2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
3ABTA 3F8MA 5G05C 2V1DA 2OOEA 3J7AO 3R9AB 1HKQA 1BBYA 1YYVA 4Q48A 5H20A 3LY9A 5JJTA 3AS8A 3PO8A 1UFMA 3D5LA 4YIIA 4UVCA 4EJVA 2LNBA 4ZYHA 3LKUA 2RDPA 4RAYA 4JONA 2Y48A 2XEVA 1U78A 1LGQA 1I1GA 2LKPA 2KFUA 3F6VA 4WNGA 3KP3A 3PQKA 2Q8KA 5J8CA 4AIJA 4M72A 4M6XA 1FHQA 5G04J 3F3XA 1SMTA 1IHGA 4Y15A 2VE8A 3QDNA 2EB7A 5IT9Z 3V8JA 3E3VA 1F5TA 1T2KA 2EK5A 2KATA 2QZ8A 5HLHA 4LJZF 2RVCA 2KCVA 3REOA 1EH8A 5L3EA 2L6JA 3ECHA 5L3CA 2JTVA 2QYOA 1B4AA 2ESNA 2PEXA 3ASHA 2HFHA 3HOTA 5CVJA 4ZYEA 2ELHA 3WTUC 1PP8F 1YIOA 3R0AA 3SHFA 4LEUA 2AXLA 1B6AA 1EH7A 4KDPA 4LLGF 3P9IA 4CGZA 5IT3A 4AIHA 1KGSA 2OD5A 5F64A 2CG4A 1JGSA 3MEXA 1QBJA 3GW4A 2ZFWA 3PQJA 3WTZA 2IA2A 4H7XA 4IPAA 2A6EF 2E7WA 2XAHA 2A5YB 3MZHA 2XUBA 3FXRA 2DBAA 4EJOA 2QENA 5BT1A 1B59A 2ZBKA 2HTSA 5H6RA 4HAMA 1ULYA 4YFNF 3RTRA 1H0MA 1WLNA 1XMKA 4BTAA 3K0LA 2OAZA 3J80Z 2M30A 4XSZF 1SFUA 1XGSA 2VONA 4I17A 5ICGA 3WU1B 2P6SA 2P4WA 2IF4A 3HUFA 3ZN1A 4I7HA 2R5SA 1LDKB 3ZPLA 2C0LA 3UUXA 2DLLA 5L3DA 1WM5A 5HS8A 2VYIA 3TDZC 2LSVA 2JRTA 3T0YA 1DPUA 2QFCA 3I6UA 4G24A 2DPDA 1FZPB 5CCLA 3WE3A 2ZJ2A 1LQ1A 1SD4A 4EGYA 1J2XA 4EJUA 1ODDA 3BJOA 3GYZA 4LK1F 4G7ZF 4R79A 1UHMA 1FBUA 1TBXA 2BYVE 2C6YA 2ZO4A 4NQ0A 2XT9B 3GFMA 1IXCA 2P7CB 4IRGA 4LLNA 2A07F 4D9VA 3VPYA 3DXJF 4KYWA 2PL2A 3P9CA 1YLFA 3OOPA 1K79A 4L9NA 5D5UB 1QO0D 1ZH5A 1O7LA 4ENJA 3RPQA 2PQNA 5KJLA 3Q4AB 4A0EA 4EJQA 3NF1A 4AY6A 1UHTA 3VA1A 1S8NA 3E6BA 4EGZA 1T38A 2Z33A 5LRSA 1O3TA 2FOKA 2MH2A 1G3WA 1HBXG 1XCBA 1HH8A 1O3RA 5L3FA 3MV2B 3FX3A 5EEHA 1LNWA 3BZ6A 1MJ9A 5DYMA 3NQOA 2GWRA 3FF5A 1IN5A 1RZ4A 2M5WA 3ZHEB 1Q1HA 2A6HF 1GHCA 1HSTA 4KICA 2EFQA 2HOEA 4GZ6A 3GWZA 3ZGQA 5A2QK 4IN3B 4UQZA 3MFKA 2H09A 2JPBA 5CVIA 2P5LC 1HSJA 2FEZA 1WRJA 4WCGA 3POAA 2DPUA 1TLHB 3GW2A 1OMIA 3S7DA 1R21A 1YO5C 3BJAA 3F6OA 3VA4A 4WXCA 3KAEA 3UPVA 4GGGA 2O61A 3KT9A 1B9NA 1JXSA 2WTEA 2VC0A 1G6GA 2XASA 2W3OA 3JW4A 1BC8C 4M9SA 1OYYA 3K1MA 3SZ7A 3IWZA 1FBQA 4RB1A 4BXUA 3LA7A 1YS7A 1DPRA 2O03A 3N4MA 3I59B 3HOSA 4YVQC 2HYFA 3ZHEA 3W6KB 3FXUA 5E8IA 3FM5A 2ONDA 5DUIA 3LAJA 2NRAC 3HRMA 2L02A 2DBBA 2L01A 2HKOA 4L5IA 3G73A 3TOAA 4R8HA 2ACJA 4L5JA 3HX1A 2MHKA 2ZNZA 4U0ZA 1U6GA 2KC7A 3F8FA 4HX4A 2YPRA 4GYYA 1GVJA 2L4AA 2H94A 4BHCA 4GA1A 4LG0B 1Y8MA 3E5XA 3EETA 4GYWA 1J9IA 3LWFA 3E5UA 2H6BA 1DDNA 2VODA 1YJMA 1BM9A 4WK8F 4XBFA 3L2CA 2E7XA 2FNAA 3KE2A 5LGUA 5G05J 2QWWA 2MLGA 3CO7C 1MZBA 2YX4A 5F6FA 3BP8A 2C0MA 2VBXA 4HX7A 3GXOA 2Q0OA 4G23A 3HTSB 3AS5A 2DT5A 3DPLC 5DJOA 3WTYC 4KBQA 1GXPA 3VFZA 4UV9A 3KLOA 5E1XA 1ZGAA 3V8LA 5FLXZ 1SAXA 4QLCU 4EM0B 1ZG1A 4HOBA 1ZREA 1FYMA 4I9CA 2O3FA 4MNUA 1P4AA 2QQBA 4MEYF 3TG4A 4KA4A 2KCLA 1YW9A 1BIBA 4E70A 4LG0A 3ZMTA 3LA2A 4BT8A 5A7DB 1MJAA 3D0SA 1HW1A 2WC2A 1XSDA 1ZN2A 1FP2A 4Q47A 1V3FA 3ML6A 4Q5SF 5EX0A 2R3SA 1P92A 2D1HA 4RGSA 5CYVA 1SFXA 5LLQA 3I0MA 3LYAA 3Q5MA 3FMQA 4I02A 4RGXA 3CTAA 3TO7A 1IZ1A 3GF2A 4L9VA 3GFLA 5FD5A 3MWMA 2PQRA 4P96A 3CKBA 4EVIA 4A2UA 3KFWX 2BBYA 3RKXA 4UNOA 1O57A 2MA3A 2J9QA 1FPQA 4F7ZA 1OYWA 2OA4A 3I71A 5D5XB 5JJ6A 2GA1A 5BNWA 4I0AA 1YS6A 3I0TA 2PQ8A 2UZKA 5FFZA 4I0BA 1KA8A 3HTUA 4G7HF 4GYOA 3ZP5A 1PC2A 3EYIA 1P5QA 1R23A 3T5XA 4L9JA 1I27A 1SD6A 3R61A 4JHRA 3HYIA 1KU2A 4M6YA 3HIFA 5ICCA 1LGPA 4UXNA 3V7SA 1Z6RA 3RKYA 2XHKA 4J0UA 4EQFA 3CDHA 2LF8A 3R6SA 2QLZA 4GXOA 3TGNA 3HHGA 3U9GA 4WWCA 4O3MA 3UNNA 3KEOA 4KMFA 5C1DA 1K2NA 4HX8A 3MAJA 3GFJA 3E6MA 2CFXA 3WTXC 3BWGA 3OUNA 5DIZA 4M74A 5DBKA 5CVRA 2FQ3A 2O0YA 4NHJA 1K3JA 5FFXA 2P8TA 3T1BA 2IA1A 5DV5A 1A17A 1ZU2A 2ZNYA 3S7JA 4K2EA 1PP7U 4AIFA 5ARFA 2EV0A 3P9KA 1KU9A 2K4BA 3VODA 4FX4A 3JAMK 4L18B 3Q49B 4ESFA 3CVQA 1RIOH 3SFZA 1LB2A 2Z3YA 4UI9J 2VC1A 3KETA 5HOOA 2FA5A 3DPTA 1IF1A 3E6CC 4G94A 3J81K 3ZMDA 3QOUA 4I9EA 2RV8A 4P55A 3BJ6A 3CJNA 1QU5A 3QP5A 3M8EA 2DO7A 4B8XA 2HEOA 1MKMA 3DEUA 4F3VA 1TQPA 1LEAA 5HDNA 2ISYA 2BV6A 1BOAA 5KK1A 3I58A 2AS5F 1B1BA 4WNDA 4I2WA 5ILSA 2HO1A 1FX7A 4QCJA 5KVRA 3RJVA 4KN4X 2CSWA 1W5SA 2HS5A 2VOPA 3KZZA 2B0LA 3VTYA 1QZYA 1VTNC 3GFIA 4MHGA 4LD5A 2DK8A 3IWFA 3CVLA 1IRGA 3TO9A 3E5QA 2JKDA 1JHFA 2UY1B 2Y0MA 3LSTA 3OXLA 1MZKA 2LC1A 1WKMA 4AD9A 4B94A 1R22A 2IRFG 2XAFA 1Z05A 1G3GA 2H27A 4HQMA 5FZRA 2JQIA 2IFUA 4ENNA 3HUEA 5ED4A 5L3GA 3KP2A 5BS6A 3BOQA 5FB2A 2R7FA 3ZFWA 3MV3B 3ASFA 4HLYA 2F5CA 1ZG3A 3HYMB 4I09A 1LEBA 4JBAA 3ZN3A 2YHCA 1G3TA 3KCCA 4JA7A 1HW2A 1J59A 3KS2A 4GCNA 3ZPJA 5HLGA 1HXIA 2PMUA 3RKVA 1FC3A 1PUEE 1E2XA 3ZMUA 3MEKA 4IHSA 1ON1A 2LDUA 2UY1A 5J8FA 2FNPA 3SZPA 1E96B 5TRDA 5JJ7A 2VSNA 3CK7A 4BHPA 2YSRA 2W24A 3WTSC 2VOOA 3LA3A 1ON2A 3M1EA 1GXCA 2L54A 4HOTA 4CO8A 1XMAA 3QU6A 3RDIA 2WWYA 2YQ8A 2DTRA 4IF4A 1J4LA 4CDRA 3K9TA 5K5OA 4O6JA 1UB9A 1EV7A 2KKOA 3EDPA 5D6FA 3KEQA 3HSEA 1WQ2A 2Z9OA 3I4PA 1IN6A 1F4KA 4P9UA 1P2FA 5DD4A 3MZYA 4MQ9F 5E18F 4J8EA 2FBIA 5HQ8A 1K6OA 4H7YA 5HDGA 3T8TA 3IEGA 4ZYDA 2CWEA 3U4TA 4OMYA 4EJWA 1S7AA 3LY8A 4UV8A 2HDCA 4LB6B 4AWXB 2JQJA 4R1HA 1KYZA 2FXAA 5DDGA 1F9NA 2KJCA 2FBHA 2IVMA 1S29A 2GW1A 2RGVA 3LQQA 2UXXA 