2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
b'EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
1Q1HA 4OMYA 2ZMEA 1A17A 2Y48A 4CHUA 1G6NA 4B94A 5LBQA 3ZN1A 4OIPF 4EGYA 3GUDA 2PL2A 1ZRFA 2JRTA 2A6HF 3HSFA 4I02A 2E1NA 4APOA 1ZGJA 4GGGA 4P55A 4AVPA 5DJOA 4ON0A 3O6BB 4JK1X 4ZZDA 4PZJA 2F5FA 1HKTA 5CCMA 6PAXA 1YS7A 2ZMEB 5DDGA 1DPUA 1FBUA 1XD7A 2FU4A 3HUGA 3WTVC 4KIGA 3DF8A 2C2LA 1XSXA 3WGHA 1GXCA 4HV6A 2E2EA 2ESHA 3P9KA 2YU3A 4D0PA 4H7XA 5DIZA 4GYWA 2QYOA 4LLGF 3F8NA 5LCWJ 4EJQA 4PGGA 1KA8A 3UN0A 5ILUA 1J75A 2F2EA 4KICA 2FO7A 3EYYA 2P8TA 2V5FA 3KZZA 2UZKA 2QZ8A 4GCOA 5LGTA 3KAEA 3RKWA 4CDRA 1R21A 2D1VA 4P96A 2W84A 2RV8A 5FD6A 3E5XA 3MAJA 3FXUA 4L9NA 4AM9A 2DK8A 2JZYA 1TW3A 3HOTA 1FNNA 4M6XA 3PQJA 2V1DA 1YIOA 4D9VA 4U0VA 2QLZA 5DYMA 1AWCA 5G05J 3FM3A 1ZBPA 1QZZA 1XGNA 3R61A 3I0MA 1WRJA 1BC8C 2OA4A 5ICEA 5DBKA 4AY6A 3UMZA 3RYRA 1Z9CA 3ECHA 3Q5FA 3J80K 2HGCA 3TAXA 3VTYA 3MCZA 2EJRA 4P9FA 5E17F 4I0AA 3G3ZA 3DXJF 4FX0A 3ESKA 5D5XB 1R58A 3QPHA 4Q5SF 3KCCA 3WU0A 2OD5A 1BIBA 3BDDA 2ZXJA 1TW2A 2RC4A 4KT5C 4XSXF 3IL2A 2CG4A 5KJMA 3JW4A 4UXNA 1FYLA 2COMA 3SZTA 4G26A 4YFXF 1JGSA 3BP8A 3HRUA 4W9RA 4RS8A 4EM1A 3K69A 2DI3A 4HF0A 2KJCA 2RQPA 2GA1A 1PC2A 3GW2A 5HS7A 4QWQA 3EETA 2R7FA 1FSHA 2EK5A 1ZN2A 2HKXA 4G7OF 1IUYA 1J0RA 3J80Z 5EEHA 4BHCA 3CO7C 2CWEA 1FX7A 2F5CA 4AIJA 3GO5A 4IN3B 4AIHA 1HKQA 2RKHA 1NA3A 4A0YA 2XGXA 3V4GA 4HAMA 1TLHB 1UFMA 5HQ8A 1IXSB 3FP3A 3DPTA 2K02A 3BEEA 4XLPF 4EGXA 3CTAA 1YJMA 4EMSA 4G7ZF 3I6WA 3L2CA 3FMSA 2A0TA 1U2WA 5G04J 3GFLA 2GXGA 4N2SA 4MQVA 2G1LA 1I1GA 1J4LA 4WNFA 3GX4X 2XIGA 3VB2A 1DP7P 2EWNA 1WQ2A 3DFGA 2VODA 1BM9A 2BV6A 2E7XA 2P4WA 5L3GA 3PO8A 5CVJA 1FP2A 4M9ZA 1WSUA 3ZFWA 2P5KA 3NF1A 1ODDA 2ZO4A 2IA2A 1ON2A 1IN5A 5JR3A 3MZHA 3I6UA 3R0JA 2XGOA 3HOSA 4GYIA 1Z7UA 3F8CA 2ZBKA 1KYZA 4LFUA 3ZQ7A 2NS0A 4BXUA 