ZRMA 3L1KA 1K8XB 4YJGB 1OI3A 3QKTA 1UC9A 4F38A 5JXIA 2Q4RA 1JDTA 2YIDA 1YL7A 5C80A 2ESRA 4YRZA 1C8VB 3OT4A 4UEWA 1SCIA 4JNCA 4OQ4A 4DA4A 3RAGA 1D09A 2ZU6A 4ZZIA 2DX7A 4M7PA 3IT2A 2ZWMA 3OTWA 3FWZA 5GTDA 3OZUA 1M1YE 4X1KA 1ID8A 2YV4A 5BSUA 4J0HA 1PG0A 3I92A 1AHPA 3D4NA 1HE1C 3QA9A 4O02B 1CUVA 4AJ2A 4MGIR 3U5TA 3LYAA 5IG2A 2VPWA 2FMKA 4LE2A 3HHPA 3R0IA 1GSAA 5EERA 1UEIA 4EGXA 3EHEA 3EGDB 3GFPA 1U5BA 4PRYA 1NZDA 3BC1A 3O4VA 4A0GA 4BZWA 1XZAA 4TV8B 3TW6A 1T5IA 3KD3A 2CXHA 4JUFA 4CIYA 4RTRA 3IVXA 1AUQA 4L73A 3T0IA 5JCJD 1NQWA 4NBVA 4EHFA 4RAQA 3AIIA 3NM6B 2VP4A 4I50A 4QBTA 1DAGA 1YS7A 1AS3A 3G02A 2QTWB 2J3LA 4AMBA 1DIGA 1UJBA 3AV3A 3HVJA 3WLPA 3DM5A 4HOYA 3OEEA 4IJ6A 3ZDCA 2ZBRA 4HBZA 4DPKA 4O4LB 3CF0A 4C1BA 1WMBA 1M2JA 3T7TA 1EUDB 3IQEA 3UJBA 3E7FA 2F8LA 4Q34A 1F9AA 4L72A 3MLBA 2WAAA 1VBNA 4MPDA 2Q2VA 5C1IA 4UM5A 3OESA 4B34A 4YJKA 1QH0A 3KR1A 4NZOA 3OF2A 4R6WA 1XTIA 4Y6OA 5CVEA 4CTMA 3PEFA 5JS2A 2ORYA 1I8TA 1U8YA 3KE9A 1U8UA 3JPYA 3RF6A 1UJ4A 5HIKA 5IUJC 5K3FB 2BGMA 2XVAA 2IHBA 1LJ8A 1AZTA 4M49A 3Q15C 4N7JA 4UHBA 3ZY6A 1R6AA 1JIJA 1NGSA 1HQYE 2X5OA 1SQ0A 1LSOA 2X0FA 2H9AA 2VIIA 3DMTA 3LPDA 3TWOA 2XWSA 4F45A 3H5VA 4IIJA 1M6VA 4UFOA 2QIPA 4DDWA 3AVWA 1GUYA 3A4YA 5KOIA 1XEFA 3DCJA 1IHXA 3UB2A 2CNBA 5LBUA 4LZWA 1BQEA 1L7XA 1FP6A 1SO8A 2CYBA 4OQLA 4KZPA 4UNQA 5B57C 4K46A 2R8XA 3F96A 3WNQA 2DERA 3EZYA 4XFJA 1SCQA 2CHQA 1GPKA 3C45A 4JVMA 5KVCA 1MVNA 1PX0A 1XIVA 3BZUA 3ICVA 4FX2A 1N1EA 3HRIA 2DFNA 3C7TA 3VZPA 2WJPA 1ZO8A 4JYAB 2VH2A 1WG8A 2ZUDA 4LCEA 3CWCA 2JLSA 1EDBA 4KZKA 4X00A 3PDCA 3U3XA 2FR8C 1QGUA 1HO3A 4CU2A 5EZSA 1OLSA 2HBQA 3ZQJA 3PNLA 1XPUA 3LDHA 5FAKA 2OD7A 2CLHB 3EOZA 4EO4A 3DFFA 2JA2A 2E4AA 4P3PA 3H2ZA 4MQ4A 5K8UA 2FVYA 1XQ1A 2GN4A 4G07A 1NVTA 4RTQA 5LN1A 4LY6A 4W5JA 1H6DA 3HCOA 3TR6A 4D4GA 4WFKA 4E15A 2VNJA 4MQ5A 2QTGA 2DTDA 1XTQA 2QD1A 4B6FA 1F0YA 1K63A 1WO8A 2P1RA 2HDHA 4KDRA 4RJJA 3SMQA 2FCAA 1GYQA 2YICA 5EGSA 2CZGA 1YR1A 4OGLA 1AKWA 4I6GA 3RYHB 5J4KA 3JRNA 4B6SA 1K6MA 2V6BA 2ODBA 2A0FA 2GYUA 3JVEA 3ZU5A 4LHXA 3K72B 5AKYA 1TA9A 1DU4A 4M60A 3ESRA 2P78A 2QJOA 4G0ZA 3HEBA 3TCKA 3VSDA 1XGKA 5LWHA 5IVKA 2C7BA 2QAGC 3H9GA 3DTVD 2AH5A 1OXUA 1FRQA 1XVVA 1Z2EA 3P0JA 2SKEA 3L43A 4PLWA 5FWAA 4AUKA 2LE0A 3EIHA 3PDIB 1P91A 1WETA 2FW6A 3C4JA 4S2EA 5AHRA 4IUDS 2XMSA 1M74A 1OXMA 2ZJOA 1QVWA 4EL5A 1NLUA 1X7YB 4MVJP 5D85A 3GQSA 1GEGA 3RYCB 1KK2A 5IHXA 3OQPA 4D81A 1UPTA 1N77A 4Z4EA 3IURA 1CRWG 5EP2A 5CIYA 3BTUA 5AW4A 2IS2A 4B7XA 3ZY3A 2C5AA 2Q1YA 4HC4A 5LLDA 1KL7A 5K3CA 4RKWA 1WXDA 3AL0C 3SXUA 1PT8A 3NC4A 3OQVA 2KB4A 1M33A 3PB3A 3WQBA 3ADBA 5AKGA 2FUCA 3WMGA 4ZZ0A 3M6UA 1ULSA 5EXDA 1I14A 4O2AF 4BNWA 4MUEA 2Z2YA 4IS2A 1ML4A 1A2QA 2JJ1D 3KKNA 3OJ0A 3V1TC 1PFVA 3CX3A 4IKOA 3LY7A 1OXSC 4Y0NA 5K0ZA 4PTYA 5C0OE 1Z2NX 4RK7A 3BXGA 4K9MA 3VUFA 4D9MA 2PD3A 2YRWA 4LGMA 1VSQA 4C07A 3ET5A 1ORDA 4EPYA 3ZJUA 4YXWA 5LOVB 3VO9A 1QK5A 1CZUA 1R0ZA 2EDAA 1J4PA 4GZ5A 3MWKA 1DSSG 1Z0FA 1Z6QA 3KU4A 4IIGA 2XCQA 2O20A 4H7KA 4MTCA 4C0JA 1KTIA 4IICA 3P0EA 4UTRA 3VKGA 2OXRA 1HKUA 2R97A 3NTVA 5DK6A 1UMCB 4BBJA 2DFPA 2CWDA 3Q4GA 1IN7A 1PGOA 3FBGA 1S1MA 4QKQA 1G98A 3CA8A 4TM8A 3B8EA 5BPFA 1NXVA 2F3RA 4I4TB 2X1HA 4BVKA 3PFNA 1S2LA 1RYEA 2PSEA 1D3AA 3FVVA 3R3VA 3FCAA 4H6XA 3R7WA 5AVSA 2ES4A 2FGJA 3CEPB 2F1KA 3EBPA 1WD5A 2DTXA 2LP4Y 3ANTA 4AB1A 5J2UA 4S1WA 1ZJ6A 1OBHA 3Q98A 2AK3A 3DPUA 3B9BA 1HDYA 1UBHS 2XB4A 3KQVA 4EFKA 3HNOA 5FUWA 4NKRA 4CLEA 5LDGA 4C6TA 1P3JA 8LDHA 4E88A 1QYCA 2ZUCA 1W94A 2TMKA 2B36A 1TECE 3DUFA 3F5SA 2CNNA 4PFJA 3WJ1A 5I5EA 4RZXA 3M8KA 4LHZA 1PW5A 4LV6A 