3VB2A 2Y4UA 3O48A 4UI9C 4HQEA 2PI0A 2YU3A 2D1VA 3F8CA 1FYKA 4Y17A 3RI4A 2V1XA 2ZKZA 2XV4S 2DK5A 3COAC 2XCBA 4KNYA 2Y75A 1YTYA 3TGOA 4N9HA 2XGXA 3HSFA 1J7KA 3R60A 1J4QA 4EGXA 2NNYA 5BPDA 3L9FA 2TDXA 1PDNC 2PIEA 3V8KA 2XROA 3LPZA 5FZQA 3GLXA 4U7BA 4HORA 3Q9SA 1K3QA 3DF8A 1BC7C 1FWZA 4A0XA 1BJAA 1SMYF 2XAGA 4OMZA 2D2WA 2QQ9A 4MTDA 2AFFA 3ZN0A 1UJXA 2HKXA 2XGSA 4XI0A 3OXGA 3HRTA 2KIUA 1R58A 2COMA 2NYXA 1FLIA 3H3ZA 5A8IA 3QU3A 2VT2A 4HF1A 3LCAA 3GZ1A 3CLOA 2JPCA 4RG6A 2DI3A 4W9RA 4G6DA 4G8XA 3GO5A 3ZMVA 4XLNF 5LEJA 4I01A 3GZ5A 2V1UA 3CVPA 3C1DA 2STTA 1MGTA 3CKCA 4G6QA 1U5TA 3DV8A 4L0ZB 1NZNA 2HR2A 3EYYA 3WGHA 1KQ0A 1IXSB 4I1AA 4A12A 3FFLA 1FT9A 1A04A 2XKPA 1IN4A 1EH6A 1XGMA 2XGMA 3T8RA 1T0FA 2KRFA 3FMSA 1S6LA 3F72A 1D8JA 5FTPA 3RIRA 3RYRA 3NRVA 2J5OA 3BROA 1QQEA 1IW7F 1I5ZA 1ZGJA 3CK8A 4RAZA 4GCOA 3GUDA 1ZRFA 2WV0A 1OUVA 1QNTA 1MDMB 2FE3A 3QAHA 4UQYA 1WV3A 4CDGA 4CZZA 2VBZA 2P58C 1OPCA 4RGUA 1IXRC 2X0LA 3C7JA 3LY7A 1YQAA 5EEGA 2GQQA 2UWJG 2BGCA 3RKWA 5K1YA 2DFIA 2WQHA 3C18A 5F1RA 2M8EA 1R36A 2JSCA 1U2WA 4UVAA 4I2ZA 1KU3A 3CUOA 1R1VA 3WG9A 4HF2A 2ZCWA 3GQSA 4GA2A 1XDSA 2OZUA 2A68F 1RUNA 4FX0A 1WAO1 1U5TC 2CO5A 2G9WA 5E8GA 1WSUA 1REPC 4WNFA 3R4KA 4LLLA 3S7BA 2A61A 1MDMA 1ZRCA 2RQPA 5IT9K 1K78B 2GA2A 4EV0A 4OOIA 3LFKA 3H92A 2QQAA 2OZ6A 2Z99A 3P7NA 3I53A 4PGGA 2BRFA 5HI7A 3GZ2A 1TW3A 1B9MA 3SQNA 2HZTA 1Z6TA 5HS7A 2VT3A 2XGOA 1USSA 3TDUC 4H0EA 4OU0A 2QVOA 3WTVC 1T98A 1Z91A 1J75A 4AIKA 4M73A 3I0NA 1B89A 3GYHX 1ZG5A 1ZARA 2O6GE 1L0OC 5DCMA 3TQNA 3JSPA 2G7UA 2ESHA 3IRRA 1HXDA 1YG2A 2OU2A 3B73A 4IJAA 2KIFA 4NB5A 3LAPA 2EV5A 1BN5A 5LBQA 2NC9A 1K78A 3ULQA 2FU4A 2IW5A 3FM3A 2JQLA 3LQRA 1D5VA 4YNDA 3RO3A 2VQ2A 1MD0A 5FT9A 4A6EA 1O7FA 4PDKA 5CJ9A 5CHEE 2VBYA 4HOSA 2P6TA 4JA9A 3J80K 5KJKA 5DEQA 3V4GA 4KUMA 1USTA 4IRHA 1G3SA 3E4BA 1ZBPA 2FMLA 1K2MA 4IVNA 1DP7P 2FBNA 4WXDA 1RUOA 3EDTB 4KT5C 3QWPA 2XAJA 2QBYB 2FF4A 2MLKA 5LGTA 2O8XA 4YG2F 1R1TA 2LF7A 2EV6A 3ERED 3SZTA 2F2EA 2EWNA 2NS0A 3E6DA 2PN6A 3QP6A 4MEXF 3WXXA 1TTYA 2DQLA 4ENMA 4LFUA 4APOA 4LB5A 4UVBA 4HDVA 3QWWA 4ME2A 5AIQA 4RB2C 2EA2A 5A2QZ 1JHHA 4U04A 2I6HA 4PCQA 4WF2A 4KXKB 1HKTA 1SD7A 1L3LA 3FHZA 1W4MA 3Q47B 2LSOA 1TW2A 4UQXA 4HOUA 5CLSA 3FZVA 4ESJA 5JVTA 4M9XA 3F23A 2FRHA 4M71A 2QBYA 2L3DA 1ELRA 3V7RA 1KLXA 1IYGA 4U07A 5J6XA 4KIBA 3WTTC 1T6SA 1FNNA 2K27A 2EH0A 1OR7A 4A1SA 3BEEA 2MH9A 4G25A 5ILVA 5D0QD 2L4MA 1R5GA 1XSXA 1TQMA 4PGHA 3TKYA 4MGRA 1NA3A 5LCWC 4HYEA 2XAQA 4N5CA 4ZZLA 4AM9A 2HTJA 2CGPA 4OINF 2KKLA 1FSEA 4XIFA 5E1WA 4P5OA 2K4JA 3I54A 3K1NA 3K9IA 2EFWA 5ILUA 4EJTA 3CEQA 1Z1DA 2YX7A 5HVQC 4LK0F 3JSOA 1RI7A 4N3CA 4GZ5A 5BPIA 3SXYA 4I2OA 4OIOF 4A6DA 2P5VA 2M87A 1CGPA 2HWVA 3U1DA 2XPIA 4RB3C 1IUYA 5E50A 2J5PA 1XDUA 4U88A 2OBPA 3RO2A 1KU7A 2NNNA 1ZLKA 2QUFA 3HHHA 2E1NA 2VGXB 3TO6A 2WPVA 4N2QA 4P9FA 2IJLA 3I6WA 4CICA 1C0WA 2A69F 1H9GA 1R7JA 2OQRA 3RJPA 4BAYA 4BTBA 5DD8A 5LHHA 4MQVA 4XRFA 1UHWA 2V6CA 3O2PE 5EX3A 1IAWA 2PJPA 1NA0A 3MDBA 2F5DA 4QWQA 4L0YB 5D8LB 4TV7A 1R5HA 2CW0F 2RC4A 2ISZA 2GXBA 2EA4A 2VN2A 5D6EA 3CUQC 3K69A 1YJ5C 3WODF 1G6NA 1STZA 2AVPA 1OKRA 3R0JA 4BYYA 4M9ZA 3KD7A 4Q4ZF 3JTGA 1R1UA 4H87A 4J8DA 1TNSA 1QQIA 2CSOA 1IN8A 1LVAA 2G1LA 3ZQ7A 2W84A 2VGXA 3UOTA 3B02A 3ABUA 4Y6WA 2Z5UA 1W7PD 3KZYA 5KJNA 1XB4A 2ZXJA 3IHUA 2E2EA 5LRRA 5FO5A 3UMZA 1I6XA 2DU9A 2XCCA 2JT1A 5CCMA 5ICEA 4HA8A 3ROUA 3I64A 3O6BB 3GVAA 2HYGD 2QM3A 4UHTA 1FP1D 1QZ2A 3ELVA 4Y13A 5JFRA 3E97A 4U0VA 4G2VA 3JTHA 5D4SA 3WTWC 1DUXC 1K3NA 2VBWA 4HV6A 5FLXK 2IPQX 2XIGA 2MBFA 2JPEA 4BQAA 4YFKF 3FWEA 4U0WA 1XD7A 1O3SA 2MC3A 1GXQA 2CYYA 1ZYRF 4IRIA 1XGOA 5DUKA 2KIMA 3IKVA 4EM2A 4HV5A 2HYZA 1OYIA 2W25A 2DAOA 5KJMA 1AOYA 3CV0A 1YFHA 4XSXF 4U0YA 1SFEA 2PZIA 3DKWA 2A3SA 2KB4A 1W7PB 3TG5A 2VSYA 4Z2YA 2V79A 5CVVA 3BPVA 4BH9A 3H3UA 1ZAOA 3QKYA 3NEUA 3W6JB 5BQTA 4CXFA 3RU0A 5D8KB 1BI3A 4O6FA 3SF4A 1ZHFA 3MCZA 2HR3A 4EQQA 3PE3A 4AVPA 4KFCA 4WNEA 3MQ0A 5HDKA 2LSUA 1U3EM 1CF7B 3RYPA 3V7CA 1AWCA 5DCFA 2PFBA 2FO7A 4ON0A 1BIAA 4U0UA 5JR3A 1U5TB 2BEOA 5H6QA 1FOKA 3ESKA 2GXGA 4A0YA 1BI2A 3JAMZ 2KJBA 2VXZA 3L00A 3ASGA 3FM8A 4U0SA 3N97A 4GZ3A 1ELWA 3UQ3A 1W7PA 4OIPF 1YW7A 4PZJA 4BHBA 3Q5FA 4ETSA 5L3BA 1MJBA 3J81Z 5BMZA 4RGRA 5K5QA 2F5FA 4OIQF 4CYDA 1LDJA 5AONA 4XLPF 2HQRA 4RG9A 1KQ8A 3KP6A 2FMYA 2P7VB 4D0PA 1T39A 4A5NA 1ZLJA 5LEKA 4G1TA 1D3YA 3WE2A 1R00A 1QZZA 3EQLF 1DMZA 1FYLA 4A5MA 4BNCA 5G04C 1CF7A 2VGYA 2FI7A 4WX9A 4HF0A 1P4WA 3FMRA 4CHUA 3I5UA 2Q7FA 5D0OD 1WI9A 1XN7A 3HRUA 2KCKA 5AIPA 3S2WA 2DQRA 4GO1A 4HW0A 4NRHB 3EUHA 3RPUA 3BY6A 3N71A 3IC7A 4N2SA 3KP4A 2EJRA 3GX4X 4HBLA 3UV0A 2PG4A 5CVUA 2JLBA 3FWVA 1NHAA 4GPKA 3GEZA 1YW8A 4DQ2A 4XI9A 2RNJA 3QRFF 4KMUX 5JI6A 3F22A 2VE9A 2W85A 4GYGA 4N3AA 4S04A 1FBSA 4ASNA 4G9YA 4JL0A 4LGWA 2V9VA 4KIGA 2HGCA 3IKTA 2XVCA 2CQKA 2PLYA 2STWA 3DP7A 2FSWA 1P6RA 4MTEA 3HSRA 5A6CA 3PDNA 3M7GA 1BI0A 5LCWJ 3K2ZA 3WGGA 4ZZDA 1S7OA 1SD5A 2RN7A 3QOPA 3HRSA 1XNFA 3ELSA 3UN0A 2LNIA 3O3KA 2KB3A 4N3BA 1WWXA 3URZA 4LMYA 4JK1X 2XRNA 5DCMB 1TNTA 