4JQFA 1BC7C 2EA4A 4RB2C 5E50A 4U0WA 1XMKA 4GO1A 1K79A 3HRMA 2PQRA 1EH6A 3HRTA 3PFIA 3KLNA 1V3FA 1ZAOA 4HLYA 3KZYA 4OIQF 1Z6TA 1TNTA 5L3DA 1G3TA 3LSTA 4HZFA 2QBYA 4CXFA 5KVRA 4N9IA 1W5TA 3SZ7A 4BHPA 2DT5A 1JHFA 2XEVA 3HSRA 2QFCA 4M71A 3WGGA 3CK9A 1LVAA 2XHKA 3NQOA 2DU9A 5CHEE 1JE8A 1O7LA 2KKLA 4A0ZA 2L02A 4HV5A 4BYYA 3CVPA 3DQVC 3EQLF 2WV0A 3M1EA 5HDKA 2AFFA 1W7PA 1MGTA 3HX1A 5FD5A 3SHFA 2KFUA 2K27A 1SD4A 2JPCA 2P5LC 2FI7A 2LKPA 1LDDA 2MD5A 4MTEA 1DPRA 3BPXA 1BIAA 1IRFA 2XAGA 3TG5A 1S7AA 3GW4A 1W3BA 1IRGA 2ADUA 2A68F 4BWRA 1ELRA 2B0LA 2PIEA 1WI9A 2OQGA 3RTRA 2GIVA 2JPEA 3KEQA 4OIOF 2KCLA 4K2EA 4LLLA 4IHSA 1T0FA 2MH9A 5JJ7A 2EB7A 2X4HA 3GXOA 1S6LA 4YNDA 3K9TA 1XMAA 3P9IA 5DV5A 3IWZA 1WWXA 2FBIA 2W57A 2XV4S 4L0YB 4OIRF 1J7KA 2KCKA 2DK5A 2RDPA 3LWFA 4IXAA 4IRHA 2PQ8A 4U0SA 2MC3A 4WX9A 1MJ9A 5ILSA 2WPVA 2CSOA 1MZBA 5CCLA 3JSOA 2VBYA 4MTDA 5AIPA 2OOEA 5FZQA 3K1PA 5JFRA 1LJ9A 3OOPA 5D0QD 5A2QZ 3MDBA 3E5QA 1FCHA 3VTXA 5LGUA 5IT9K 2GW1A 1YW7A 4LK0F 1CF7A 1J9IA 4CDGA 1XGMA 5FZSA 4ZH4F 2E1CA 3RO2A 1Y0UA 2EFOA 4BH9A 3CUQC 3WTXC 1FZPB 3OXGA 3ASDA 4P9UA 4NB5A 2IJLA 4RB3C 1RUNA 4A12A 4LB5A 4EJWA 1KT0A 1E2XA 1IAWA 2XAHA 4GA0A 1FPQA 2LNBA 1MJBA 4LB6B 3UQ3A 3POAA 1TTYA 5AONA 3RIRA 1CF7B 2V9VA 3HSEA 3F22A 4JHRA 3H92A 3CVNA 5FFZA 2M87A 3AS5A 3DEUA 1K3QA 1AOYA 3I5UA 1K3JA 5BPIA 3JYSA 4N39A 2HDCA 5J8FA 2Y75A 5F1RA 4NRHB 2BGCA 1ZARA 3KP7A 1YG2A 4EJTA 4IHTA 3FMQA 1REPC 3VFZA 1FYMA 3F72A 4R1HA 2NC9A 1O3QA 4RG9A 2XCBA 5IT9Z 3F8BA 5CYVA 3TGOA 1B9MA 3TDUC 4QCJA 3REOA 1KT1A 4OINF 2HEOA 2VSYA 4KYOB 4HOSA 1UCRA 5FTPA 5E20A 3TQNA 1K6OA 1XGOA 2CSWA 3E6BA 3WTSC 3IEGA 1HKSA 5H6RA 1OR7A 1DDNA 2L01A 3HIFA 4N5CA 1X3UA 3FHZA 2LF8A 1PDNC 1U8RA 1YW8A 3RJVA 1XN7A 3FXRA 2AXLA 3FF5A 3KP4A 3VOEA 2BYVE 2H94A 2FMYA 1RIOH 1ZRCA 4KNYA 4G6QA 2LNIA 3CV0A 3F6OA 1R22A 3HRSA 3TGNA 5AYWD 