5TRTA 4PXYA 4ARCA 3O3OB 3REOA 2NW6A 2YWRA 3BA1A 4R1NA 2G1KA 3MBOA 4PS1A 5GVSA 1TO6A 3TFWA 2WR8A 2V6FA 1Z13A 2QMOA 4B8ZA 1JNYA 1VXOA 1HDCA 1XNJA 3HJBA 5I7WA 3GD7A 3GRYA 4OUDA 3WWPA 3DSRA 4QTTB 3IAFA 1XMIA 4HLDA 3HSYA 4N47A 2OORC 5JDCA 2GUGA 2M6RA 3SXJA 4WKPA 1XQYA 3QXSA 1KNQA 4JB3A 5KX5F 5ETJA 1D2HA 3K4HA 3TGWA 2VZLA 1B14A 2IDKA 1N1GA 1VQ1A 1JFVA 3IJRA 4XVHA 3KTDA 2JHPA 3DJFA 1G7RA 3M34A 3V8PA 1QONA 4DLRA 3HN6A 2VDVE 3CH4B 1AUXA 3R0ZA 4D46A 4RS4A 2VNHA 2JKVA 4BNGA 4MR9A 2ZVPX 1JSCA 4JBIA 3HJNA 3I2IA 4DLXA 2VHYA 4HMOA 3A6ZA 2FG5A 2ZPAA 2I2CA 3ZE6A 5KNDH 2B69A 3TSWA 3Q11A 3ZV4A 4F8EA 1W5BA 1QF6A 3NEYA 3R6TA 4F91B 1KEZA 1P17A 3GZTB 4DTCA 4ZVUA 3II6X 3NW9A 4EOGA 3ZKWA 3E48A 2QPLA 2QM7A 3EW7A 3SU8A 3SHOA 1MR3F 1GQFA 4YAFA 1PTKA 1SUAA 1W48A 1V8DA 2XZDA 3AIKA 1OTHA 1X3SA 1SXPA 2IVZA 3QH4A 1NVEA 5KJCA 4GAEA 4V1CI 3U1TA 2ZROA 1JDPA 1E94E 3A58B 3G6WA 5FNZA 4Q18A 1OH7A 1M34B 3L4SO 1I3NA 1KU6A 2B6NA 2EG5A 3O5AA 4RH1A 4JL5A 3K70B 1Q1EA 3M9WA 4KV7A 2PXAA 1SVOA 3EDMA 3OUTA 1G20B 4B6QA 2VF4X 4Y1RA 4FW8A 8ABPA 1Y7TA 2XNSA 4E46A 3GLHE 4TYWA 2C8LA 2DEUA 3OZFA 1E2UA 2RH9B 3G8CA 4BATA 3L5KA 1VCNA 1OX6A 5F21A 5LC1A 3ZUGA 4FCVA 4FE3A 2JGKA 2XITA 4D8VA 1IXSB 1HYGA 4PLPA 1CZLA 1BW9A 1I30A 1T34A 5M3BA 3B38A 5BSFA 2JIZA 1JU3A 1MR1A 1JKJA 1KP9A 1VJ5A 1Y4AE 2QZJA 3D8RA 2ZBQA 3WWDA 3TAUA 1IZ9A 2PCJA 2JDID 4GGPA 1DBIA 5FV7A 5DH9A 5JALA 2F1OA 4KRYA 3COPA 4F86A 1KFBB 3KXPA 5ALZA 1ULTA 2WTUA 4R1SA 4LQCA 5ALYA 4BJ1A 4L4RA 4URFA 4UU0A 1NJFA 1Q50A 2ISSD 2WU1A 4BNUA 4RQUA 3OX2A 4BO4A 2HK7A 3IDQA 721PA 1U4SA 4B09A 3NHRA 3WB0A 4ENWA 2C2XA 3RRMA 5HHTA 3HU3A 4EMSA 1MQ8B 5IT4A 1GRQA 2VF7A 3G5AA 4HNSA 2ZYGA 3DEZA 4JEUA 4RKRA 4BCBA 2WTNA 3ESDA 5G41A 4KMSA 2ZI7A 4US0R 4Y6LA 2CE2X 5ALPA 4CF5A 5JBIA 4B7CA 2O2JA 1FLAA 2KI5A 3OTIA 2J9XB 2AKAB 1UJCA 4O1IA 2IX9A 2ZE7A 1IJKA 3M82A 4CMKA 1YNSA 4I8IA 2PMWB 1UEXC 4KE9A 5CMLA 4F60A 5KKNB 3AXSA 3D3QA 1K97A 1IM5A 1WVMA 5FJIA 1TM7E 1DJPA 4NF2A 3HA3A 3H2HA 3LCCA 3KSAC 4PFQA 4YRCA 4JA2A 1XKLA 1SC4A 3KELA 4LVNA 1AGRA 4JP5A 3RJMA 4H3KB 4P4SA 2R751 5EIAA 2NO9A 4FR0A 1EQUA 1J5XA 3HRKA 4N4AA 4YNBA 1P0PA 1YRAA 5IBPA 4BTVA 4BPRA 2FPRA 3GRFA 3P2JA 4F8YA 2Z6UA 2W7TA 3K9HA 3OT1B 2WVAA 5G0SA 1D7OA 1PJ4A 1XPOA 2AEEA 3MCAA 4OHFA 3H05A 2EP5A 1H0RA 2CXNA 3NONA 2H57A 3QMMA 2ID4A 1F7UA 4B80A 3U7QB 1ZIPA 1QP8A 2VEOA 2IOYA 3HUUA 4UBLA 1SKQA 4KXMA 1F6WA 1K4KA 2EL7A 5LZ7A 3L6DA 2QEQA 3CZMA 3DOUA 4HH0A 2JK0A 3ILVA 3T3MB 3DOFA 1Y1KE 4IHQA 3RO7A 2WHRA 3TF5A 5B6IA 3RHSA 1AMNA 3B9PA 4YO7A 3BXEA 3AM4A 3RUIA 3GUUA 3IUNA 3AEKA 2NZJA 3QUCA 4FB4A 4PBRA 1WCIB 4II3A 2ICAA 3P45A 3W3AD 5FBVB 5JNRA 4ZI7A 3KZCA 1FQWA 3ZNPA 4AZ0B 3H4MA 4V0ME 2W43A 3PGA1 5TF0A 1B8PA 3PNSA 3JD2A 3QPDA 4TV9F 3SIPA 4I5DA 4DGSA 3UH0A 4AC9A 5CVTA 1DMRA 1L4KA 1BHJA 4TWAA 3BKXA 4XB2A 1AGNA 1EP3B 2E21A 3PWSA 4IMIB 3RC8A 2AF4C 2NXJA 4LVCA 3ER9A 4IS3A 2ONJA 3KSUA 4KLRA 1A27A 1YRWA 3H7IA 4LZNA 4N76A 3E9YA 5BMVF 1Y33E 4C7JA 3HKBA 5JU6A 1MPTA 1TD9A 3F71A 1OFVA 3W04A 3OT5A 1WV1A 3ZI7A 4AN1A 4KN5A 2VPIA 4BO2A 1E0JA 5ILOA 1T1EA 4HFMA 4V2IA 3ZE2B 2RJOA 1RWMA 2PEYA 2VDOB 4BFUA 5BVGA 4IBOA 2K5UA 3LLCA 1L5YA 5IJZA 5JTUA 1WMFA 4L0DA 3EVGA 1RQNA 3E3LA 3R9KA 4ZU6X 1RD4A 3HB1A 4KXNA 5FFNA 2DY1A 2BEVA 5FI0B 3QEOA 2D59A 1O87A 4HN2A 4XWOA 1UADA 3P1JA 2ZIFA 4OHPA 1VYVA 2JGJA 4ONEA 1YFZA 5DX1A 1C7IA 5FHRA 3UAVA 4DDHA 1EEHA 5J23A 3H6HA 5K8VA 2Y0CA 4G0NA 2HWWA 1EHIA 5K3DA 3G2KA 4BMNA 1D2CA 2IDMA 1XTZA 2F90A 1RVV1 2XNKA 5TMPA 1J97A 1KI3A 2ORIA 3KFVA 1X8JA 5FP0A 3DVSX 2OHOA 3MLEA 1AHNA 2H0AA 2WJWA 4RM3A 4B5KA 1P1RA 3OJCA 1JG4A 