1Z9CA 3ZMZA 4HZFA 4GYIA 1J4KA 1LJ9A 1S3JA 4CGWA 3WGIA 4HDUA 3M8FA 1HQCA 3I59A 3IL2A 1J4PA 3Q9VA 1KYWA 3TAXA 3ULQB 4IHTA 1XGNA 3S7FA 1J4OA 5LHIA 1KT0A 1IN7A 2PBIA 5TJJA 1W5TA 1BI1A 4ABNA 4ZYGA 2RKHA 3VTXA 1I1SA 5ERIA 4N9IA 4A0ZA 5D5WB 4FT8A 2JZYA 4BT9A 4NQWA 3RIBA 1P4XA 2R7DA 3ISPA 1QPMA 3DFGA 5FD6A 3GZ6A 2UXNA 2IT0A 4JQFA 3UNMA 2A0TA 4HOQA 1E17A 5LGNA 4IXAA 2M45A 5K5RA 1Z7UA 4ZH4F 2W57A 4ENKA 2PMHA 5LHGA 4YIFA 3QWVA 3U3WA 2C2LA 2ETHA 1RNLA 3C3WA 4RS8A 1TJCA 2X4HA 1LDDA 4ESBA 2IA0A 5BOXA 4J8FA 1F1ZA 3KP5A 1G4DA 1FSHA 1IRFA 4UUVA 4GA0A 2K86A 1W3BA 3VOEA 1D8KA 1HZ4A 3VEPA 3BDDA 2BUGA 2GAUA 2GZWA 4YVOA 2Q2EA 1J0RA 5ICFA 2OQGA 4S05A 2P5KA 3F8NA 1FCHA 3MKRA 3L7WA 2Y4TA 5BW8C 2G7HA 2FBKA 2IP2A 3ASDA 1ZRDA 1H9TA 2F5EA 4GCVA 5EKQD 3Q15A 4G26A 1J5YA 2DW4A 3MA5A 4G2SA 4UI9K 2D45A 3WU0A 2YR2A 5ARGA 3M9AA 3CK9A 2H6CA 2E1CA 4FHTA 5FZSA 5E1ZB 2M1BA 4BWRA 5HLIA 1JE8A 4EMSA 3CUQB 1FY7A 5HS9A 5E20A 4WUYA 5AYWD 2XKOA 2EFPA 3HUGA 4U7DA 2K7LA 2ZMEB 1V4RA 4O5VA 3CVNA 2UWMA 1ONVA 4KIFA 3F21A 4HLXA 5D5VB 4Y6CA 5M72A 3KP7A 4DNCA 4I98B 1HW5A 1X3UA 4G7OF 3QPTA 1Y0UA 4B09A 3L09A 3F8BA 3JYSA 3TOBA 4KYOB 2GIVA 3QPHA 2K02A 5FGMA 1K7AA 3PFIA 2EFNA 3ZMSA 5E17F 4N39A 5D4RA 4N0BA 4RB0A 2EFOA 3U2RA 4KN7X 3K1PA 4YFXF 4EM1A 3OXFA 1U8RA 4WXHA 3KLNA 3ECOA 3CUQA 1TQIA 2HQNA 2BE5F 3ELKA 1XCVA 2NAZA 1QGPA 5JHUA 4AY5A 5FJYA 2ZMEA 3DQVC 1HKSA 1FHRA 2V5FA 3IRQA 1UCRA 4OIRF 3AAFA 2MD5A 3BPXA 3G3ZA 3FXQA 4L9TA 1KT1A 3CO6C 3AS4A 3PE4A 2ADUA 3FP3A 1XSVA 1YA0A 1O3QA 1G3YA 3OV8A 4CGVA 6PAXA 1KQ9A
chains in the Genus database with same CATH superfamily
3ABTA 3F8MA 1VQ6I 5G05C 4O60A 2V1DA 2IXSA 4MIMA 2OOEA 3J7AO 3R9AB 1HKQA 1BBYA 1YYVA 4Q48A 5H20A 3LY9A 5JJTA 1U0RA 3AS8A 3PO8A 2LXLA 1UFMA 3D5LA 4YIIA 4J00A 4IQJA 4CCNA 4UVCA 2DT6A 2FOWA 2LNBA 4EJVA 4ZYHA 1XX5A 2RDPA 4RAYA 1V5GA 2X6HA 3LKUA 3OY9A 3PVLA 3QAQA 5CEAA 4JONA 3RZOJ 3HOVJ 3Q79A 1BA5A 2Y48A 3OYKA 2RAEA 2XEVA 3FHNA 3K70D 4IO9F 1U78A 1LGQA 1I1GA 2LKPA 2KFUA 3F6VA 3M8JA 4WNGA 2I5UA 3KP3A 3EU9A 4XEIG 4EPZA 4IHYA 3PQKA 2Q8KA 3V7UA 3CSTA 4RMNA 5J8CA 4AIJA 4M72A 4M6XA 1FHQA 1YJ9I 1I3AA 3AL0C 4M3FA 4B47A 3DPYA 5G04J 3F3XA 1SMTA 1IHGA 3CF2A 4Y15A 4J8YA 4LG3A 4OYSA 2VE8A 2HQ5A 4DJAA 2EB7A 1LFUP 1TN8A 3QDNA 2V1NA 5IT9Z 4HS2A 3V8JA 3EUAA 3E3VA 2F8XK 1F5TA 5H2FC 1T2KA 5M3MJ 1N4RA 2EK5A 4U95D 2KATA 2QZ8A 3HOYJ 5HLHA 2X51A 4LJZF 3HOUJ 3M1CA 2RVCA 2KCVA 3REOA 3UIPC 3BG3A 1EH8A 5L3EA 2L6JA 3ECHA 5KNHD 3PSFA 5L3CA 2JTVA 2XPUA 2OTJI 2QYOA 1B4AA 2AQFA 2ESNA 3DBHB 2PEXA 3ASHA 1N9AA 3F6QA 4IEJA 1YRNA 3L2VA 1OCTC 4FE7A 2HFHA 4XMYA 1Z5SC 1INZA 3HOTA 5FQ4A 4E7ZA 2HXOA 5CVJA 3JRCA 1K1AA 4DX5D 3ZQIA 1OWOA 4ZYEA 3QYBA 4MRUA 2L0KA 3HBLA 2ELHA 3WTUC 1PP8F 2JQ7A 3ZEFA 2I2AA 1YIOA 3R0AA 3SHFA 3BQYA 4LEUA 2AXLA 1SVMA 4AU7A 1B6AA 2LOOA 2J09A 2RQQA 2IS6A 1EH7A 3K4JA 4LLGF 4KDPA 3BQOA 4CUGA 1D9SA 2WAQA 3P9IA 4CGZA 5IT3A 4AIHA 2QEXI 1KGSA 3C2GA 3QWLA 1IV6A 1IDZA 4DLQA 3ML8A 1NG6A 4UWKA 2OD5A 1WJFA 5F64A 4GRIA 2BOLA 2CG4A 1JGSA 3MEXA 1QBJA 2IS2A 2ZFWA 2XEHA 3GW4A 4NURA 3PQJA 3NQPA 3V7WA 1JGGA 3WTZA 2IA2A 1YJWI 3I56I 3S40A 4H7XA 3G2WA 4IPAA 2A6EF 1TWHJ 2E7WA 3OR2C 1QNFA 2XAHA 2F4OB 3H5AA 2A5YB 4PSWA 3MZHA 4BERA 2OJED 2XUBA 3PNTA 2J49A 3FXRA 2DBAA 4PFOA 4EJOA 2QENA 3JREA 5ENOD 5BT1A 1B59A 4ZFHA 3CCRI 3X2QE 2ZBKA 2HTSA 1U7FB 2E60A 5H6RA 2QGUA 4HAMA 2QY7A 1ULYA 4YFNF 2WADA 3RTRA 1H0MA 3ZCOA 1V5FA 4XKVA 2I2DA 4DY6A 3CF5F 4Z68A 1XMKA 1WLNA 4BTAA 3K0LA 2OAZA 4XK4A 5DHSA 3J80Z 2K9QA 3UKGA 2M30A 4DRXE 4XSZF 2LY9A 3K4MA 4IZZA 1SFUA 2ZB9A 3SO8A 1XGSA 3C3OA 1LVKA 1BR1A 5EDNA 2VONA 3KZIC 4ZYAA 1TNUA 1BW6A 5ICGA 2JABA 3WU1B 2P6SA 4J01A 4I17A 4IRUA 4APFA 4S0HB 2B0OE 2DCEA 2P4WA 2IF4A 4IQ4A 4EBAG 3ZN1A 3HUFA 4I7HA 2VUMJ 1RKWA 4KMOA 3TWRA 4DX7D 2KHMA 4LOCA 2R5SA 1LDKB 3ZPLA 3C72A 5E3OA 3EU5A 4HI8A 3ZGKA 2X6WA 2XZTG 3OYCA 3HXBA 1HC8A 2C0LA 3UUXA 4GFBA 2DLLA 2VPRA 5EJCA 2KP6A 4A3TA 3OYJA 3I3LA 1KHXA 2KL4A 5L3DA 1WM5A 4RSYA 4O1PA 5HS8A 2VYIA 5J90A 3GBGA 4U8YD 4OAVB 3AG4E 1MNEA 3TDZC 4CCAA 3BG0B 3L16A 1QWTA 2ZJPF 1OY3D 2LSVA 4X6AJ 4XKCA 3OOUA 3HXFA 2JRTA 5EN5D 4I43A 2X48A 2NXPA 2P9UG 2EZKA 4DUIA 3T0YA 3DU5A 5T8IA 3W9FA 1DPUA 2QFCA 3I6UA 1BPOA 3SEQA 2DPDA 4G24A 5KWDA 1FZPB 5CCLA 4D7NA 5TISC 3WE3A 2CS3A 2ZJ2A 1LQ1A 1SD4A 3K4LA 1K83J 4XLEA 1D1BA 2BVLA 3ONQA 3L2RA 2E2JJ 3D9MA 3TP3A 3TBIA 1J09A 4JX5A 1WJEA 2W1OA 5DS9A 2QC9A 4EGYA 1J2XA 3BCAA 4I6JA 4EJUA 1ODDA 3BJOA 3GYZA 2M34A 2XF5A 4LK1F 1UHMA 4R79A 4G7ZF 3VWBA 3ESLA 1FBUA 1VNDA 3GZSA 3LS8A 1TBXA 2BYVE 2C6YA 2EBIA 2ZO4A 4DW6A 4NQ0A 2XT9B 2DT7B 2XF7A 3GFMA 1IXCA 4UWFA 2P7CB 2VQHA 4C0MA 1MH4A 1UJ8A 1MBHA 4IRGA 4KZ0A 3LSRA 4LLNA 2A07F 1Y8RB 2MGQA 3ESWB 1WFXA 5IY5H 4D9VA 2VQLA 2IEKA 5GTIC 3VPYA 3DXJF 4Y7NJ 3ABLE 3S2HJ 4J19A 4KYWA 2PL2A 2I1KA 4GAAA 3T5PA 1JWGA 3P9CA 5GAEJ 1YLFA 3OOPA 4HNAD 2HVQA 2OEWA 5C44J 1K79A 1IRXA 1XG1A 1QO0D 3JCUC 4L9NA 1O7LA 5D5UB 3OYIA 1ZH5A 2Z1DA 5JVGF 3RPQA 4ENJA 3D9PA 2PQNA 3CJQB 5KJLA 2MSYA 3Q4AB 3FBIB 4A0EA 4EJQA 3NF1A 5LX8A 4AY6A 1UHTA 1S8NA 