4U0UA 3HUFA 3VA1A 3LA2A 3PE3A 2KIFA 2NNYA 3GZ6A 1YFHA 1R36A 3CUQA 4A2UA 1W7PD 2DTRA 4KA4A 1XGSA 2Y0MA 2Q0OA 5HLIA 2HQNA 2A69F 2IA0A 3WTUC 2JT1A 2FXAA 1OUVA 2FOKA 4XLNF 3E5UA 1IYGA 3M8FA 2YSRA 3KP5A 1E17A 2KJBA 1MJAA 2UWJG 2PQNA 3WGIA 4Q48A 3CLOA 2V1UA 5K1YA 1J4KA 3LAPA 1IN6A 1H0MA 3S7FA 3VPYA 1MZKA 5FFXA 1SFEA 4F7ZA 3QWVA 4GA1A 4Y6WA 1O57A 5LEKA 4JONA 4G2SA 1TJCA 4N3BA 3CUQB 5BS6A 5CVRA 4I7HA 2OBPA 2KB3A 3RI4A 3QOUA 5FO5A 4ESBA 4HF1A 2V6CA 3R60A 3WE2A 3ZN3A 4G25A 3JSPA 2GXBA 3CKBA 2X0LA 3RJPA 2M30A 3B02A 3KETA 2CYYA 3KLOA 5FLXK 2A61A 1HXDA 1O3TA 5BNWA 4RB1A 2VGYA 3LY7A 2MBFA 3RKYA 1BOAA 5HLHA 1BI3A 4KYWA 2IP2A 4U0YA 4M6YA 4CYDA 2HOEA 2VGXA 3GYHX 2BE5F 5D8KB 4BNCA 3C18A 3JTHA 3OXFA 3J7AO 3WXXA 3QP6A 5A8IA 1SD5A 3TOBA 2W85A 4CO8A 5CVUA 1MDMA 3IKTA 2NRAC 3V8KA 4OMZA 4UVBA 5KK1A 1JXSA 2MLGA 5HOOA 1RNLA 1JHHA 2KATA 2PG4A 5JI6A 4AWXB 1L3LA 5LGNA 2FBHA 2HTSA 4KUMA 3ELSA 3T0YA 2STWA 2QQ9A 4WK8F 3D0SA 1G4DA 2O61A 2VGXB 2VOOA 5FLXZ 1K2MA 1ULYA 1B6AA 1L0OC 4WNGA 1USTA 1XDSA 2PMUA 4Y17A 2ISZA 2DFIA 1QZYA 1MDMB 3KD7A 3Q9VA 3RPUA 3D5LA 2HS5A 4G1TA 1GXQA 1J2XA 4RGRA 2XAJA 3ISPA 1Y8MA 4U7DA 4HX7A 2K4JA 4I9CA 3RYPA 2VE9A 4G9YA 4KXKB 1BJAA 2KIMA 4L0ZB 4EJUA 5HDNA 4WNEA 1OMIA 3L7WA 3MEXA 1ZRDA 1W5SA 1UHMA 1O7FA 4HX8A 1IZ1A 1G3YA 2RNJA 4HQMA 3BROA 4I17A 3C1DA 1LEBA 2WTEA 2UXXA 5J6XA 4I01A 2R3SA 3MV2B 3I0NA 4G7HF 2WWYA 4S04A 2R7DA 3O3KA 3NEUA 1CGPA 3BJ6A 1VTNC 1T38A 1T2KA 4Y13A 1OYWA 1FT9A 5FGMA 3I58A 3V7SA 2OZ6A 4HQEA 1O3SA 3KP6A 4DQ2A 4EJVA 5FJYA 3IWFA 2JQJA 3IHUA 3RIBA 1R23A 2IVMA 2UWMA 4OOIA 2BRFA 1J4OA 5DUIA 4UV9A 5EKQD 2ETHA 2VT3A 5CLSA 1KU9A 1LDKB 4J8EA 5EX3A 4S05A 3GFJA 4N0BA 5LRSA 4CGWA 3E97A 3LA7A 4KIBA 1PUEE 3ULQA 1SAXA 4RG6A 4M9XA 1XCBA 3QWPA 2KRFA 3E3VA 3TKYA 2V1XA 4GZ3A 2L3DA 3AS8A 2QVOA 3ZMVA 4ZYGA 3HTUA 3P9CA 3LPZA 1HXIA 4Y15A 4A0EA 1LNWA 