5ENVA 3DDSA 5AJHA 4IH1A 3CNOA 4OGKA 1ENZA 2GM9A 3O4IA 4X7RA 4CIXA 3RUHA 1N7GA 1KF0A 1VE6A 4A82A 4PRLA 5L3SB 2VS1A 2AR7A 2WWXA 1ZAKA 3DEAA 4UAGA 1VGVA 2RCYA 4N3GA 3T7AA 4EJSC 4QGSA 5LUAA 1G41A 1M2VA 1IIRA 1KJQA 1WBDA 2HMUA 2D8MA 3I04M 3JD1A 4ZA2A 3CLKA 5FH9A 2OL4A 1DG1G 1TVKA 3L0PA 3ENKA 1LK5A 3U4GA 2DQSA 4FIDA 3K9NA 1CBUA 1ZFNA 3KQKA 1U7WA 1TAGA 1TQHA 4YCJA 1ULZA 2B7BA 2WYWA 2R11A 4Q4HB 4YT5A 5JMWA 1OXXK 2RGNA 2Z98A 5IASA 4MV8A 3DBVO 2F8MA 5EMHA 5TY0A 4EO7A 3JPWA 3E9RA 4YAEA 1W88A 2CUKA 1PJ2A 4BIMA 4F4CA 5DHUA 5ITWA 1AS2A 1SBQA 3HX1A 3C4VA 4DRYA 2O2EA 5J2TA 4BRWA 1ECBA 2VJDA 3KTOA 3K30A 3REQA 4DQDA 2B1QA 4MI6A 3N8GA 4TSKA 2R7KA 4K9LA 3DBRB 3TIFA 2P9HA 2VP0A 5CPFA 4M38A 4DHWA 2OMKA 1A8SA 2BR4A 3P26A 1AQLA 4MV4A 2WPNA 3L6OO 3DR3A 2FFBA 3LC7O 1AUPA 4XDHA 2IWHA 4ENUA 2QP9X 5FV4A 5JD5A 1LI5A 5EEHA 4IRUB 3UMBA 1YZLA 1O5IA 1Q12A 1TT7A 2G8NA 4D79A 4EO9A 3O9ZA 4KQWA 1K7EB 2EGGA 3SDZA 2QX6A 3OM8A 4TS9A 1MB3A 3ONDA 3Q3GE 3PXXA 3S2IA 2DXIA 4WCFB 2FQ1A 3COVA 3WRVA 3BT7A 4CXMA 1M54A 4XEUA 4ARUA 4DV5B 4DOMA 2I5PO 3OX1A 4JS0A 3X1YA 1TIKA 4NTZA 3WY9A 1OLUB 1W581 3AFIA 3U0BA 3W7VA 5JATA 4TXJA 3JYLA 1L4MA 3WWOA 5I7EA 3C8UA 3CQ9A 3K96A 4KIGA 3F6YA 3TLJA 2B0CA 4RC9A 3TOCA 3W5UA 1MRZA 1QLWA 2NYRA 3FE2A 1JIQA 5K0LA 3T7EA 1M5RA 2XQJA 4UARA 2YUIA 2BW0A 2OCBA 2D4HA 2YV3A 3ZHYA 4C4YA 3QPUA 4CM1A 4EG1A 2FFRA 3PFWO 3K94A 3QEMA 3F5QA 1YUBA 4GWGA 4P83A 5FL7A 4F6CA 2X3YA 2CWWA 1SUDA 4NV0A 3AOEA 4FCTA 4INAA 4K28A 5AD1A 4QUGA 5EIFA 3W5CA 5ERGB 3NJRA 1CUBA 1KJYA 3I4FA 2JJMA 4G85A 4KN9S 4RQTA 1JPUA 4UTZA 2AMJA 4CIWA 4OLAA 3TRHA 3WNDA 1CUEA 2JBAA 2VVTA 3FDZA 5K6AC 5IKXA 2DWCA 3L6RA 1P9WA 4NE2A 5LNK1 4WZBB 4AJNA 1P77A 2EW1A 1C80A 1T1RA 3NKLA 3QPCA 4U2DA 4WLEA 3ZE9A 3EH2A 1OZAA 3L8GA 1TKCA 2I7VA 4FEAA 4LJAA 4YQYA 3WIBA 4Z1MD 4ZMBA 5BW4A 5FEMA 5DU2A 1AK1A 2RHRA 4H4EA 4HHEA 1UBGA 4KJZA 1SEVA 4LBVA 1QZUA 3N7AA 4PLHA 1QR6A 3EXG1 1WY7A 4PCVA 4AY4A 5E38A 4C5CA 1VPDA 2QQ0A 1VBKA 2TMDA 4X84A 1H69A 1L3CA 4C2TA 1WB4A 1WQ3A 1Z7YA 1NYTA 4ER7A 1NN5A 4RY0A 2IHTA 3OLYA 3KL2A 2VTVA 5TPZD 3GNTA 4GECA 5F2OA 1A5TA 3E22B 3JALB 1QF7A 3VTZA 1HLFA 5HP4A 3DAYA 1U1EA 2J67A 2ORWA 3BQMB 3KYDA 3ORYA 4ND5A 2XB6A 4UBIA 1FQKA 3WSVA 3E3MA 4E13A 2LTAA 1CK4A 1HNWB 4LCJA 5AQEA 4QJIA 3C74A 3N2GB 3MS7A 3PICA 3KDAA 3A0UA 1HY3A 4UZEA 1ECFA 1SD2A 2NYVA 3MHTA 1FYFA 4P92A 1SELA 1YS2X 4D02A 3BWEA 2XJ9A 2E9SA 2ZBGA 4MVJF 1AKEA 3G85A 3ANYB 4G1FA 3SIWA 4Q9IA 5AW1A 1QGDA 3DTNA 1E1YA 1WVIA 4NCJA 1U7ZA 5HJ7A 4MUGA 3EPKA 2J7PD 4CDRA 3P2MA 3GN1A 1Z6ZA 4JT4A 1QTQA 4LRQA 3CH5A 1NVAA 3MRTA 3CE9A 5DW3A 4NK5A 2OENG 1Z62A 3JSAA 4GPIB 4YCLA 3V4LA 3H5AA 3OIFA 3QKRA 4CCAA 2GF2A 5JVDF 1ZZGA 1YL5A 4GLLA 4I5GA 3PHBE 5DGHA 4NJEB 3SFZA 5AWFC 4Y2PA 4OGWA 3ID6C 2IP2A 4FWTA 2DULA 1FFCA 2ZT7A 3NGLA 4LV8B 4D3DA 1ISMA 1WULS 5A04A 4QXQA 5LQAA 4DC1A 1A9ZA 2DM6A 2HDNB 4LE0A 4M9SA 3CF2A 3DZBA 1WDMA 5SY6A 1N2EA 1NFFA 5LA6B 3R5HA 1U0FA 2QRVB 3HBNA 3PXUA 3RWOA 1Z0SA 1V16B 4N5LA 4R8RA 1LX7A 3U9LA 9ABPA 4EH1A 4IMJB 3WR5A 3M81A 2NTEA 2I03A 1XWIA 2E55A 4R2HA 5T6MA 2I2FA 3KCNA 3VXKA 1N6RA 4E6EA 4EFMA 3DMNA 1I6KA 4AROA 5DF1A 3ZE7A 1IEVA 2BMAA 1BD3A 3X0DA 1ZIXA 2WWFA 2HBYA 4O63O 3BRWA 3QXXA 4WJKB 5KB3A 3FROA 5AJZA 1K6JA 4ZO6A 4L02A 4LGCA 1IBRA 1E0KA 1Z29A 3T3IA 5JXWA 2WB2A 4X8LA 1FNCA 3FETA 1X80A 5AVZA 1Z5WA 2VDRB 3ZK9A 4C5AA 2O8FA 4P36A 3HKEB 3TQCA 4QJBA 1KVSA 1DQYA 3HQ4O 1W1WA 4FYIA 2UDPA 4TKLA 3V1YA 1YONA 2JFXA 4KLZA 2V1UA 4MS4A 1UP6A 1JZSA 5EHGA 3IIEA 4G0WA 2Y05A 1Z4LA 1BZYA 1SHZA 1T3GA 4HVCA 4BO9A 1QHGA 3I9FA 4L07A 4AO8A 4B0PA 2Y77A 3D7RA 1VRWA 