3E6BA 4EGZA 3Q0UA 1T38A 3VA1A 2Z33A 5LRSA 4QTRA 1O3TA 2FOKA 2MH2A 1G3WA 3C2BA 1HBXG 1XCBA 1HH8A 5GP9A 1O3RA 4FLBA 5L3FA 5CEDB 3MV2B 4AM3A 2CQNA 4BEHA 2DIWA 4NIKA 3CSFA 3FX3A 5EEHA 3H36A 2R7SA 3RRUA 2XSJC 4X1EA 2YINA 1LNWA 3BZ6A 1MJ9A 3BCBA 1A31A 2HPMA 1APLC 5DYMA 4RQIA 3NQOA 5G55A 4E7KA 1W0UA 4C2MJ 2GWRA 3ML9A 3FF5A 3H9GA 1IN5A 1JTXA 5IPAA 2ZXWE 1SA4A 3OL3A 4HNVA 3ASOE 2VQGA 5J47A 2FQ4A 1O5MA 3CVYA 3KIOA 1A35A 3DITA 4B3AA 1RZ4A 2M5WA 2I2CA 3VZCA 3ZHEB 5IYCJ 1Q1HA 2A6HF 4PFPA 1GHCA 3U66A 1HSTA 4HB5A 2K5CA 4KICA 3K70C 4BY7J 2EFQA 2HOEA 3FK6A 4IKFA 3AG4H 3GWZA 1N78A 2WXOA 3G1LA 4Y3OA 4GZ6A 3OMYA 5A2QK 3ZGQA 3FUIA 1ZK8A 3Q3SA 4WWPA 2RD0A 4IN3B 4UQZA 3MFKA 2H09A 2ZXIA 2JPBA 5CVIA 2CFZA 1D0ZA 2P5LC 1UHSA 4FA6A 4M3DA 1HSJA 2FEZA 1WRJA 2W82A 3LFUA 4WCGA 2L9VA 2PX9A 1OWNA 3POAA 3GTPJ 2F6CA 1PVEA 3LSHA 1AKHB 4XLFA 2DPUA 2ETBA 1TLHB 4XN3A 3SYTA 4XQFA 3V7YA 3GW2A 1OMIA 4QIWN 2HOSA 3HIZA 1YO5C 4PS7A 2X3MA 1WH5A 3BJAA 3S7DA 3F6OA 3VA4A 1RKTA 4WXCA 1SC7A 3KAEA 3MYVA 3UPVA 4GGGA 1X1DA 2XSDC 1VF9A 5K7FA 1OCPA 2O61A 1Z67A 4II2A 4HLLA 1B9NA 5AN8A 3KT9A 1JXSA 4AYBA 2FO1E 4F7AA 2WTEA 2VC0A 2XDVA 3H1CA 1VQLI 1XPXA 2VJ8A 3UTMA 1G6GA 2XASA 3ASNH 2W3OA 3JW4A 1BC8C 4M9SA 1OYYA 1E7UA 1KPSB 1SAUA 5EDSA 3K1MA 4ZJZA 2GRLA 3SZ7A 4NC7A 3IWZA 4BL0B 3MJWA 1YX3A 2IGKA 3BZKA 1SW6A 1QU3A 3FKJA 1FBQA 3B7RL 4RB1A 1TWFJ 3V31A 2LP0A 2OTLI 4BXUA 4PJMA 3LA7A 3CC4I 1V55H 4KZCA 1YS7A 1BL0A 2P2CP 1DPRA 1U7VA 2OPTA 1VQPI 3APDA 2BEDA 3FTZA 3D5SC 5A23A 3VZDA 2O03A 2LY1A 3N4MA 3I59B 3OYLA 2DFEA 3HOSA 3IKOB 3BG7A 1A6IA 2HYFA 4YVQC 3ZHEA 3W6KB 3FXUA 3ULEG 5E8IA 3FM5A 4CA0A 2ONDA 4BQQA 5DUIA 2HYJA 3LAJA 2NRAC 2YS9A 1KZHA 1SZAA 4ZDOA 1PJRA 4PJJA 2J08A 1LD7A 3HRMA 3SBTB 2RFAA 2L02A 3FBNB 2DBBA 4EEFG 2XRYA 2L01A 2HKOA 2EZHA 4GZCA 4L5IA 1MMAA 3G73A 3RZDJ 4EZKA 1WDYA 2AN1A 2BZTA 3TOAA 2I8DA 2K3PA 4R8HA 1RETA 3BR6A 2ACJA 4L5JA 3E37A 3HX1A 3ENEA 2MHKA 1GV5A 2ZNZA 3RQ4A 3OIQA 4U0ZA 5FIOA 1O1RA 1IJWC 3HJEA 2V9KA 4F1SA 1X2MA 3NB2A 1U6GA 2KC7A 3F8FA 2BHYA 4HX4A 2YPRA 2J4BA 2DTZA 4GYYA 4A3JJ 3VPRA 3T5VA 1X1CA 1GVJA 3HKZA 2PMZN 2L5QA 1X4PA 1LPQA 4XZ4A 2L4AA 4P29A 2OVFA 4PDXA 1MMDA 1H19A 2Q1ZB 2H94A 2X9DA 2M2EA 3LSPA 2CHWA 4BHCA 2UV1A 4GA1A 4LG0B 1Z7LA 3BR2A 3E5XA 1Y8MA 3EETA 5J1RA 2GROB 2X38A 2LUHA 4GYWA 3ABME 4HNTA 3L08A 2JVGA 1JUMA 3Q0WA 1VQ7I 1J9IA 2LVSA 5CRVA 3E33A 2B9SA 3LWFA 4NACA 3E5UA 2H6BA 1DDNA 2VODA 4D9JA 2RG8A 3IBEA 4I6GA 1YJMA 1BM9A 4N4NB 5B1AH 4WK8F 3IUOA 2VKVA 4XBFA 3L2CA 2E7XA 2FNAA 2I2OA 3KE2A 5LGUA 5G05J 4RLQA 1E90A 2FUG2 2QWWA 1ETWA 2MLGA 1MZBA 3CO7C 2YX4A 3J5QB 5C2YA 3RRNB 5F6FA 3BP8A 2C0MA 2VBXA 4JEHA 1OWLA 1HDPA 2QKMB 3KPHA 4HX7A 2P1RA 3GXOA 4YDEA 4BJ5C 2Q0OA 4G23A 3G2SA 2LK2A 1H8AC 3HTSB 2DMTA 3AS5A 2DT5A 1T0FC 3DPLC 3VDXA 3WTYC 5DJOA 4KBQA 1GXPA 3VFZA 1DCEA 4UV9A 4D5FA 3KLOA 5E1XA 1ZGAA 3V8LA 5FLXZ 2JVHA 1SAXA 2KDOA 2HM8A 3HZJA 4QLCU 1IC8A 4EM0B 2DA5A 3BU8A 4RLFA 1ZG1A 4KISA 1LF8A 3S2DJ 4HOBA 1WGXA 2HE0A 4A1GA 1ZREA 1FYMA 4E6KG 4I9CA 2O3FA 4AEZC 4MNUA 1P4AA 2QQBA 1A5EA 4MEYF 1S63A 1MBEA 1LD8A 3TG4A 4FHKA 2WAFA 2DCPA 4KA4A 3D1NI 2I10A 2QA4I 3GTMJ 4ZDLA 2KCLA 3UT8A 1YW9A 2E1MB 2KZVA 4OAYA 1R71A 1BI8B 1BIBA 3DCFA 4E70A 4LG0A 3J5PA 3ZMTA 1T08B 2R7RA 3LA2A 3FTYA 1IQRA 1K8KG 4BT8A 5M3FJ 4BE2A 4XOPA 3V80A 5A7DB 1MJAA 3D0SA 2LKXA 4A55A 1HW1A 1TNOA 2WC2A 4MO7A 4OWRB 1ZN2A 4DIQA 1XSDA 3E32A 5JLXA 2LO6A 1FP2A 4Q47A 1OCCH 1R5ID 1V3FA 5TGTA 1YYHA 3ML6A 4Q5SF 2EZLA 2R2LA 5EX0A 4XICA 2R3SA 2ETAA 1P92A 2D1HA 2E1OA 1H6OA 5BXOA 4RGSA 5CYVA 2KBXA 1SFXA 4F3QA 3TXMA 1HG5A 1B72B 1TNBA 3B6AA 1E8YA 5LLQA 3I0MA 5B1BH 1UJXA 2MYSA 4WAFA 3LYAA 3Q5MA 3FMQA 4I02A 1RPWA 4RGXA 3CTAA 3TO7A 3VYTB 1JI8A 2WXRA 3C98A 1MBFA 2COBA 3NWSA 1IZ1A 4QPOA 5EZHA 1JCSA 3GF2A 4L9VA 1ZELA 3GFLA 5FD5A 3S1RJ 1U3CA 3MWMA 2PQRA 2O5RA 4P96A 5KNLA 2BW3A 4EVIA 1A36A 3CKBA 4A2UA 3PO3J 5EIDA 3KFWX 4BFRA 2BBYA 3K7AJ 3RKXA 1HF0A 4J7WA 4UNOA 3HUGB 5IYDJ 3B95A 1X3ZB 2I29A 1O57A 3LEWA 2K9SA 1TN7A 1MSFC 4FULA 2R7TA 4PK4A 4H4KC 2MA3A 1N94A 3ZQFA 1YMPA 2J9QA 3IV0A 1FPQA 3K2AA 5LOZA 3ZQQA 4F7ZA 1OYWA 4BX8A 1HX8A 2OA4A 3I71A 5D5XB 1JTYA 2V4JC 2F5VA 5JJ6A 2GA1A 3KYCB 3MCXA 5AQ9A 3ZU7B 5BNWA 1QZEA 2P9IG 3SFIA 5CRUA 4I0AA 1YS6A 1VQ4I 3BR1A 2XGDA 1F43A 3I0TA 2PQ8A 2UZKA 5FFZA 4I0BA 1KA8A 2P9NG 3ZQHA 5JHFA 3HM5A 4DPRA 3HTUA 4NNJA 3FUNA 5JLWA 3FEYA 4G7HF 4GYOA 2EIMH 2WQ7A 3ZP5A 1PC2A 2NSZA 4W97A 2XGEA 3EYIA 1P5QA 4KT6B 1R23A 2ECBA 4L9JA 1I27A 3T5XA 1SD6A 3R61A 3AL0B 5EYPF 4JHRA 1MW7A 3E1SA 5E75A 2RREA 1B72A 3HYIA 1KU2A 2EH3A 3I3NA 1FPPA 5EYLA 2JEKA 4M6YA 3HIFA 5ICCA 4ATGA 1LGPA 4UXNA 2ZGDA 3V7SA 2N8GA 1Z6RA 1SFOJ 3RKYA 2XHKA 4J0UA 4L23A 4EQFA 3CDHA 5E3LA 2LF8A 3CQCB 1WH7A 4B4CA 3AU4A 4M3BA 1ZR2A 3ZVVA 4JVSA 3R6SA 2A5UA 2QLZA 3B7BA 3JQ0A 3TMOA 2V0PA 4GXOA 4DLOA 3IV5A 1FOWA 1H2VC 3TGNA 2OF7A 3HHGA 4K0RA 3U9GA 4A69C 4WWCA 5M5YJ 4O3MA 1R21A 2KPMA 2OCCH 1TNZA 3K4NA 3UNNA 4L2YA 3V8RA 1OCRH 3WHBA 4E6HA 3KEOA 3NZUA 3C5RA 2WBMA 4BACA 2A6TA 5F0CA 1O1TA 1ETOA 3QQAA 4KMFA 2AHQA 5HNFA 