2GZWA 1BI1A 1LGQA 4M72A 2HFHA 2GA2A 5BW8C 1OYYA 1K2NA 3UUXA 4WUYA 2XUBA 3PE4A 2CO5A 4U04A 4A5MA 4KMUX 5L3BA 2A6EF 5CJ9A 3FXQA 2M45A 2ELHA 4BT9A 3V8JA 2DQRA 4WXDA 2WC2A 5DCMA 3ULQB 1B9NA 1Z05A 1OKRA 1KQ0A 3FM5A 3Q49B 3ELVA 4IF4A 3M7GA 3BPVA 1LDJA 1T39A 5DUKA 2EA2A 4N3AA 1BBYA 2E7WA 2HQRA 4A5NA 2HR2A 3E4BA 3U3WA 2KKOA 4M74A 3S7JA 2FEZA 1TBXA 1Z91A 2JPBA 5HDGA 3T8RA 3QP5A 3QDNA 1ZG3A 3ASHA 3UOTA 3OUNA 5LHGA 2Z99A 1B89A 2CGPA 1B1BA 3KE2A 1DUXC 4OU0A 5DCMB 3CDHA 4UI9K 2VN2A 1U78A 4HOQA 4UI9C 1PP7U 3ABUA 3VEPA 2QM3A 1YS6A 5ARFA 4J0UA 4ASNA 2VC0A 3R4KA 5HI7A 1A04A 2M1BA 2EV6A 2I6HA 4XRFA 3T8TA 4MEXF 3IC7A 5TJJA 3WTTC 2ACJA 2HKOA 3WE3A 1R1UA 4FHTA 2JKDA 2STTA 2TDXA 2LSUA 2ZJ2A 4M73A 1ZYRF 1LEAA 1TQMA 2O6GE 1SFXA 1KQ9A 1R1TA 1TQPA 1GVJA 2EFQA 5TRDA 2VXZA 4YIIA 4I98B 4WXHA 2DAOA 1XSDA 4HOUA 3ROUA 2FNPA 3GEZA 2OZUA 3I71A 1BI0A 3OV8A 3L9FA 2EFWA 4KDPA 3C3WA 3I4PA 2BBYA 1IXCA 3M8EA 4EJOA 1LQ1A 2Z3YA 2XAFA 3ELKA 5D6FA 2RVCA 3VODA 1NZNA 2PI0A 2MA3A 4IJAA 3R9AB 2NAZA 2PFBA 4UQXA 3ZMUA 5BQTA 2FNAA 4LD5A 2DPDA 2KB4A 2H6CA 2FMLA 1SFUA 3U2RA 2Z5UA 1OYIA 3BZ6A 2LSOA 4GPKA 4GXOA 3VA4A 5D4RA 3GFIA 2L4AA 1FSEA 4HYEA 4G24A 3KP3A 3RDIA 1MKMA 2CW0F 5BOXA 4E70A 3GQSA 3F6VA 4TV7A 4B09A 4UV8A 4AD9A 3P7NA 4LGWA 1UHWA 4N2QA 5ICFA 4PCQA 1S29A 3ZMZA 1SMYF 1YLFA 4WCGA 2FA5A 3SFZA 3K1MA 3FWVA 3RKVA 1BN5A 4B8XA 3TO7A 1GHCA 4L9TA 4A0XA 5DD8A 4R8HA 4YG2F 3GVAA 3R0AA 3I53A 3ASFA 2P6TA 2Z33A 1D8KA 3WTYC 5EEGA 1B4AA 1FC3A 3NRVA 5JVTA 4MHGA 1EH7A 2IPQX 2JTVA 4LLNA 3HHHA 2Q8KA 3V8LA 3WODF 3V7CA 2EFNA 1TQIA 4WWCA 2VBXA 4G94A 5EX0A 3CEQA 4JA9A 1WKMA 5HLGA 4KFCA 1HSJA 1ZLKA 4WXCA 5D8LB 3ZHEA 4KMFA 3KT9A 2VT2A 2A5YB 3MFKA 1S7OA 1V4RA 2Q7FA 3S7DA 4ME2A 4WF2A 2F5EA 5KJNA 4JL0A 1PP8F 3GZ2A 4U0ZA 2QENA 2ZNZA 4BTBA 2W24A 2LF7A 2ZKZA 3KP2A 3F3XA 1UHTA 5L3EA 2VOPA 1S3JA 4RAYA 1D5VA 5E1ZB 