1PYOA 3B3AA 4YRSA 4R69A 1WBBA 4JT2A 3DEYX 1NM5A 2EBFX 5EE9A 2M6LA 1D4OA 2HH9A 2J6CA 1SBNE 1LS6A 2GQ0A 2JIOA 3AR3A 1DDOA 5FULA 1U0SY 5DZSA 1TYBE 2PMKA 5C18A 5JSZA 3PGKA 4OY3A 1FXSA 5G53C 4ZIRA 2Z5FA 1S8AA 4TMVA 2I6UA 3BMNA 5I7HA 2NZVG 3WL3A 3B78A 1SJ9A 4G26A 2IWRA 3G68A 4P3OA 1IY9A 1Y4ZA 3ZTTA 4DN6A 5CD1A 4R9RA 3TX6A 1OC4A 2PMFA 2W90A 1ZL0A 3OA0A 3PLNA 3UGQA 1H1LB 3TQHA 1CF4A 1N0HA 4GWKA 1DCTA 3OE5A 3WA6A 3N0WA 1QB8A 4JX8A 3QKUA 1E64A 3AZPA 3ZX4A 1W36D 2L19A 2P7HA 4UNIA 2OB1A 4AK9A 4YDQA 1KVTA 2ZAGA 1R4ZA 3DS8A 4KEAA 3K0HA 2O8VA 4CQLA 2DQYA 4CODB 1W5EA 4HXEB 4JK3A 4H6PA 1YKGA 1ZEMA 2ZI9A 3KEQA 1UMKA 1IOWA 3VO1A 5LD2C 1CT9A 2QROA 3CNQS 1OPXA 3V4FA 2FDRA 3ZDZB 1SQGA 2QUHA 5DWVA 3UFXB 4C0KA 4C6SA 1CJVC 1TJ5A 2O2HA 5EWMA 4D8WA 3O91A 1D9ZA 4KSYA 1IAVA 1K4MA 1XVLA 2CL5A 4MDFA 4LX0A 1NV9A 1XTUA 1V5EA 1O0SA 5C7YA 2JBWA 4GRIA 4PZYA 4YLGA 1NJ2A 4EARA 2CMHA 4EKNB 1UBLS 1G7TA 2EJVA 4NICA 1RXIA 1Q7CA 1FUIA 2JJQA 2GESA 4LDZA 4RD4A 1GAXA 1MW9X 3G9UA 3QLUA 2Z9DA 3PGJA 1E59A 2COUA 3DBIA 4EG7A 3CVJA 1XPJA 1GVHA 1PK7A 2O52A 3F6SA 1ZRNA 3GUHA 3A26A 4ZVQA 5G1OA 4F4HA 5CB8A 5AVRA 1ZD1A 4DARA 1WXWA 4J3FA 3HCNA 3KYCA 2XZLA 3DM9B 1PF7E 4P98A 2F55A 3AO0B 3L7AA 1AX9A 3ZWMA 1OMOA 4ASUA 4HUQA 1ATZA 1G6HA 1H5UA 1RP7A 1I2DA 1CUYA 4WNCA 5D86A 3RREA 4N9WA 4OHOA 3CF4G 3K5HA 2CHFA 1WHTA 2AJDA 3IAXA 3NVAA 1G66A 3PT9A 4M0DA 4Y98A 1V43A 1XRJA 4GF5A 4K0RA 1XVAA 4EI7A 3CGGA 5FNVB 2Q0HA 3HLKA 4KYTA 4CQMD 3U81A 4JJZA 3CLHA 4X1IB 1Z8DA 4TL8A 2FQXA 2O7SA 5BW8A 5FTMA 5JH7B 2BTQA 1ZU5A 2ZJYA 4XFDA 3WLEA 1OFUA 5ESRA 1Z0IA 3TIGA 2HMWA 2EWWA 1UDAA 2PQ0A 1YB4A 1ZCBA 4FSDA 1X9HA 4PHHA 2PXCA 4EDHA 4BQSA 1YFKA 5BV7A 4F04A 2X2EA 4KTVE 4EJMA 1TX4B 3DEJA 4LVOA 1PS8A 3K8OE 1FSSA 3LUJA 4TMWA 4UZFA 1DEKA 3QEBZ 3FJYA 4C4PA 1QJ4A 1FNBA 4AI6A 3B5JA 1OZFA 3T61A 4GOND 4UNPA 1AK2A 1DOZA 5G4KA 4S1TA 1W36C 2C58A 3M83A 1QCCA 5EC8A 3K71B 1FRVA 1H2RS 4KITB 1YNOA 4Q1EA 4R1MA 3RNOA 4BIIA 2J4FA 2Z6VA 3BAZA 4EJQA 2ONYA 4TGLA 1QIEA 1JEQB 1PQPA 3ZCUA 1C5KA 3LECA 1XMPA 2ZUSA 3AI3A 1T3SA 1WV3A 1KP2A 1ND6A 1XD2B 2R7NA 1E6EA 3FZGA 3GX1A 4AFNA 1P45A 2ZYRA 3R9XA 5CVCA 1Z7BA 1RWPA 3BYZA 3VVBA 4U7HA 5CEFA 3GPBA 1E4OA 1XMXA 3KDPA 2BT4A 3GOHA 4OXNA 3PI6A 3EF3A 4DAOA 1PRYA 1RCFA 1XYVA 4HB0A 2D5BA 1N25A 2HA2A 1HDIA 2YZGA 3NH6A 2IZ1A 2XX3A 2I3AA 2XTJA 4OBXA 4ZJYA 1B93A 3BFVA 3EEBA 2GCNA 4ML3A 4X8HA 3C48A 4JQYA 4D8YA 1KIMA 4KOEC 3E8SA 3TTWA 3NBUA 3GEGA 1JQBA 2B4YA 1VCIA 2HNKA 2I78A 3OCZA 4P5EA 1IUKA 5HRUA 2CV0A 1Y42X 4RTPA 2VNSA 1R16A 2Q0SA 4WBNB 1BQ3A 3QMWA 2NXWA 2NO5A 4L1KA 3HB9A 4R51A 3WIEA 3Q7IA 2WVGA 4WDQA 3ZQKA 3T1VA 5CVDA 5KPDA 2XYQA 4NBTA 1KE2A 5H3LA 3S68A 3VUEA 2FUEA 2UZ3A 3PXDA 4OAOA 2PUFA 3UATA 3ETJA 5GGYA 1F17A 3QSGA 4ICIA 1Y5LA 3O3NB 4PZLA 4I1VA 4XYEA 1B8VA 3EIXA 4OXQA 4F4IA 1JFLA 3CXUA 4HRAA 1GHTA 1F2DA 9LDTA 4HZUA 4TMXA 1HE2A 1VGRA 2GN9A 4DSZA 1F2UB 3ND9A 4HX5A 5K0CA 3R0QA 2CFRA 3NAZA 4O3MA 4COKA 2FWNA 4AKGA 3GJ5A 3PUYA 2Q3FA 1M6EX 3HZHA 5EL0A 5TPWB 2C83A 1I3MA 1SKUA 3OHPA 4N9QA 3ULKA 4Y0AA 1N34B 4MS1A 1URPA 4D4MA 2W6NA 1VMAA 4BBZA 3WO0A 4DYDA 5HM8A 3BSSA 1OAAA 1W0JD 4BVAA 4FMPA 4A7PA 1UM9B 1Q0LA 1H4TA 1SC1A 1U7UA 2IUEA 3JYNA 1E9FA 2R4UA 1QMPA 3I42A 2A5YB 3GQBB 5L95A 4YK7A 1S4QA 2G9UA 2HEIA 4ZJUA 4BZZA 2IU6A 3OTQA 1TKAA 3NHAA 2QW1A 2WF7A 3EPRA 1Y5NA 1ESDA 3I2KA 3LGAA 5CB4A 3S27A 3AUYA 3IYLW 3LRXA 3TKLA 4CFSA 1JEJA 1VE1A 2PS9A 4D82A 5DI3B 1KDOA 1RWNA 3RFUA 3ITKA 1JQ5A 3FPHA 5AHKA 1MIOA 3RVLA 1V2GA 3OP4A 3U4QA 2OCXA 3Q8KA 3V8QA 2AMYA 1YQQA 5IH3A 4RVGA 3BGSA 3M6IA 4MWDA 5LQKA 1NRXA 1SHJA 1KXZA 2YXNA 