5C1DA 4HX8A 1T56A 3K6GA 3UR3C 5FLMJ 1K2NA 3APCA 3MAJA 5CQEA 3GFJA 4FC8A 3E6MA 3TL4X 2CFXA 3WTXC 4U8HA 5JHAA 2KRCA 1MHQA 2NVYJ 3BWGA 2CG2A 3P1UA 2NOGA 1FMVA 1X1AA 5DIZA 4M7CA 3OUNA 4M74A 4KT6A 5F1JA 2K85A 3MZLB 2E19A 2WQ6A 1M1EB 4L2LA 5DBKA 1ITYA 3CCQI 1L5JA 3A0BC 5CVRA 4QFVA 3EPZA 2P9SG 2FQ3A 2O0YA 4XIDA 4NHJA 1K3JA 5FFXA 2P8TA 1MZCA 1MJ0A 3T1BA 2IA1A 5DV5A 1QPIA 1A17A 5AQAA 1ZU2A 1OJLA 2ZNYA 3S7JA 2A5EA 4K2EA 1PP7U 4AIFA 2P9LG 4JB8P 1D8DA 4V3IA 4Q96A 2BY3A 5ARFA 4Y4RA 2EV0A 3DWLE 1HFAA 3P9KA 1KU9A 5CKTA 5FKOA 4GMRA 2ID3A 2DDBA 3W3CA 1X3WB 2K4BA 3VODA 2BKGA 1ZGWA 4RLYA 1WJCA 4GTQA 3JRAA 3JAMK 4FX4A 2QZAA 3TWWA 4L18B 3Q49B 4ESFA 4W1UA 1KZOA 3CVQA 3IHYA 1RIOH 1H88C 3GTGJ 2I2FA 3SFZA 1LB2A 2Z3YA 3CLQA 2DZOA 4UI9J 2VC1A 2Y0BG 4DK5A 3KETA 5HOOA 2FA5A 3JRHA 1X4OA 2XPVA 3HDXA 3DPTA 1IF1A 3SQVA 4HVBA 3E6CC 2R5YB 1JUQA 3UINC 2HZDA 3TL5A 1DGWY 3FU0A 3KYDB 1JCQA 3DSVA 2QKLB 4G94A 4JP0A 3J81K 3ZMDA 3RCOA 3QOUA 4I9EA 3DTIA 1IO2A 4A3VA 2RV8A 2IU1A 2DMPA 4P55A 3BJ6A 3CJNA 5EZGA 1QU5A 4ITVA 3QP5A 3M8EA 2DO7A 2PM7A 3TJPA 4GPKA 4B8XA 1YRNB 2HEOA 1MKMA 2CU7A 3MMYB 4CCKA 1GW6A 3DEUA 5FLVA 1ZKGA 4F3VA 2HNHA 1TQPA 1MIJA 3FTSA 3QC1A 4HRIA 1K61A 3CJRB 4BKXA 2W48A 3NAWA 1WHUA 1LEAA 4DZPA 2JMWA 5HDNA 2ISYA 4D1QA 2BV6A 2JJ7A 1BOAA 5KK1A 3I58A 2AS5F 2R7XA 1K3ZD 1B1BA 3FUDA 3D9OA 3I9V2 2HVRA 4WNDA 3FH5A 3QJZA 4I2WA 5AQBA 4CYCB 5ILSA 2DA6A 3C3QA 3L2UA 2HO1A 2WVIA 1FX7A 5EG0B 3R9MA 4QCJA 5KVRA 3RJVA 3BTCA 3BQZA 4KN4X 2X6YA 3CZ6A 2CSWA 2QV7A 1IV8A 1W5SA 2HS5A 2VOPA 1Y3HA 3KZZA 2B0LA 3VTYA 3CP2A 1QZYA 4ILIA 3VSLA 1VTNC 3ASNE 2X6OA 2DOEA 4QSHA 3GFIA 4MHGA 1YE9A 3FU5A 4PJ0C 3HB9A 1OCOH 1QVTA 3N05A 3LL7A 4LD5A 3KSQA 2HOAA 4GTVA 1ZOQA 1GVDA 2DK8A 3IWFA 3ABKE 3PNTB 4C30A 4LITA 1JT6A 3CVLA 4EECA 1IRGA 3SZGA 3TO9A 2R5YA 3LVQE 3E5QA 4BGDA 2JKDA 1JHFA 1E3HA 2LC2A 3FTXA 2UY1B 2Y0MA 3DSSA 2L2OA 3LSTA 1X5BA 4EBAA 5JEOA 3OXLA 1MZKA 2LC1A 1WKMA 2YHEA 4AD9A 4B94A 2DFFA 5K7HA 1R22A 2BHZA 3J7YJ 2IRFG 2XAFA 2AXVA 3PZ4A 1Z05A 2KZTB 4BETA 1GT0C 2M4KA 2H27A 1G3GA 4HQMA 1JJ6C 1T33A 4E7HA 3A0HC 3K10A 2WXFA 3OS1A 3HGYA 4MS6A 5FZRA 5IP7J 2JQIA 2IFUA 3CC2I 3G4SI 3A02A 4LNGA 2OV7A 4ENNA 1XS9A 3HUEA 1OISA 2XZDG 5ED4A 5L3GA 2NVXJ 3HHMA 4JYKA 4GMLA 2AO9A 2W7NA 1SZ9A 2WAEA 3I4RB 4NUBA 3KP2A 5BS6A 4CYCA 3BOQA 5FB2A 2R7FA 3CHRA 4GTMA 3ZFWA 3MV3B 3ASFA 4V2FA 2F5CA 4HLYA 2IO2C 4HLEA 1ZG3A 5EG0A 1YIJI 1QYMA 4TUUA 1U2VG 2AXZA 3LMMA 4I09A 3HYMB 3PJRA 3QB2A 2ZC2A 4JBAA 1LEBA 1BW5A 4TUMA 3KSLA 4ACLA 3ZN3A 3NOCD 2YHCA 1G3TA 3KCCA 4JA7A 1HW2A 1J59A 2ME0A 2IS1A 2PNNA 5AJLA 1SQMA 5FKMA 3NARA 5CMWA 5J4VA 3KS2A 3OYMA 3FH7A 4CSWA 5J08A 3FXOA 5FKNA 4GCNA 3ZPJA 5HLGA 1HXIA 2PMUA 4I76A 3RKVA 5E3MA 2ELJA 4HNUA 4ACKA 3ZQCA 1BOBA 1FC3A 4ZTFA 2M9HA 1LE8B 2GRRB 1PUEE 1DC2A 1E2XA 2HI3A 3BT9A 3ZMUA 3MKZA 2JA6J 3MEKA 3HEFA 4IHSA 2CJJA 1ON1A 4J8SA 4BJ6C 1JUSA 2LDUA 2UY1A 5J8FA 2FNPA 1SEUA 3SZPA 4UY8I 1Q1VA 5TRDA 2R92J 1E96B 3FXLA 3FUKA 4LNBA 4ANUA 3G2TA 3FK7A 5JJ7A 2VSNA 1RR7A 4KJZA 5B1AE 2LYCA 4YDOA 2IBDA 3CK7A 1FTTA 2KZTA 4BHPA 3CIAA 2EIJH 2YSRA 3S1NJ 3HOWJ 3AG3H 1MBGA 2W24A 2WA0A 1K4SA 3WTSC 2VOOA 3O4ZA 3LA3A 1MQSA 3H5RA 1ON2A 1U9NA 4B8AA 1WCMJ 1HS6A 3M1EA 3DWLG 4PUCA 1GXCA 2L54A 5B3SH 4CO8A 2Y2ZA 4HOTA 1E8XA 1XMAA 3QU6A 3RDIA 2WWYA 4HAOA 2YQ8A 1H89C 4AOFA 2DTRA 4IF4A 4A3BJ 3D3MA 3BTLA 1J4LA 3FUEA 4CDRA 3K9TA 5K5OA 3IAS2 4O6JA 2XPYA 4WWOA 4F6RD 1UB9A 1MH3A 3MKWB 1EV7A 3VYSB 4UWHA 4WWNA 2KKOA 3EDPA 5KAIC 5FJ8J 2M0CA 1TR4A 4KVMA 3NBNB 4M6VA 5D6FA 3OS0A 3DLAA 3WG7H 3KEQA 3HSEA 3MN2A 1MSEC 1FVHA 2B6CA 2L6BA 1WQ2A 1G3NB 2IGMA 2Z9OA 3L54A 1MBJA 3BR3A 3I4PA 2WXNA 4JXTA 1IN6A 1UELB 3KEYA 5HS0A 4C9YA 1F4KA 4P9UA 1P2FA 2LRDA 5DD4A 3MZYA 4MQ9F 5E18F 5FINA 1UAAA 1Z0SA 1SVXA 3CCYA 4J8EA 2FBIA 2G0EA 5HQ8A 1K6OA 1LE8A 4H7YA 5HDGA 4BEHB 9ANTA 4PS8A 2VKHA 2EIKH 3Q73A 2D5VA 5F27A 3OWTA 2LD5A 1PYVA 2NOJB 1POGA 1TZLA 2CHXA 4DI4A 5DHPA 3T8TA 1IQUA 3IEGA 4ZYDA 2CWEA 1OCCE 5ENNA 5DHQA 2ZISA 2KQRA 3VYRB 5BUZA 2R7ZJ 2XRZA 3U4TA 2WB2A 1BU9A 3TXNA 2BVMA 1D5YA 4OMYA 3HOZJ 1Y1WJ 4EJWA 1S7AA 2OEVA 3S3MA 3LY8A 1H6KA 4UV8A 2BY2A 2KIQA 2HDCA 1EKEA 4LB6B 4AWXB 4YIRX 4DX2A 2JQJA 1OCZH 4M3EA 3UT4A 4R1HA 4II3A 1HF8A 2L9BA 1KYZA 2FXAA 4FHJA 3UM0A 5DDGA 1F9NA 2KJCA 4DYRA 1VFCA 4ATZD 3FU3A 3LJNA 2FBHA 3PZ3A 3PO2J 2IVMA 2CV0A 1YI2I 3HRAA 4G8LA 2DDAA 1S29A 3UIOC 2GW1A 2RGVA 3LQQA 2UXXA 3H0GJ 3VB2A 1FOXA 2Y4UA 3D9JA 3OIOA 5DTDA 2F48A 1VQOI 5EJHA 5G2NA 3KX2A 4HQEA 3SY2A 4CRWA 3OYGA 2PI0A 3APFA 2YU3A 2D1VA 3F8CA 2NVUB 2H8RA 1FYKA 4Y17A 3RI4A 1IRZA 2V1XA 2ZKZA 4BY6A 3L2WA 3L13A 2XV4S 2DK5A 1B8IB 1SANA 3COAC 3ZQLA 3I4GA 4XE0A 3PL8A 4YRVA 2VLAA 1JKRC 4KNYA 2XCBA 2Y75A 2DYRH 4ABZA 1YTYA 2EINE 3ZOBA 2XQ0A 3AFHA 3TGOA 2H6FA 3OSFA 4N9HA 2XGXA 3HSFA 1TL8A 1WZ2A 1J7KA 3R60A 1H2UA 3TW6A 4LERA 2NNYA 4G8KA 2CMPA 3L9FA 5BPDA 1VQMI 2JK3A 2TDXA 1DU0A 2NVTJ 2GGFA 3V8NA 1PDNC 2EIME 2VSOE 2PIEA 3V8KA 1YX5A 2XROA 3GTJJ 2VL8A 3LPZA 3DSWA 2B7EA 5FZQA 1Y8QB 3GLXA 4M3GA 4U7BA 2IS4A 4OAZA 4HORA 1W1WE 1MMSA 1U7VB 