2QUFA 4KBQA 3FX3A 3SF4A 2FE3A 2HYZA 3SZPA 4RAZA 4AIFA 5LHHA 2FBKA 4M9SA 4O3MA 3ZHEB 3LY9A 3UPVA 4GYGA 2H27A 4UI9J 4KN7X 4G8XA 1W4MA 1ZREA 3DV8A 2YPRA 4AY5A 1P92A 1FOKA 2YR2A 1D3YA 4UQZA 3MEKA 3E6CC 1K3NA 1USSA 1QNTA 3MWMA 1KGSA 5JHUA 1T98A 3RPQA 4ZYDA 1LGPA 3KS2A 3COAC 1P5QA 4UUVA 5K5RA 3WU1B 1WAO1 1H9GA 2F5DA 3LQQA 2AS5F 4Y6CA 5D5UB 3S7BA 1R7JA 3HTSB 4EM2A 3HUEA 1YYVA 3F8MA 3ASGA 4JA7A 3MKRA 4R79A 3FM8A 2DLLA 3JAMK 3GF2A 3GZ1A 4J8DA 2PBIA 2O3FA 3OXLA 3LY8A 4IVNA 1NHAA 4HOBA 3K9IA 1R5HA 1F4KA 3TO9A 3TOAA 1ZHFA 3BWGA 5HS9A 4G23A 4YFKF 3UNMA 4EQQA 2XROA 2PJPA 3WTWC 2Z9OA 3MA5A 2K7LA 2YX4A 1ZLJA 4XBFA 2QWWA 2D1HA 4IRGA 3K1NA 3Q9SA 3BJAA 3O2PE 1P4XA 2J9QA 1TNSA 2HO1A 2XPIA 4GZ5A 3IRQA 2AVPA 5DCFA 1QQIA 4G2VA 3W6JB 1G3SA 3U1DA 3N71A 2C0LA 2PN6A 2ONDA 2HYFA 5M72A 4CGZA 2JLBA 3KEOA 1RI7A 1HW1A 3JAMZ 4L9VA 3CJNA 1FLIA 1LB2A 2PLYA 3F23A 3N97A 4UVAA 2FSWA 5D6EA 2FBNA 2CQKA 3LQRA 3TG4A 4UHTA 4HF2A 4HDVA 4FX4A 4I09A 1F1ZA 2P5VA 1WM5A 4AIKA 1ON1A 4A6DA 2DBBA 4QLCU 5ICGA 5HS8A 2W3OA 2XKPA 2XRNA 4RB0A 1QQEA 3U4TA 3DKWA 2BUGA 2GWRA 3UNNA 1IXRC 4HORA 2XKOA 2W25A 4N9HA 5J8CA 2ZNYA 1Z6RA 4JBAA 1YJ5C 3FFLA 1NA0A 1YA0A 4I2ZA 1EV7A 1I1SA 1IN7A 1XNFA 1G3WA 5D5VB 1I27A 3CO6C 4HW0A 1FYKA 1B59A 1KYWA 4YIFA 3TO6A 5H20A 2L4MA 3PDNA 1HBXG 3BOQA 3R6SA 5FB2A 1ZH5A 3CKCA 4N3CA 3CK7A 1UB9A 4F3VA 1KU3A 1FBQA 5AIQA 4CGVA 4EM0B 2M8EA 4UQYA 2RN7A 5E8GA 1P4AA 4H0EA 3GWZA 3WTZA 2FQ3A 1FY7A 4ENJA 3LYAA 2CFXA 3L00A 1F9NA 1G6GA 5ARGA 4ABNA 3LA3A 1R5GA 3F8FA 4I2WA 3J81K 2XASA 3V7RA 4P5OA 4MGRA 2BEOA 2OQRA 5K5QA 2DO7A 5L3FA 4MNUA 3E6MA 3BY6A 4XI9A 3ZGQA 2L54A 2EV0A 3L09A 4UVCA 1UJXA 1FWZA 1HW5A 4I9EA 1H9TA 2M5WA 4I0BA 3QU3A 3W6KB 4GCNA 1K7AA 4EGZA 3QRFF 2VYIA 2VC1A 5E8IA 2J5OA 2VBZA 2V79A 1ZG5A 2G7UA 2VE8A 5E1XA 3SXYA 4BTAA 4XIFA 4I2OA 2HYGD 3UV0A 4O5VA 4YVQC 3LAJA 1S8NA 3FZVA 