3OHMA 1C30B 3ROPA 5I4BA 5JCZA 2G9NA 3JWIA 2ZSFA 1E6KA 4M0EA 3H8VA 3K0CC 3RS2A 5LR6A 4AN0A 3EGCA 2ZWOA 4R7TA 2C3UA 4HAXA 3ZW9A 4JXZA 3KKOA 5GADl 4WK6A 2WG0A 2V65A 2ZBUA 3DEKA 4LHYA 1SVSA 1CULC 1ZI9A 3WZ2A 3DHVA 4J16C 4JODA 5HIIA 2IYQA 3GYBA 3KZVA 4XIGS 3UH1A 1QQ7A 1KSJA 5E1OA 1RC8A 4DSTA 2EFDB 1N5IA 2FW9A 4MGZR 1FYVA 2I71A 5L7YA 1AURA 4EKIA 2JPEA 1T1SA 1T5TA 4MV6A 1E3IA 2BKEA 5CTJA 1QRTA 3MGBA 4RTJA 4M98A 4BGIA 2REXB 1UJ5A 4O2BB 4LVUA 4U2KA 3T7JA 2WFZA 1DDGA 1USVA 3AL2A 2D3TA 1ZM2A 3EZNA 4HDQB 4E5MA 2XF2A 3TE6A 1ODCA 3E5NA 1GZ6A 1T5DX 4G5OA 3FPBA 1YH3A 1MAUA 4MKZA 2Y0EA 4NFYA 3MRVA 4DNOA 5A02A 5JAUA 4BNIA 1EXDA 1N2OA 1CY1A 1E6LA 4EZEA 5T4BA 3CO5A 2R1ZA 1RJEA 5CITA 4ZHQA 1DEOA 1VYHA 3EXHA 5JCOA 1R8JA 3WI7A 3KTFA 3KOMA 4LISA 2ID7A 1WOMA 3FTDA 4L50A 1EX9A 1L4NA 2IS6A 4G81A 3T9BA 4RWZA 4BO1A 1JDJA 2HYIC 5AESA 4WERA 1NZJA 4F9FA 5A4KA 3K9FC 2IZOA 4UUPA 1FFSA 2XPCA 3AFNA 4V0KA 4JI1B 1CUFA 4C22A 3THWA 1Y8CA 1G291 4EITA 1RAIA 3IDSA 4FKZA 1I2CA 4OHUA 4DM7A 4KH0A 2BFDB 3UYLA 4C7OB 4Q3EA 3SHVA 3IEUA 1LLDA 4MZDA 4OMDA 1LWOA 4KOAA 2HCRA 3FNBA 4GXQA 4C0BA 2CF6A 1OZHA 1I94B 3EJ6A 2YHAA 3D7NA 4KLAA 4EBFA 1KEKA 3GFVA 4CVNA 5IDWA 4GGMX 1NW6A 4JB0A 4W1PA 1UIMA 4ARSA 2I2AA 3OQBA 4JOBA 7ABPA 4OQYA 2CCJA 1OFGA 1YVUA 4R5HA 5JWOA 4OKIA 1J49A 3FFXA 3KJXA 4LHSA 3N7UA 5A9SB 5E6SA 2YHIA 2J5BA 2BM9A 2FWAA 2JEOA 2Q3HA 5K1ZA 5DISB 2PJDA 4IFTA 3BWXA 3O8QB 3VPGA 5CA1F 3OMXA 4NZMA 5F73A 1FFEA 2NTYC 4U63A 3RTGA 3SHFA 2WABA 2QX4A 3TXAA 3OU6A 1K6IA 2TMYA 4G1EB 1NUAA 4UBMA 1F48A 3AM5A 3GH1A 3MT0A 1U0JA 3CRRA 5EQJB 1WHSA 2FHPA 4H7IA 3I05A 1TB4A 4PGGA 3V2UA 2Q0QA 4B2LA 3F6BX 1M5UA 1WPXA 2FTKE 2J5KA 1N9GB 3MJEA 2G8LA 3FKQA 3N07A 1TU4A 4EB6B 3ELWA 2X0KA 1GAEO 4RYLA 5JLJA 1ZXBA 3F46A 3K9GA 1YJ5A 3CINA 3GMTA 2AB0A 3OU7A 2P4HX 4FKMA 4GMGA 4KDCA 4NWIA 4NYMQ 5BSKA 3C39A 4QO8A 1DTEA 4O6VA 3FPCA 5EYPA 2HB6A 2SCUB 4UHHA 3X2EA 2JKDA 4XRGA 2RFLA 4LG1A 4IJWA 3GFFA 5EWJB 2EIHA 4GKKB 2PWBA 2F9MA 2ZJAA 2DUUA 4E5PA 5FFMA 4DA6A 2VYNA 4HKTA 3PSHA 3FF1A 3CEAA 4EVIA 2IRWA 4KXLA 4MW0A 2B4RO 5E0OA 5MDHA 2DPYA 2OHHA 3H0CA 1IOVA 1CHNA 3NETA 4GH5A 2VHJA 4MEJA 2J8ZA 4ND8A 2QN6A 3OP1A 5TXGA 5F12A 5F5LA 4U02A 1NJ1A 2LW7A 1V3QE 4TTRA 4XUGB 3FCYA 3PQ8A 5C5IA 1PDOA 1R4NB 5F1KA 1JDZA 4J7XA 4DREA 1AN0A 4HB4A 1SRRA 2OK8A 3MIIA 2H2WA 4CKBB 2GM3A 3W8NA 2WD7A 2W8BB 4IDCA 3PR3A 3A6FA 3G8YA 4L5AA 2QRUA 3P32A 3I72A 4MVJD 2ARKA 5EIOA 5GVRA 3WK9A 3W5BA 3FTEA 4EHDA 2RI1A 4FC7A 4YIKA 5H8WA 4NFLA 4OJQA 4OJTA 2J0UB 3EFEA 4BYMA 1RPZA 3RKRA 1BC5A 2G5PA 3R5SA 5KJ1A 2ONCA 2Z57A 2O14A 2YJ3A 1MENA 4UUNA 3KT8A 3E8MA 1J09A 1PP4A 4POAA 2QN9A 3WHKA 4OO3A 4FX5A 4RPJA 2NACA 1R50A 2X0DA 3R77A 1MO5A 3MDBA 5EFOA 1GGEA 4YJ3F 1O96A 3NXKA 3EXEA 1PGNA 3COYA 3OG9A 2IYLD 4PR3A 2P1ZA 2PRKA 1SURA 1FS6A 1NG1A 3F4BA 5FOSA 5E6RA 2VXBA 4M88A 3RSQA 4KVAA 3BH0A 4WLNA 1Q2UA 3OTHA 4PG4A 4EPXA 5DYYA 1G64A 4BLTA 3AVYA 1UANA 4ARIA 1L6IA 2XI4A 3LUKA 3JQCA 3HJHA 4TYMA 4PN7A 1DP4A 2XXAA 2CFCA 4FMDF 1CP2A 4N65A 5JPCA 4DKXA 4HYTA 4ZVOA 4GMXA 3M3PA 4J7CA 1ESNA 2NLOA 2QZ9A 1EFRA 3TNFA 4DRXB 5I45A 3SJZA 4P1ZA 2GF9A 4UCFA 3O3MB 1GKKA 3D8SA 1SQSA 1MOZA 4ALJA 1POWA 4BNYA 3OZDA 4C4RA 3AEQA 1M1NB 4X1OA 1ZGAA 3SN6A 4XGKA 4BNHA 5K03A 3NYIA 4EDFA 4Q7KA 4MARA 4TV8F 1KQPA 5ADVA 1TC1A 2CLIB 1G8SA 3P94A 4J0KA 4EF4A 3LPLA 3OOHA 5IVHA 1IQRA 2H1IA 3FYDA 3M33A 1O4VA 1LRJA 1XRSB 3KLNA 3M3HA 1NN3A 1ZK4A 4L28A 2EOAA 3U4HA 4CM8A 1VI2A 5D5HA 4D3YA 1M1UA 2WJGA 2XUDA 2JFFA 4YRBA 1EM8A 4TMZA 4Z7JA 5JYBA 5E4YA 3DEFA 3SVLA 3JASA 5BVHA 3D6MA 1PQYA 2JFGA 3TIVA 3I8XA 2BV3A 3B3JA 5DSTA 