2F0YA 3CESA 2OCEA 3Q9SA 1K3QA 1V54H 2EILH 3DF8A 1BC7C 1FWZA 3DXMG 4A0XA 2L7FP 1BJAA 4PJLA 3ZXPA 1SMYF 4XKWA 2XAGA 3LJ3A 1TWCJ 2D2WA 2QQ9A 4OMZA 3PM1A 4MTDA 2AFFA 3ZN0A 4KITB 2HKXA 2H8WA 3G2BA 2XGSA 1RC9A 2ZJQF 3OXGA 4XI0A 5JMND 3HRTA 4DI3A 5BVIA 2R0QC 3ONLA 2KIUA 2ZIRA 2J07A 2QSFX 1R58A 2COMA 2NYXA 1FLIA 5ENRD 3DKYA 3H3ZA 5A8IA 5FKLA 4JIVD 4FQGA 1X1PA 3BG9A 3S8PA 3QU3A 4XL9A 2VT2A 4HF1A 2CFUA 3LCAA 3ISMC 1OFCX 5F08A 5F04A 5J4YA 1S0PA 3GZ1A 1PAQA 3EIJA 3CLOA 3UKUG 2DMNA 2OCCE 2VASA 2JPCA 1OCRE 4RG6A 2KISA 5CERB 2VI6A 2DI3A 1QHGA 2WV1A 1B8IA 4W9RA 4G6DA 4DZJA 5T3RA 4G8XA 4UI9C 3GO5A 3ZMVA 3CVUA 4XLNF 3H0DA 2EPFA 3SDBA 5LEJA 3V79K 4I01A 3FU6A 3PNYA 2M0MA 3CHOA 2XXSA 1HE8A 3GZ5A 2V1UA 3CVPA 5AAOA 2RKKA 3C1DA 2STTA 1MGTA 3CKCA 4OVVA 4RBOA 4G6QA 2KXPC 2QQ8A 1U5TA 4CCJA 1Z77A 3AU5A 3DV8A 4L0ZB 2DN0A 2X6KA 4YDWA 3TP0A 2ID6A 2GRMA 3BUAA 4DYQA 5C3EJ 3QNKA 1NZNA 2HR2A 3EYYA 3WGHA 1E8WA 1KQ0A 1UG0A 2M63A 2QF7A 1IXSB 5LP0A 4I1AA 4A12A 3FFLA 4TXPA 1FT9A 1A04A 2XKPA 1YGSA 1IN4A 1EH6A 2DJNA 1XGMA 2XGMA 3T8RA 1T0FA 2H6IA 1UZCA 2KRFA 3FMSA 4P1WA 1S6LA 3DSTA 1MK2A 3L17A 3F72A 3E34A 1WI3A 4F93B 1D8JA 1F36A 4HBDA 3RIRA 4CH7A 2LH9A 5FTPA 3R7QA 1G88A 3RYRA 3NRVA 3JCKC 2J5OA 2XRLA 3BROA 2ZSHB 4ILHB 2MYOA 1XGWA 1K1BA 3GZNB 1QQEA 2MC4A 1IW7F 5DM7F 1I5ZA 3AJIA 1W5CC 3K4KA 4LSZE 3SFXA 2VJIA 1ZGJA 3CK8A 4RAZA 3DRAA 4GCOA 3GUDA 1ZRFA 2WXIA 3MGBA 1UMQA 1IDYA 4ZTJA 4GPMA 5J1UA 2WV0A 1OUVA 1QNTA 1WJBA 4HRLA 1MDMB 2FE3A 2DA2A 3QAHA 3OYFA 4U8VD 4CDGA 4UQYA 4DYCA 4CZZA 4FTHA 1WV3A 2VBZA 3G6EI 3ZNGA 1IG7A 2IGNA 1BD8A 2P58C 3SBSA 4ANJA 4DBRA 1OPCA 4RGUA 3SGHA 1IXRC 2R05A 2X0LA 4FETA 3OYDA 3C7JA 2P81A 2VIXA 2Y30A 3G1OA 1NL4A 3JRGA 3LY7A 1YQAA 5EEGA 2IY0C 2GOMA 3G2VA 2KLOA 3JRDA 2GQQA 2WXQA 2ZSIB 3PUKA 2UWJG 1EF1C 2BGCA 3CVWA 3RKWA 1D0YA 2VB6A 3CC7I 4E7IA 3V30A 5BV0A 5K1YA 2DFIA 2WQHA 2E36A 1HDDC 1OXJA 3L22A 3C18A 4IOAF 4GTSA 3U21A 5F1RA 2M8EA 1SVOA 4RDUA 3OL4A 1R36A 4AV7A 2LAIA 2JSCA 1U2WA 4UVAA 4I2ZA 1KU3A 3CUOA 1R1VA 1WG0A 2VJ4A 2AXUA 4JX6A 3WG9A 1GDTA 4PS3A 4HF2A 2ZCWA 1BLXB 3CHQA 3GQSA 3DSXA 4GA2A 1XDSA 2OZUA 2VTBB 2A68F 1RUNA 4FX0A 4U63A 3ZYMA 1WAO1 3I4NJ 1U5TC 2CO5A 2G9WA 5E8GA 4IOCF 2Y0SN 1WSUA 2E5NA 1LUJB 4IX7A 1REPC 1N4QA 2XHEA 4WNFA 2ZU6B 1OCOE 2LFBA 2XS1A 2BW3B 3R4KA 4LLLA 1MX4A 3S7BA 2A61A 1MDMA 4IYPA 1ZRCA 1JWFA 5D66A 2RQPA 5IT9K 2CUJA 4A3KJ 3O8GA 1K78B 2X6JA 2GA2A 1HCRA 3A77A 4EV0A 3CLJA 3DKXA 3QPLA 4OOIA 3GTOJ 3TWUA 3LFKA 3HPGA 5KCMA 1AU7A 3H92A 2PMZA 5E79C 5BXUA 4NBQA 2QQAA 2OZ6A 2Z99A 3P7NA 3PZ1A 1JPLA 1NP7A 2WXMA 2XPZA 5EJIA 3I53A 4IHVA 2I1JA 4PGGA 3PIOF 5HI7A 2X1DA 2PM6A 2BRFA 4AVXA 3GZ2A 4AUXA 4F91B 1TW3A 1B9MA 3SQNA 1O4XA 2HZTA 4D7MA 2OVBA 2E71A 1Z6TA 5GPCA 1RW2A 2AWIA 5HS7A 2VT3A 2GRNB 1USSA 2MABA 2XGOA 3DBSA 2LBFA 3TDUC 2M4GA 3L82A 4XM3A 1Y0NA 4H0EA 3HXDA 4OU0A 2QVOA 3MZ8A 3WTVC 1VZ0A 1T98A 1Z91A 2CQXA 2HDWA 3S3OA 3PH0C 1J75A 3OYHA 4AIKA 4M73A 2CUEA 3M4OJ 4RVBA 2E2IJ 3I0NA 1B89A 2VSXE 3FUFA 3GYHX 1N11A 1ZG5A 2Y0SA 2VTBA 1ZARA 5AJDA 1FIAA 1U7FA 2O6GE 1L0OC 5DCMA 3TQNA 3CCVI 3DBLB 3JSPA 4BDZA 2OV8A 2XS8A 2G7UA 5CBNA 5EYRA 5AARA 1Z21A 2ESHA 3IRRA 1HXDA 1YG2A 2OU2A 2LG4A 3FXJA 1HOMA 3E30A 1NI1A 3B73A 1H2TC 2YU9J 4IJAA 2KIFA 4NB5A 1T8IA 2V8SE 3LAPA 2EV5A 1BN5A 2Y69H 5LBQA 4L9PA 3V8MA 1MYOA 2NC9A 1K78A 3ULQA 2FU4A 2IW5A 3FM3A 2JQLA 3LQRA 1D5VA 4YNDA 3RO3A 5EJGA 3DTKA 3HDDA 1TYQG 4ANWA 5IYBJ 2VQ2A 1MX2A 1MD0A 5FT9A 4LUNU 4A6EA 3EUKL 1D1CA 1FT2A 2QVLA 2QYUA 2O8KA 1O7FA 4PDKA 5CJ9A 4U7EB 5CHEE 2VBYA 2V26A 2FJ1A 5IOYA 4C0EA 4B44A 4FCYA 3CCUI 2P6TA 4LCTA 4JA9A 4HOSA 5AENA 4A4YA 3J80K 1WPKA 1MR1A 5KJKA 3UMVA 4NDLA 5DEQA 1Z0UA 2EIJE 5GTHC 3V4GA 4KUMA 1USTA 3OTNA 1Y3IA 4EATA 3AG3E 4IRHA 2B63J 1G3SA 3E4BA 3P5JA 5F0FA 2FMLA 1ZBPA 1FJLA 4C48B 3L1PA 3CCJI 4IVNA 1DP7P 2FBNA 1K2MA 4WXDA 2PJRB 2WXPA 5B3SE 2R7WA 1RUOA 1BJZA 3EDTB 4KT5C 2IOSA 3NAUA 3QWPA 3IH3A 2XAJA 2L0TB 2QBYB 2V4HC 1U8BA 2FF4A 1X19A 2MLKA 3K4CA 5LGTA 2O8XA 3IAM2 4X8QA 2JA5J 1TT5B 4YG2F 5JA4D 1R1TA 3EHRA 4RAFA 3SDGA 1E7VA 3CQZJ 4RA2A 2LF7A 2YUSA 2EV6A 3ERED 2O9LA 3OYNA 3GTKJ 2IAIA 3DSUA 3WG7E 3SZTA 1KHUA 2KDZA 2F2EA 2EWNA 2NS0A 3UM3A 3E6DA 2PN6A 3QP6A 5JHBA 2AQEA 4A93J 4HRNA 2DOAA 4MEXF 4GB9A 1N25A 1TTYA 1HLVA 3WXXA 2DQLA 2L9RA 1I6HJ 3ERMA 3I55I 1W36C 2OC6A 2WXHA 5HRYA 4ENMA 4V19K 5EGOA 3S15J 4LFUA 2DVWA 4APOA 4LB5A 2F8YA 4DX6D 4UVBA 4HDVA 3QWWA 1DVPA 3BG5A 3L6AA 2VJ5A 2EIKE 4ME2A 2HOTA 5AIQA 4RB2C 2EA2A 3PNVA 1JHHA 5A2QZ 4U04A 2L9NA 3QODA 1VI0A 4V2GA 2I6HA 4PCQA 2IOLA 4WF2A 1EJ9A 4BBRJ 4KXKB 3AKZA 3DXKG 4I1OB 1HKTA 1SD7A 2TRTA 1L3LA 3BLYA 3FHZA 1W4MA 5ENQD 2NXNB 2R5ZB 3DU6A 3DEPA 3Q47B 1IUFA 2HVSA 2DA7A 2LSOA 1E3PA 3Q9UC 2L7KA 1EA3A 2KT0A 1TW2A 1ERDA 1BR2A 4UQXA 2A05A 2QYJA 4HOUA 3PUBA 2CV2A 5CLSA 5IY5E 4NC6A 2PJRA 3FZVA 1OCZE 3OAWA 4ESJA 1QA6A 5JVTA 4M9XA 3F23A 2FRHA 2KRHA 4M71A 5C4XJ 2QBYA 3IXEA 2L3DA 4AJWA 1ELRA 2R7VA 3V7RA 1JCRA 1QBQA 1X58A 1KLXA 1UN8A 1IYGA 4U07A 1SA5A 3DEOA 3SNXA 3BR5A 5J6XA 4KIBA 3A2KA 4IHXA 3WTTC 2ECCA 