4ESFA 1D8JA 2PMHA 3IKVA 2XGSA 1I5ZA 2LSVA 1U5TC 3QWWA 3G73A 1OPCA 4KN4X 1STZA 1KU7A 5E18F 1WLNA 2YHCA 4U07A 3HYMB 1SD7A 4ENKA 1F5TA 3J81Z 3K0LA 3GZ5A 3ZMTA 4IPAA 3URZA 4Q4ZF 3PQKA 5ICCA 1QU5A 3F21A 3H3UA 2RGVA 5F64A 4ETSA 1XSVA 5HVQC 1O3RA 1SMTA 5K5OA 2Y4UA 2EH0A 3Q47B 1QBJA 3MQ0A 3WG9A 4XSZF 2FRHA 4DNCA 1ELWA 2IA1A 2HWVA 2HZTA 2DW4A 1KU2A 4GYOA 3DP7A 2OAZA 1ZG1A 1YTYA 4L9JA 4EQFA 3EYIA 2IT0A 2VSNA 3SQNA 4ZZLA 4PDKA 1ZGAA 3TDZC 2HR3A 4U7BA 1ZU2A 1E96B 5KJLA 1KLXA 3CVQA 2NYXA 1HQCA 2UY1A 5F6FA 2A3SA 1R00A 1IW7F 3HYIA 2ZCWA 3U9GA 2HTJA 4RGXA 4FT8A 2L6JA 1T6SA 1HH8A 2UXNA 3IRRA 4ESJA 5ILVA 3GLXA 3Q4AB 2JQLA 4YVOA 2O0YA 4CICA 3CK8A 1ONVA 4BQAA 1FBSA 5LRRA 4LJZF 2GQQA 2YQ8A 4YFNF 3LFKA 1QZ2A 2UY1B 4O6FA 1QPMA 2XGMA 4UNOA 1U5TA 2ZFWA 3T1BA 3ZMSA 4G6DA 4J8FA 2H09A 4BAYA 4EVIA 1YQAA 2P58C 4ENNA 4A1SA 4H87A 5D4SA 2QBYB 2JSCA 3QKYA 3HHGA 5IT3A 4GA2A 2Y4TA 3DPLC 5DD4A 1U3EM 3MV3B 3ZP5A 2FF4A 1RUOA 5KJKA 1P6RA 1R1VA 1YO5C 4Z2YA 3ERED 1HSTA 1IN8A 3QAHA 5A2QK 2OU2A 2ESNA 1GXPA 1FHQA 1W7PB 1U5TB 4BHBA 1FP1D 1J4QA 4PGHA 1HW2A 2QQBA 3EUHA 2QQAA 1I6XA 2XCCA 3K2ZA 4EV0A 4BT8A 3MZYA 3QU6A 4L5JA 2IRFG 3S2WA 5LEJA 5D5WB 2LC1A 3ZPLA 5A7DB 2MLKA 5FT9A 1RZ4A 1YW9A 2P6SA 2Q2EA 5LCWC 5H6QA 3QOPA 3ZMDA 5JJTA 3QPTA 2DPUA 2A07F 1K78A 5ERIA 5CVIA 4ZYHA 1G3GA 4L5IA 4LG0A 4CZZA 4NQ0A 1MD0A 1FHRA 4MEYF 2IFUA 4H7YA 3O48A 1Z1DA 3M9AA 3ZPJA 2PEXA 3GFMA 3RKXA 5BMZA 3LCAA 2YX7A 5CVVA 2EV5A 2KCVA 3AS4A 4GCVA 4L18B 5G05C 3ECOA 3Q15A 3FWEA 5C1DA 4RGSA 2KC7A 3AAFA 5JJ6A 2R5SA 4GZ6A 1K78B 3E6DA 2JQIA 5A6CA 4NQWA 2C6YA 1WV3A 1J59A 1IN4A 4LG0B 3ML6A 4HLXA 3LKUA 2G7HA 4HDUA 2P7CB 3KFWX 3I59A 4HA8A 4NHJA 4HBLA 2WQHA 2XVCA 1QO0D 3CUOA 2XT9B 2NNNA 3RO3A 3I0TA 3EDTB 2P7VB 1U6GA 1BI2A 1QGPA 3Q5MA 5ED4A 3GYZA 2XAQA 4IRIA 2C0MA 4GYYA 4HOTA 2EFPA 4HX4A 5FZRA 5D0OD 1XDUA 2O8XA 2IW5A 2IF4A 