3A37A 3KJGA 3T0GA 4DCSA 1RQGA 4DMKA 3O8OB 1L4EA 4ABYA 1R0RE 5ARBA 1LTQA 2ZG6A 5K4GA 2PS1A 4YTEA 2RGBA 1C9KA 1J90A 3FIUA 1NLYA 5EZQA 4W6QA 3ZV7A 3KK0A 4PG5A 4HNTA 4KRGA 3RUAA 1UXHA 1DG9A 2BZ0A 2GA9A 2IIPA 4QBFA 5EP3A 3BQ9A 3RROA 3RVBA 4JVNA 3LG2A 3IP7A 4I66A 3HUEA 5A7HA 1M72A 2P5TB 3W6UA 1SG6A 2R6DA 5IAEA 4PHGA 2B7CA 4EJ2A 4MR7B 1DC3A 1IJBA 2REQB 2VUUA 3EIQA 4JLUA 1O9HA 2RH4A 1TE2A 4G2TA 1JEYA 2CD7A 4D9JA 3OCYA 5EXTA 3ZCSA 3EOBI 4Q3CA 1E2DA 3RE1A 5TGZA 3ASYA 4QYIA 4LWZA 1QH8B 4WV3A 4I8XA 2G88A 2XDQB 4N39A 3ONNA 4PWZA 4PICA 3LXRA 3JQ7A 3IMKA 5KQSA 1GT91 1E3EA 1JHDA 3WLOA 1JS1X 1YCHA 3VOSA 5LDHA 5COBA 4CM9A 4WW0A 1RJGA 1UAAA 3U4CA 5JRZA 2PH5A 1MFZA 2JLRA 5H7XA 3HZZA 2YHSA 4KXFB 4D9IA 4X7PA 1GXSA 2K2QB 4KQGA 4LW8A 4QJ3A 4B2PA 4OLBA 2WJAA 3JZAA 4O4IA 1N6KA 3SEQA 4O4HB 3GPLA 4G6ZA 1U63A 3KZXA 1T43A 3NUGA 2IODA 1M7BA 1V45E 3QUAA 4KBYA 5C2JB 1ZJ5A 3DZHA 3AC0A 1B76A 1F0NA 3ZLVA 4E7OA 2EWVA 3R7SA 4NMMA 4GZLA 5LSAA 2C3YA 3N59A 2TYSB 3FR8A 5CT6A 3ZK7A 3EF0A 2O8NA 3MINB 1NX6A 1ZOOA 5I4KA 3ZIDA 1ZH8A 4CTNA 5B3LA 2JHAA 1Y7IA 1ZVVA 2P8JA 9GPBA 1KOJA 2DPLA 2VHTA 2QUIA 4RCYA 4BKUA 1E5VA 1X1CA 3CISA 3LHSA 1R4MB 1MP0A 1A4UA 4PV7A 1N3BA 2G1AA 2VJBA 2W6ZA 3EDCA 4MVCA 4QNRA 1Y8AA 3F7TA 4DJJA 1VL6A 4DMHA 3TE7A 3E1KA 3MWDB 3RBXA 1SU7A 2KS6A 3QKSA 3P7MA 3FB4A 1MF7A 3VPAA 3S70A 4WDRA 3MILA 4AZVA 4B74A 2VQDA 1QJCA 4CF3A 1X8XA 3R9WA 1NQXA 2J0QA 3R7FA 1EZ4A 2FWRA 3CUVA 3C6BA 2ILTA 3IXMA 2FK8A 1TLFA 5K3EA 3I8OA 4EENA 3DYBA 3DBHA 1FEZA 2FHSA 1OXVA 1IOLA 4P4UA 5DJ5A 9MHTA 1QO9A 5JV5A 3TL2A 4EG0A 2NSYA 3VHXB 4G4SP 3VZSA 4NABA 5J3JA 4QUJA 3ZBQA 4ZT4A 3TBFA 1D1QA 2ECFA 4QRDA 3WGOA 2COEA 5M34A 1YJXA 4CI9A 1GV0A 4BC1A 1IY2A 4BFZA 4RHFA 1T5OA 4BO8A 1Y1LA 1FK8A 3ZHOA 4MDEA 5ICCA 1QZXA 3D8HA 3TZCA 1L3BA 5HNKA 2FY8A 3IUBA 3IMFA 4E6PA 1BHO1 1SZJG 1Q7EA 4FE4A 5JXJA 4Q66C 4C2UA 5BN4B 3LOQA 2D0OB 2Z4SA 3DE7X 1TPYA 1Z7EA 3DB2A 4GI1A 1XCGB 2PZEA 1FX0B 2GPSA 3LO8A 3A05A 3O8BA 4JJIA 5A9TA 1PVOA 1ONOA 2PR7A 2WAOA 4UTOA 1BDJA 4XIIA 1EAYA 4NNOA 3MTJA 3K9CA 4HRYA 5KMGA 4R7GA 4LOJA 3I4LA 3T3NA 1ZCAA 2FR0A 2BM1A 3HYLA 4XH9B 1YCGA 2NU9A 4GI7A 2C07A 2V55B 1U8FO 4HDAA 4OQPA 4ON9A 2FSPA 5F2NA 5ECGC 2OOKA 3BJZA 3A9UA 5CDUA 1ZH2A 1K7SN 2IH2A 1OWPA 3OH8A 4Q9DA 2OZPA 1MNAA 4HAUA 3OEHD 4XM2A 2YWHA 2PM8A 3JQBC 4I4TF 1WRBA 4EECA 2GCGA 1KJWA 2IU0A 4NXNB 3LJKA 3WIUA 3GVIA 1U0BB 3QGMA 1MZPA 4HGNA 3V48A 1MBZA 5FI1B 5HRCA 1USUA 1TVMA 3MTAA 3ECAA 2CDNA 3W90A 3BMCB 2IGTA 2EWMA 4KWEA 1A7JA 3D4PA 1OT5A 3L04A 3ZBUA 4AJIA 5HKKA 2QY6A 4KSBA 4HFJA 3TOXA 3OQ1A 3VH3A 5KTRA 1JEDA 4ZWNA 1XJCA 4A1OA 2O7QA 3ECSA 5DW0A 2KBEA 1ACJA 2ZYWX 4PLVA 1ZUNB 4J7AA 5FPPA 4EQZA 3RKUA 1MA3A 4XCQA 4ACBA 4A16A 4YRDA 2Y93A 3G2IA 4N0MA 3EIUA 4H31A 4MLCA 1SC9A 3RIXA 3ZDFA 1NSYA 2O8DB 1VBMA 3SD7A 4LYJA 2WM8A 1GG5A 2GBPA 3D81A 1YFJA 1ZNYA 3GLQA 4Y67A 2HHHB 1XFDA 3MB5A 4HSGA 2QHXA 1S7GA 1V1JA 3NIFB 4FFDA 1W2GA 3WJ7A 2JI9A 5GM2A 4AECA 5KINB 3RSCA 3HSSA 3ILYA 4CJXA 3W6NA 1VECA 1NU8A 1M1YB 1X7ZA 5DCWA 3M6AA 2ZDHA 1CTQA 2PMBA 4FN4A 5AK0A 3R6DA 2JATA 5IJXA 5I5GA 3THOA 2EBUA 2QLFA 3WSWA 5FD8A 5GONA 3DOEA 2CFIA 2XYVA 1EG7A 1V7QA 3BRQA 3CY6A 3KBOA 3PLRA 3RS4A 4ED9A 2PXXA 2MJLA 1NN0A 4ZOLA 4RW0A 3EZ6A 5PNTA 2DUJA 2GCOA 5FWYB 5BSWA 1JQJC 2Q0XA 2YWBA 3TG2A 1J8MF 2BFMA 3QX8A 5FJJA 1GUAA 2VCEA 1DARA 4QLOA 1BOOA 4C3VA 1HYEA 4E1AA 13PKA 1D4FA 3N86A 1X7GA 2C97A 2X5XA 3CLSD 2P3LA 3R40A 4RACA 3K1AB 1TCBA 3UTDA 1EGQA 4MYDA 3MJVA 2HMYB 4KXQA 1C4KA 1CUDA 1R0XA 3LK6A 2ERCA 3CT6A 4EAQA 5JTTA 2E1RA 1TM2A 3H2GA 1W85B 1ZD4A 4RD3A 3WISA 1NMZA 4OQZA 2HA0A 3KE8A 