1JJ8C 3VLDA 2JA8J 2E35A 1T6SA 1FNNA 1R4MB 5FQ7A 2K27A 2XB5A 3CHMA 3TWVA 2EH0A 1OR7A 4A1SA 2CQQA 3BEEA 1S9HA 3HC7A 2LR8A 4K5BA 3DEEA 4L02A 3HVEB 2MH9A 4G25A 5ILVA 5D0QD 2XF6A 2L4MA 4UWGA 2DYRE 1R5GA 1XSXA 3PIPF 2CQ7A 1TQMA 2VKDA 4PGHA 2R93J 4XRSG 1A5JA 1U0TA 3AG1H 2A4ZA 1N4SA 3L9TA 3TKYA 1DEVA 4MGRA 1NA3A 3FTWA 5LCWC 2BY1A 4HYEA 2XAQA 1LTXA 3I4MJ 3BC8A 4MFDA 4ZZLA 4N5CA 4JEUA 4AM9A 2NYJA 2HTJA 2R17C 2CGPA 1ETKA 4OINF 2KKLA 1FSEA 2WM9A 4GMJA 4L1BA 1WJAA 4XIFA 1N0QA 1A6QA 2VJJA 1XTAA 3QOEA 5E1WA 5J1YA 4P5OA 2KZGA 2JA2A 2K4JA 3I54A 3W2VA 3K1NA 3KYLA 1MX6A 3FUJA 2R5ZA 1V54E 2EILE 3K9IA 2EFWA 3Q0VA 2DJIA 3WHCA 5ILUA 2GM4A 3CMYA 2L9SA 4EJTA 4A3GJ 1ETYA 3RRMB 3ZYLA 2NS7A 2MD0A 5E3NA 3CEQA 4CCMA 1Z1DA 2YX7A 3VLFA 1FTZA 5HVQC 1J2FA 4LK0F 4HXIA 3JSOA 1RI7A 4N3CA 3VYUB 4ZC3A 2Y31A 4YDYA 4IULA 5JEJA 1N95A 1S5LC 4JX4A 4GZ5A 1Y56A 3PEUB 2IJGX 5BPIA 2FULA 4GTTA 4J6IA 4A3FJ 2H1KA 2JGRA 4XN0A 4XX5A 3QPSA 3SXYA 4XRMA 4I2OA 4OIOF 2P5VA 4A6DA 2IONA 1P7JA 3H5NA 2M87A 2AXTC 1CGPA 2HWVA 3U1DA 3O48A 4HFGA 2WXGA 2XPIA 1D0XA 1ETVA 4RB3C 1SUWA 1IUYA 5E50A 2J5PA 1XDUA 4U88A 3FDYA 3HVEA 3QARA 1IHBA 1P9QC 3W9GA 4URKA 2OBPA 3RO2A 4JW1A 1KU7A 2R03A 4Z6YA 2NNNA 1ZLKA 2QUFA 3HHHA 3ABMH 2E1NA 4B89A 2VGXB 4N4OB 3TO6A 2WPVA 4E7JA 4P9FA 1CQTA 2IJLA 3OIPA 4N2QA 5FROA 3I6WA 2WY8Q 4CICA 1SFKA 2ZGGA 1C0WA 2A69F 1H9GA 1R7JA 2OQRA 3RJPA 4BAYA 1IGNA 1HG2A 2CG3A 1V55E 3EUVA 4HQDA 4F92B 3E0JB 1ACIA 3ONKA 2CW8A 1OR7C 1YT5A 4BS9A 2WB1N 5DD8A 5LHHA 4MQVA 2WAQN 3S1QJ 4FISA 4XRFA 4A3IJ 1UHWA 2CRGA 2V6CA 2HPIA 2BY0A 1VQ5I 1HA8A 1HU3A 2K40A 2K9LA 1NK2P 1EDUA 4GDFA 3O2PE 2R7UA 4JD2G 5EX3A 3BZCA 1IAWA 2PJPA 3FKIJ 1NA0A 3D9NA 3MDBA 2F5DA 2JRMA 3U64A 2R7QA 4QWQA 3MKYB 4L0YB 1I3QJ 5D8LB 4TV7A 3S14J 5EILA 1R5HA 3F0CA 3ZUVB 2CW0F 2RC4A 3HGGA 2ISZA 2GXBA 2EA4A 2VN2A 5D6EA 2EZIA 3CUQC 3K69A 1YJ5C 2BKKB 2CH0A 2LTPA 3WODF 1Z0ZA 2GBYA 1G6NA 3OYEA 2TCTA 4D5CA 1STZA 4FU3A 4L7TA 5FWQA 2AVPA 1Z0XA 1OKRA 3W2AA 2ZMEC 3CHSA 3R0JA 4O1OA 3TWTA 3ZRGA 4M9ZA 4BYYA 3KD7A 5GADJ 4K5AB 4Q4ZF 3JTGA 1R1UA 2UUZA 2W4SA 3ZRHA 1G8XA 4EZLA 4H87A 3FULA 1YHQI 4J8DA 1TNSA 1QQIA 2CSOA 1X2NA 2DXIA 1IN8A 4XKBA 1LVAA 2G1LA 4EHMA 1Z3XA 4BUPA 3MD2A 2W84A 3ZQ7A 1JT0A 2VGXA 3B02A 1D1AA 4K03A 3AG2H 5DM6F 5BPPA 3UOTA 3ABUA 4BX9A 2DZNA 2WB1A 4Y6WA 2Z5UA 4LIVA 3S17J 1W7PD 3RQIA 3AAAC 3FXKA 1WJDA 3KZYA 2O7OA 4DBQA 5H7PA 4JOMA 2VPLA 3V8QA 5KJNA 1XB4A 4M3OA 3ZW3A 2ZXJA 3IHUA 4BEPA 2ETCA 3I5PA 2E2EA 5IP9J 1UJKA 5ENSD 3CDLA 5LRRA 2Y9YA 1RESA 5FO5A 1Y6IA 2DWZA 4HRMB 1VQ9I 3UMZA 3LSIA 1W0TA 1I6XA 2DU9A 2GLOA 4C2TA 2XPWA 4U96D 2A5WA 1UN9A 2XCCA 3LVRE 1BR4A 2JT1A 4BQNA 4N5QA 3HXCA 5CCMA 5ICEA 4HA8A 1Z3YA 3ROUA 3D9KA 3UM2A 4RM2A 2QSHX 3FUHA 3I64A 3WU2C 1XC5A 3GVAA 3O6BB 4CCOA 3Q7FA 4ANXA 4YEJA 2Y9ZA 3EHNA 2HYGD 2QM3A 3PZDA 4ANVA 4UHTA 1FP1D 2GRQB 3FHEA 3CQGB 2Y1LE 3QYFA 3IP4B 1QZ2A 3ELVA 3NOGD 4Y13A 5JFRA 3E97A 4U0VA 4G2VA 3JTHA 5D4SA 3WTWC 3S16J 1DUXC 4BBSJ 2WMOA 1K3NA 2ZXHA 3JQ1A 3RPUD 2VBWA 2M8GX 3CMMA 4HV6A 3OS2A 1KZPA 5KNGA 5FLXK 1U3DA 2IPQX 2H1LA 2XIGA 4L5EA 2I2BA 4I6EA 3S93A 4ILGA 4OVUA 2W00A 4CEMA 3DPDA 2MBFA 2JPEA 1WJ5A 4BQAA 3J7ZI 2F4IA 4YFKF 3A1YA 3FWEA 2M3AA 2BXYA 1XD7A 4U0WA 4A3CJ 3P2BA 1O3SA 1AP7A 2MC3A 3JXIA 1GXQA 3GTQJ 2JUGA 2J8SD 3HXEA 1AWCB 2CYYA 5FQ8A 1ZYRF 2IEJA 4IRIA 2V6EA 2J4DA 3V42A 1XGOA 5DUKA 2LREA 2KIMA 2CV1A 3IKVA 2JUCA 3OR1C 4B48A 2JWTA 4EM2A 1PY1A 4CZCA 4HV5A 3U1KA 1OWPA 1OYIA 1O1SA 2HYZA 4G11A 1VQKI 1YOVB 3JXJA 1J4QA 4GU5A 5JERA 3G2UA 2W25A 4MLPA 2QSGX 2P9KG 5M5XJ 5B1BE 2DAOA 5KJMA 2HXIA 2ZFUA 1YFHA 1AOYA 3CV0A 4FLHA 4XSXF 2R02A 4U0YA 3SD5A 1SFEA 1YCSB 3GLLA 3HG9A 3FDHA 2PZIA 1S70B 1VDYA 3DKWA 4BXXJ 2A3SA 2R59A 1ZTRA 2K9NA 2KB4A 1W7PB 3TG5A 1I50J 4Z2YA 2VSYA 2ILRA 2V79A 5CVVA 3FH8A 1N4PA 3MKQB 3HL2A 2P0WA 2Y69E 3BPVA 2I1WA 3IHVA 4BH9A 1DP3A 4YELA 3T9KA 3H3UA 1ZAOA 3QKYA 3NEUA 1ORKA 4C9BB 3W6JB 5BQTA 4CXFA 3RU0A 5D8KB 3ZYQA 5EIBE 3S32A 4F52A 1IXVA 1BI3A 4O6FA 1WY6A 4TXQA 3SF4A 1ZHFA 3U9WA 3MCZA 1UJJA 2HR3A 4EQQA 4CZ2D 3CCEI 2DA4A 2I9CA 3D9IA 4AVPA 4KFCA 3PE3A 4WNEA 3RAUA 3MQ0A 3CHPA 5JEKA 5HDKA 2LSUA 1FOYA 1U3EM 3EJNA 1GUUA 5DHUA 1CF7B 2X1EA 1T95A 3UKRG 3RYPA 3JRBA 1N54A 5EJFA 3V7CA 3EHMA 4D10C 5IP6A 5HODA 1YJNI 1ETXA 1AWCA 1X81A 5DCFA 2PFBA 2FO7A 4ON0A 5AIJA 1BIAA 2GOXB 1N0RA 2RFMA 4U0UA 5T4YA 5JR3A 1U5TB 3CCLI 2BEOA 2LLKA 5H6QA 1FOKA 1I39A 4EGXA 1ELKA 3PFYA 3ESKA 2GXGA 4A0YA 1BI2A 3CVVA 4E7SA 3JAMZ 4QQIA 3C2HA 3KEZA 4KU0D 2KJBA 4HSRA 3ZYKA 2GRPB 3CD6I 3CJTB 2VXZA 3L00A 3ASGA 2JSPA 4AYBN 3HOXJ 3EHQA 3PEVB 3FM8A 3E7LA 4U0SA 3N97A 1YITI 3JUEA 3LXUX 3QYEA 4GZ3A 1ELWA 3UQ3A 3BG1B 1W7PA 4OIPF 1YW7A 3LNQA 4PZJA 3SEZA 4BHBA 3Q5FA 2V4LA 4ETSA 5L3BA 1MJBA 3J81Z 3MKQA 3DBRB 5BMZA 4RGRA 5K5QA 2DFHA 2F5FA 4CYDA 4OIQF 1LDJA 3PNLB 1U0JA 5AONA 3L2QA 4XLPF 1FT1A 2HQRA 1DU6A 5AQ7A 4RG9A 1KQ8A 3KP6A 3C3RA 2GIZA 2DYSH 3T8KA 2FMYA 3FIWA 3CMAI 2P7VB 3A01B 4D0PA 1T39A 4A5NA 5LFAA 1ZLJA 1DQUA 5LEKA 4G1TA 4UWLA 1D3YA 3WE2A 1R00A 4GTPA 1W36D 3FXMA 1QZZA 3EQLF 4FJYA 3VZBA 