4NNJA 2FSHA 3OQMA 3PYXA 1T1IA 3NAMA 4AUNA 1DAFA 3DO8A 5ALNA 3ABRB 1S8OA 2VYVD 4ZOAA 3S40A 3Q3JB 1MUUA 4OM7A 1E62A 4D8TA 4U2EA 3CJTA 4LZAA 4UUBA 4D97A 5TS3A 4F5WA 2WQ7A 3H17A 4CV0A 2WE8A 3QPVA 4X1KB 1AXGA 2O4CA 2ZJ8A 5IRCD 4FLMA 4K9QA 3QKWA 5ICFA 3L8DA 2WV7A 1XRRA 3L1HA 5SY4A 3V00A 4BFXA 4MO2A 2V98A 4QPCA 1X70A 4P5PA 2YRFA 2G25A 3T35A 1NBMA 2TMGA 3ZVLA 1U5BB 3SM9A 1W9HA 1FYEA 1IPEA 2FSGA 4FIZA 4DHEA 4JELA 4BNMA 4C08A 2O6LA 3L7JA 3GGSA 3U16A 3E7XA 2WMOB 5IXJA 2I99A 2MIIA 4QLAA 4W9MC 2WF5A 3NTQA 2NP7A 1ZLXA 4KR7A 2E48A 1HL3A 4BVLA 1QZTA 1W4ZA 3KLMX 4F9EA 1MO4A 4C4SA 5EAIA 5FPHA 8GPBA 1VPLA 3A9WA 5GAJA 4ZVRA 1SZPA 2V7PA 5H02A 1HFKA 2EARA 4RZUA 2CBGA 3RAJA 4JYMA 4AWXA 4UOZA 1NW5A 2HGZA 2YTZA 4GD3Q 1P4HA 4R16A 2VQ6A 3N76A 4YPVA 3O8NA 3Q6NA 3H3XA 4BVGA 5C32A 2IYTA 4XWGA 1AT1A 1EFCA 2P5YA 1ILEA 1VL5A 3H19A 2H1HA 3BCHA 3LD9A 3LKZA 3TNLA 4IVPA 4A8TA 4QBHA 4KUHA 1M6WA 4LF4B 2JFQA 1OX5A 2XRMA 3G9ZA 4H18A 2NAFA 4MLZA 4MTLA 4AF8A 4FINA 4PLFA 3QBJA 4UBJA 5K0JA 1E2BA 2E85A 3H9QA 1OPRA 3K4PA 2C4WA 3OOEA 4GT1A 2W6PA 3LA8A 4IOLA 1SFRA 3UA4A 4OF4A 5AVXA 3THXA 3ETDA 1M5TA 5TC4A 3T3DA 4AL4A 2X2PA 3OIWA 1ZITA 1M6VB 1QCYA 4P8RA 4M2LA 4DMFA 3CLSC 3QVGA 1F8GA 2B8JA 2JD0A 1HDOA 3KDSE 4IDNA 4Q93A 1EX7A 4FKBA 3RRJA 1J8FA 3O3CA 4DB4A 1Z15A 1J70A 1U3FA 4XVQA 4Q4HA 2JA1A 4HWKA 2ZB7A 3HFJA 4BUCA 1R5JA 2I2WA 1MLDA 3IAM1 4H08A 3W2EA 3B48A 3CJQA 1QGUB 3K9QO 1ML3A 1OLSB 5AW6A 4LZJA 5AKLA 1XFAA 3W6OA 5AICA 4PTZA 1X9GA 4UXIA 4WECA 4IIYA 5LP6A 4IJ5A 3I61A 4GKAA 3CBGA 1F60A 3LLMA 1F20A 1JHUA 2ENUA 4EY5A 1SXJE 3FDXA 1T36A 4DDVA 1OXTA 4I6EA 3LW7A 4IPTA 5AHXA 5E2BA 1CYDA 3FDJA 3WV4A 2IOFA 4ISCA 1MRNA 2FCRA 1B6TA 1U0HC 3ETNA 3M2TA 4R1UA 4C14A 2OHGA 4GMDA 3SXPA 5D5QA 5C81A 1N1MA 2GEKA 3LS2A 4DLUA 1XLUA 1FNMA 4DR1B 1GPNA 3IXLA 2FMTA 3BUSA 5IN5A 1H2ZA 2ZE6A 3FMVA 3VC7A 3VKWA 2PQMA 1TVCA 1X42A 2QJWA 1J07A 3OZXA 4C20A 3ICEA 1Z34A 1IFXA 2P4UA 1RAFA 2H4ZA 4N7RA 1QMGA 1JA0A 2CVZA 3KVOA 4H7DA 3OQNA 4LBYA 3PKZA 4RSMA 1I6WA 1WLSA 4JJAA 1BDMA 1ISJA 1PN3A 1QIJA 3EQ2A 4N82A 5K3AA 3SYLA 5EE1A 1Y9JA 1A9XA 1G5QA 1GG8A 4C0HA 3QVSA 4B9EA 3AF6A 4UU8A 5AUQA 3PIIA 2JGMA 2PKQP 1S96A 1U2TA 4L9AA 3I2JA 2B30A 4YC7A 2AMLA 4UU1A 3BJRA 2WINI 2H2AA 1L1EA 2QRMA 3YASA 2NQ8A 4OL0A 2AVDA 2C5EA 1DJNA 1HZJA 4K9PA 1CG6A 3C8DA 3H11A 1NN1A 4LZLA 4MHOA 4Z8YA 5MHTA 2CUNA 3H83A 3RNLA 1N4AA 5C34B 1XQXA 4ZREA 3LHIA 2PT9A 5AXAA 3SXUB 4BAZA 4W5TA 3P9RA 2AUNA 3C8MA 4UW9A 5EXSA 5FUMA 1C14A 3TQIA 1H8EA 3VVCA 5HPYB 5CYOA 1LLCA 3EEYA 2WT9A 3EEOA 4F2PA 3HEAA 5CBKA 1LLQA 4ZZ3A 3AZQA 1DBQA 2W2LA 2ZR7A 4X8OA 4HWSA 3ZXSA 4D92A 1DXYA 4A73A 1GQYA 1M0TA 4F72A 4FBMA 3SWWA 2XT6A 1TMYA 4ZVPA 3ORRA 3NO4A 4PO1A 3L06A 1KETA 3R24A 4UHKA 3IKTA 1R9MA 2ZRQA 4NEQA 4XW2A 2HNAA 5ARCA 3U31A 4P22A 1L5SA 3ZZ1A 3PR2B 4N6NA 1C3JA 1L8AA 2C9MA 2FPMA 5CFPA 1NBWB 1H8HD 3T3GA 3U61B 1GA4A 1V2HE 2AZDA 2J07A 3EA0A 1J1IA 1U2DC 4XGNA 4ZCLA 4TN1A 3FM9A 3T12A 3MSXA 4PW0A 1A8QA 1E1LA 5BNIA 4ND3A 1TA4A 1IN6A 1U9ZA 2B6HA 4DIUA 4DNQA 1BXKA 4NG5A 4BNDA 1RT9A 2RHLA 3NBAA 4DMLA 1HT3A 2P65A 3A1VA 5H5JA 1B8OA 5KS2A 1JLRA 1ZGZA 4AAYA 4KN6A 3EHDA 4HDMB 5BWBA 5DGXA 1B23P 1C7EA 3R7WB 2CLFB 1QFZA 4FONA 3MSCA 5DP2A 4Y2YA 3INNA 4PXSA 2KJQA 5J2UB 4A92A 2VL7A 1MAVA 3JQ6A 3QU2A 1LF0A 3IP5A 5KNBD 1NBIA 4RH0A 4C6TB 1HSZA 5E4JA 4YT8A 2W8ZA 3MBIA 4ERNA 2VFAA 1EUYA 1NF2A 2IL1A 3Q0EA 3AJAA 1D04A 4U8GA 3DUFB 2JL1A 3ME5A 4LY0A 5I7AA 4KIUA 3RSOA 2EF0A 1NE7A 2QSZA 4C0WA 3DEHA 4N40A 1DBPA 1YJMA 5C51B 5DBGA 3OE4A 2XQKA 2AXNA 3PDUA 2B1JA 4PQRA 4XVRA 2AYYA 4QPZA 3TPZA 1U7TA 4LZZA 1GPJA 2Z08A 1WV0A 3EQ7A 1E5QA 3IQHX 4ZFNA 1HE8B 1KBQA 5HJEA 2QG4A 1JH8A 4QM7A 1YA4A 4OUDB 4O33A 2GHRA 3E9DA 4J1NA 4Z9YA 2OYCA 3L4BA 2ZXUA 4FNOA 4YRLA 2XECA 1NATA 3I28A 4E70A 2CJXA 2PJRA 1G3IA 1OZ0A 5ESWA 2HZBA 4GICA 1J6UA 5FO1A 4NPAA 1QS0A 4LN1A 2K7FA 2FRDC 3LIIA 2QA5A 1YBVA 2FX3A 1VPWA 2A92A 2CUZA 1MZKA 3S7ZA 1UAYA 1OX4B 3F47A 3GLHB 3QVXA 4DCMA 4LKOA 2G5TA 5B58C 3EFOA 3L7YA 4GBGA 1PJBA 4MB0A 1YRHA 4GUAA 1DTWB 3VPSA 3DA8A 1CW2B 1NVVQ 3B1JA 4MR9B 5CYFA 3D2AA 1NF3A 2IY7A 4WTOA 1BA2A 2EBHX 4XFKA 3ZI4A 2A30A 5H59A 5AVUA 1LDNA 4PLCA 1T15A 2J3QA 3WGLA 1JDUA 2VWHA 1ECGA 2E4WA 4ZI2A 1QDUA 3CIFA 4CDGA 2XBMA 4NYMR 4GOKA 4TXNA 4IO1A 1SOWA 1VJ1A 3IJEB 4P38A 2Q9BA 1VL2A 1C3EA 3A3OA 3PUVA 4HXYA 1ZN2A 3B5IA 3BGDA 5ALFA 2QYOA 4WESA 4B79A 2F67A 2I9PA 3KJQA 1UBKS 1PZMA 1Y8ZA 1IK6A 2OD2A 4L51A 5K2MA 4CQJA 1IVYA 1XA3A 1ORRA 1PBNA 1M1ZA 4KQ1A 2IW3A 4MI3A 1Q1BA 3R3SA 2GVDC 5BN3B 3BXXA 4QRHA 1L8LA 1V1MA 2FZ5A 3A6JA 2GAIA 1D0SA 1PIWA 1GFIA 3CJRA 4JWTA 4OSOA 4N5DA 4Q3KA 3EWSA 4Y1RB 1XELA 3T4UA 5LIPA 3DWIA 1A9QA 1UC5B 4QQFA 5THXA 1XD9A 4M8IA 5KYGA 4ZRDA 1BN6A 2OFXA 4OAPA 3E27A 1U8AA 2QLLA 4B9AA 1QGYA 3JCZA 4IDEA 1JSLA 4UDNA 4LOKA 4DNPA 2MT9A 1MC4A 1BW9B 1UMDB 1E8MA 4W7IA 4K8OA 5K8LA 1IWOA 1M66A 1NUSA 1Y9ZA 2V9ZA 3LTEA 4HYYA 4HEA6 5EJMA 4IQ0A 1XHLA 1G4HA 1VCMA 4MYTA 2GDJA 1RZUA 1QBGA 1JHMA 3MM4A 4Y9RA 4RXUA 2OM2A 3K0KA 1HI9A 1VJRA 4H7HA 2JLAA 5B3JC 3MYRA 2WDPA 4MB2A 3TZLA 1JTVA 3IT0A 1F3LA 1G6OA 1Y34E 3HDHA 3L41A 4FGUA 1SVLA 4QOEA 1RXEA 1QE0A 3ECCA 5HMMA 3TIIA 2VAVA 1JHOA 1J2UA 1C9DB 3ZJ5A 5KZMB 4F2WA 5C8DA 2J5XA 3BE5A 2XOEA 4HQKA 2PT7A 4IIBA 4RHCA 3VR5A 3ZCPA 4C78A 3C8HA 2YXPX 1U0NA 2VDWB 3GHYA 3IO5A 1YQTA 3DXFA 4ZVNA 3PRHA 3TLYA 1ZOSA 3QUQA 5MF6A 1DAKA 4J91A 4W1SA 3QHPA 5TMDA 3H9EO 3EGEA 4MJXA 1Y1SA 2NU6A 4M9RA 3T9FA 3VR2D 4YMHA 1FL9A 1L7EA 2V45A 4J2HA 5BV8A 3FCOA 2BUAA 3QITA 5JZMA 2NV6A 3PRJA 5DGTA 1IG0A 5TQ2A 3S8EA 3FSJX 1Y98A 2P2GA 5IZCC 4V03A 2PRIA 2IYNA 2WIFA 1N2HA 5BSVA 5JISA 3OCUA 3PL5A 1XJWA 5CVVA 3QYJA 2Z6AA 1DC8A 3WQSB 3VPCA 4DLVA 4P4SB 1NSTA 3WZLA 4S3MA 1EBUA 2J3IA 1T8UA 4FC6A 1J9EA 1WUYA 1ZIYA 3WKEA 3RYIA 3TRJA 3B12A 1L5ZA 3ND8A 2B92A 4H3VA 1GR0A 1NR5A 1Z5VA 5I8WA 1HV8A 2Q1UA 4Z51A 4DUYB 2XWQA 3A2LA 4OM8A 4Q01A 4CG2A 5JSKA 4MV3A 1ZMXA 4RKFA 2XTMA 3ML1A 2HDOA 3T1TA 1KY3A 2QWXA 2FRXA 5DNDA 1AUOA 3HDTA 3H9CA 4YFYA 5AKZA 4HGYA 3WHLA 3JS5A 2NVOA 3DKRA 3O0DA 1NJ6A 2DQKA 3U1BA 4JC5A 3SS8A 1YDMA 1QH9A 3OCCA 4YRTA 1KKMA 2R1VA 3G0CA 3TI7A 4YASA 4AZTA 3PEEA 3P9KA 1U04A 3UJAA 4TKMA 4IAOA 2XF8A 5FBLB 3TCNA 3GLGA 3KB6A 4ARZB 2KM1A 1N6OA 2B35A 3AEKB 4UJ5A 2F3PA 3DOCA 3GEPA 1ZK3A 3C85A 5B1DA 1KXJA 3IT1A 1T6ZA 1JVNA 3AJDA 3BN3A 2AMFA 2I4LA 2QUJA 3QF4A 5FBZA 3AKYA 3HCDA 4DM3A 1M83A 1KORA 2BISA 4ER5A 5TDHA 1UINA 5MFPA 3OY7A 4G89A 1PV4A 1IU9A 3AY3A 4D44A 1TU3A 1EAMA 2FA9A 2QMEA 2AE1A 3GVXA 1QP0A 4IXNA 2NSDA 2BEKA 1PR3A 2PSFA 4GS5A 5HGXA 3BQNB 3K9WA 4MVWA 2AFFA 3G5TA 4AYXA 1QSGA 4B43A 4BXOA 4JU9A 3H2JA 2C8JA 3TX2A 2B8NA 5BVGB 2EBWA 5AW8A 5LDDC 3NNDA 1MK2A 5C3MA 3L1VA 4BX0A 3W34A 4D9HA 2YQ4A 2A5JA 2IE8A 4LC0A 1IBCA 3IC5A 4U7FA 3RC2A 3OQIA 1U2GC 4F8JA 2E87A 2BEVB 2PKEA 3E70C 1U31A 5FWNA 3I6BA 4C01A 1BE8A 2VHWA 1G88A 1RHKA 4HX2A 1XSEA 2X86A 3A4NA 1ILWA 3BRCA 3RSSA 3VISA 3J80A 3WQQA 4G3XA 4UE6A 1Q57A 3U3MA 3N8DA 3ZLTA 3DE6X 1A5ZA 2KBFA 2YXBA 2CNOA 4IJVA 3ZWPA 4CUZA 3PQDA 6YASA 3I5AA 3QJYA 3ZZUA 2CL7X 1GXCA 1YU9A 3A1UA 5LQCA 2CV1A 1ZNZA 2POCA 3HPRA 3KEOA 2IPNA 3HVUA 2IF2A 4PVCA 3GLUA 1HDEA 1ZEJA 4J2OA 5JSHA 2LZ0A 4Y18A 1TLLA 3HCRA 3TMKA 4X93A 4PYIA 2OCYC 3Q9UA 3M6LA 4ZP1A 4YLY