4UUCA 1DMZA 4MFEA 4A5MA 1FYLA 3LSMA 4BNCA 5G04C 1CF7A 2VGYA 3B7UX 2FI7A 4WX9A 3S1MJ 3PUFA 4HF0A 4X0GA 4I99C 1P4WA 3FMRA 4CT4A 2EQXA 3FY4A 4CHUA 3I5UA 4BJTA 5F0HA 5CBOA 4HSTA 1MMNA 1R49A 3OSGA 2Q7FA 1WI9A 1OLTA 1XN7A 4AIDA 4U87A 4C3JJ 4ZHBA 3HRUA 2KCKA 4RAGA 5AIPA 3S2WA 1OWMA 2Y3AA 3D9HA 4V24A 4MLOA 2DQRA 1TN6A 2V7FA 4GO1A 4HW0A 4NRHB 5D2MC 3EUHA 3RPUA 3BY6A 1NG7A 3N71A 3B7TA 4MKTA 3IC7A 4N2SA 2P9PG 3TWQA 3ULYA 3ZKJA 3KP4A 5CMYA 3GMJA 2EJRA 1QHHD 4XNFA 3GX4X 2EQRA 1ETQA 4HBLA 5ITZF 3UV0A 2PG4A 5CVUA 2JLBA 3FWVA 1NHAA 3ZR8X 1MMGA 1XMXA 3GEZA 1YW8A 2R7OA 4DQ2A 2XENA 2RNJA 3PREA 3VSKA 4XI9A 4K5CA 3UX4A 3QRFF 4KMUX 1UOHA 4JC8A 3PUJA 3HKZN 3V8PA 1EYHA 5ENTD 3ABKH 5JI6A 4R9PA 4UUSB 3F22A 2BF0X 2VE9A 2W85A 5FKKA 3GMEA 4E85A 2X1CA 4JPSA 1ZR4A 1ENHA 4FJZA 4GYGA 1QRYA 5FRNA 3AG1E 4N3AA 4BDYA 4S04A 4R7LA 5C4VA 1V5EA 4XR6A 3PSIA 1FBSA 4ASNA 4G9YA 2BTDA 4JL0A 4LGWA 1TWAJ 1GLNA 4GTRA 2V9VA 3A01A 4E4HA 4AXHA 3LSGA 3Q9NC 2ICWG 4KIGA 4JIWD 2HGCA 2E5ZA 3IKTA 2XVCA 2CQKA 2F4MB 1VQNI 1E0EA 2PLYA 2STWA 4B8CB 3DP7A 5ANRA 2FSWA 1TNYA 3JUIA 4NC8A 2XC7A 1Y39A 5HNHA 1P6RA 3V2XA 4MTEA 3HSRA 5B66C 5A6CA 4HPQA 2LKSA 4G12A 1AKHA 2IGOA 3PDNA 3M7GA 1LFBA 3UM1A 1BI0A 4NQWB 5BV1A 5LCWJ 2Z16A 3B7SA 1R9TJ 5BNGA 2WY7Q 1UG2A 4BXFA 4B43A 3K2ZA 3WGGA 2IO3C 3R7RA 2LBFB 4ZZDA 3BR0A 3FTVA 1S7OA 3LDZA 2JN6A 1G2HA 1SD5A 2RN7A 3QOPA 3HRSA 3TEDA 1XNFA 2Z2SB 4Q69A 4XLCA 4PSXA 3ELSA 2DMUA 3UN0A 3RSEG 2VGEA 2LNIA 3O3KA 4I1MA 2KB3A 4DOZA 4N3BA 3S3NA 1WWXA 3PS6A 3URZA 3IH4A 4JK1X 4LMYA 5JEMA 2XRNA 3SFYA 2YNQA 4A3MJ 4I6ZA 3ZQGA 2X6IA 4GZDA 1E8ZA 5DCMB 4UUSA 1TNTA 5HLTA 3X2QH 1Z9CA 3ZMZA 2FX0A 3KEAA 3EUHC 2MRIA 4HZFA 4JHJA 4GYIA 3HPHA 1J4KA 1LJ9A 4UB6C 3CDIA 3V2OA 1S3JA 1UG3A 3WGIA 4CGWA 4HDUA 3M8FA 1HQCA 3I59A 3IL2A 1J4PA 1X1BA 3Q9VA 4XLHA 2DA1A 4KVOA 1KYWA 3SI5A 3TAXA 2XB0X 3LSKA 2ME6A 4XONA 2XGCA 1P7IA 2HDDA 3A4CA 3ULQB 4IHTA 1XGNA 1DD1A 3S7FA 1TT0A 2CUFA 1J4OA 2LMDA 5LHIA 2JA7J 1IN7A 2PBIA 1KT0A 5TJJA 1W5TA 1BI1A 4FASD 3RSNA 4ZYGA 4ABNA 4F1PA 2RKHA 3Q7AA 5LD2C 3VTXA 4AC0A 3PRZA 1U9OA 1OT8A 3DSHA 2X6XA 4C3HJ 2V9PA 5KHDA 5ERIA 4N9IA 4A0ZA 5D5WB 1I1SA 4FT8A 1S64A 4QPQA 3J7AY 4BY1J 2JZYA 4BT9A 4NQWA 1R4NB 1EPUA 3RIBA 1P4XA 3JR9A 2R7DA 3ISPA 2Q2EB 3H35A 3OYBA 1QPMA 3DFGA 4XLAA 3CMEI 1RR8C 5EEAA 5FD6A 3GZ6A 2UXNA 5FQ6A 4PJNA 2IT0A 4JQFA 4EZJA 1AHDP 3D9LA 3UNMA 2MW8A 2RNGA 2A0TA 4A3LJ 4HOQA 1E17A 5LGNA 1TC3C 1ZQ3P 3GCMA 4PH4B 4IXAA 2M45A 5K5RA 3CVXA 1Z7UA 1TP4A 3H9QA 2BXZA 4ZH4F 5D0OD 2W57A 4ENKA 3UNGC 1PUFB 3QK0A 3ZIMA 2PMHA 5LHGA 4YIFA 3QWVA 1MNMC 3U3WA 2C2LA 1S7EA 1TJFA 4AP2A 3FEXA 4B0ZA 2ETHA 1RNLA 3C3WA 3O8HA 4RS8A 5ANLA 2E34A 1D8EA 1TJCA 3AG2E 2X4HA 2DODA 1LDDA 4MBGA 1JUPA 1MNDA 2IA0A 4PUSA 4ESBA 5BOXA 4J8FA 4AVZA 1F1ZA 1LFPA 3KP5A 5EGOB 3RKQA 1LKXA 3GTLJ 1G4DA 1FSHA 4XOTA 5B5EC 3H9JA 2WMNA 2K3FA 1IRFA 4UUVA 1RRJA 2GXAA 3JRFA 1ZB1A 2K86A 4GA0A 3S2AA 5CQGA 4BTBA 1W3BA 5CPRB 3D5RC 3VOEA 1D8KA 3CP8A 4DX1A 1HZ4A 3VEPA 5CECB 3ABLH 3PFNA 3BDDA 1H0AA 1N75A 1Y1VJ 2F37A 4JZYA 2BUGA 2GAUA 2GZWA 4YVOA 2Q2EA 1J0RA 1SVLA 2DMQA 2OUMA 3B6CA 4A3EJ 2H6HA 4BQOA 5KAFC 5ICFA 2OQGA 1K4TA 1UW4B 3LOCA 4S05A 2P5KA 3A03A 3F8NA 4C3IJ 4TV3A 5DHRA 1FCHA 3MKRA 4A63B 3MVPA 3F9KA 3L7WA 3PZ2A 2WXJA 3NZSA 2Y4TA 2LY2A 3LSJA 5BW8C 2G7HA 2FBKA 2IP2A 2VXDA 3ASDA 1ZRDA 1QVUA 3UXGA 5J3LA 3TWSA 4WERA 4RM3A 1H9TA 1EF4A 4F55A 5GAGJ 2EINH 2F5EA 4GCVA 1GV2A 3T8MA 5EKQD 3Q15A 4ZDPA 4G26A 1J5YA 4TXRA 4HG2A 2CUZA 1PUFA 5IOZA 4XRSA 2DW4A 3MA5A 4G2SA 4UI9K 3DTEA 1VQ8I 4FE4A 5GAHJ 1KONA 2D45A 4FADA 2LXMA 4Y33A 3WU0A 2L7MP 2YR2A 3DPUA 3M9AA 2CW7A 3W6VA 2NVQJ 5ARGA 3CK9A 5K7ZA 1MBKA 1WVRA 2R4GA 1IKND 1R6RA 2ZXWH 2H6CA 4HEA2 2E1CA 3ASOH 3SJMA 4FHTA 4UB8C 5FRMA 2IQCA 4JHKA 5E1ZB 5FZSA 4CYMD 5JELA 2M1BA 3UT7A 4BSXA 1BI7B 5HLIA 3EIQC 4HI9A 3UI2A 4BWRA 2KFDA 4CCLA 4BE1A 1JE8A 2VQCA 1TWGJ 1MJSA 4EMSA 3FISA 2VKEA 3CUQB 5EF6A 1FY7A 5HS9A 5E20A 4WUYA 5ENPD 5AYWD 2XKOA 2EFPA 3CGHA 3MX3A 3G1MA 3BTJA 2ZJRF 1N52A 4LG6A 3HUGA 1NTCA 2MG4A 2V5QC 5HKPA 3DLLF 1FMWA 4U7DA 2K7LA 4E7LA 2ZMEB 4DGWB 2LAHA 4GTOA 1V4RA 4O5VA 3ZXSA 3H3VK 3CVNA 2UWMA 2XAUA 4BSZB 5KBAA 2KM4A 2Q5FA 1ONVA 2K9MA 4KIFA 3F21A 2QCOA 4TRQA 1TEZA 1K6YA 4HLXA 5D5VB 1NFIE 5C4JJ 4Y6CA 3NWTA 2X85A 3KP7A 5M72A 4DNCA 4I98B 4XORA 1FIPA 3VLEA 1HW5A 2FD5A 1OQYA 1X3UA 4G7OF 5J40A 2AW6A 3QPTA 4WRRA 3CCMI 3TW7A 1Y0UA 4B09A 3HG0D 5M5WJ 3L09A 3F8BA 3M07A 4IHWA 1H6PA 3M3YJ 3TOBA 3JYSA 5E76A 4KYOB 2GIVA 3QPHA 2K02A 2X6FA 5FGMA 1K7AA 4CT0A 3BTIA 3PFIA 4A3DJ 1DGRM 2EFNA 3ZMSA 4IL6C 4LIUA 4FP7A 3CCSI 4UUTA 5E17F 2M7AA 1E3OC 5GPAA 5D4RA 3OYAA 4N39A 4N0BA 4RB0A 3W2WA 4F53A 3BG6A 2MFZA 1NK3P 1NH3A 2HQAA 1DNPA 2EFOA 2AJAA 3U2RA 2E1MC 1FEXA 3AFOA 4KN7X 3K1PA 3MKLA 4B1RA 4YFXF 3JRIA 3G71I 4B93B 4BU2A 4EM1A 3OXFA 1JKQC 2DOFA 1U8RA 4BE0A 4WXHA 3KLNA 4B3XA 4CDMA 3K4BA 2XEEA 2E2HJ 3ECOA 3FTUA 4BESA 3CUQA 1Q2ZA 1G59A 1FVFA 1TQIA 2CFOA 2HQNA 2BE5F 3ELKA 3FUMA 3B13A 1XCVA 4OAUC 3TWXA 2L0IA 2NAZA 1QGPA 5JHUA 4G6TB 4AY5A 5FJYA 2ZMEA 2HU9A 3IH2