4O6JA 2MHKA 2LDUA 3H3ZA 1KQ8A 2H6BA 3I59B 4I1AA 1J5YA 1DMZA 2K4BA 3ABTA 4A6EA 1J4PA 3N4MA 2G9WA 2D2WA 4Q47A 3FMRA 5L3CA 2VBWA 2PZIA 5LLQA 2MH2A 4RGUA 1C0WA 3I64A 5BPDA 3I54A 3T5XA 5LHIA 4ENMA 4WNDA 3CVLA 4LEUA 1SD6A 3ZN0A 1EH8A 4KIFA 1P2FA 4MQ9F 2VONA 3JTGA 2VQ2A 2K86A 2DQLA 3BJOA 2GAUA 4LK1F 2D45A 2J5PA 5BT1A 4U88A 4LMYA 3B73A 1XCVA 5DEQA 2KIUA 2DBAA 1IF1A 4XI0A 1IHGA 2ISYA 5E1WA 1XB4A 3RU0A 1HZ4A 4ZYEA 3EDPA 5G04C 2O03A 1P4WA 3C7JA
chains in the Genus database with same CATH superfamily
1Q1HA 4OMYA 2WB2A 2ZMEA 1A17A 2Y48A 1Y1WJ 4FASD 3PEUB 2KRCA 4CHUA 1G6NA 4YDOA 2QZAA 4UB8C 1A5JA 4B94A 5LBQA 3ZN1A 4CCKA 4OIPF 3MGBA 2GOXB 3JRHA 4EGYA 1EF4A 3GUDA 2ZXIA 1JKQC 3CMAI 2PL2A 2VB6A 3KPHA 1WCMJ 4KT6B 1NK2P 2JRTA 1ZRFA 5EIDA 4AXHA 3TP3A 3QYBA 3UKUG 2BY2A 4TRQA 2A6HF 3HSFA 4I02A 2X6FA 2E1NA 2OCCE 3D9HA 4APOA 3BR5A 1CQTA 5FINA 1ZGJA 4GGGA 4P55A 5IOZA 1H6OA 3FBNB 3ZQHA 4AVPA 1YRNB 3UIPC 5DJOA 4ON0A 2I8DA 1DGRM 1VI0A 2QYJA 2V1NA 3AG2E 3O6BB 1W5CC 1JCQA 3CHMA 4JK1X 5LP0A 3QPLA 2PMZN 4ZZDA 2KDOA 4PS7A 3G2UA 4PZJA 4B3XA 3SD5A 2F5FA 1HKTA 3MKWB 1EYHA 5CCMA 2LY2A 3CDIA 6PAXA 4DRXE 1YS7A 2ZMEB 5DDGA 1DPUA 3CVUA 1FBUA 1XD7A 2FU4A 3E1SA 3HUGA 4NNJA 4B47A 3WTVC 3BG9A 4KIGA 1D8EA 3DF8A 1X2MA 4GMLA 1P7JA 4DI4A 2XAUA 2C2LA 1XSXA 1MSEC 4ILHB 3WGHA 4EECA 1OCRH 1GXCA 4A3TA 4L2YA 1ETOA 2FX0A 4HV6A 1Z3XA 2E2EA 4BY6A 2ESHA 4AVXA 4GPMA 2UUZA 3P9KA 2X6KA 3FTSA 2YU3A 4NC6A 4D0PA 4UWKA 4H7XA 5CBOA 5DIZA 1Y6IA 4GYWA 2QYOA 4IEJA 4M3EA 4LLGF 4D9JA 3QB2A 3F8NA 2Y0BG 5LCWJ 4EJQA 5IP9J 3GTPJ 3D9NA 4PGGA 1KA8A 2HZDA 3UN0A 5ILUA 1J75A 2F2EA 4KICA 2FO7A 2MGQA 3EYYA 1DCEA 2P8TA 2V5FA 3KZZA 2UZKA 4LNUD 2QZ8A 2VUMJ 2QEXI 1TWGJ 4GCOA 2QVLA 3I9V2 1OISA 5LGTA 3KAEA 4K5AB 2IGOA 2EBIA 3RKWA 4CDRA 3RAUA 3CMMA 3HUGB 4IQ4A 2D1VA 2VJ8A 4BU2A 3UM1A 1R21A 4P96A 3H1CA 2JUCA 3TWWA 2W84A 4KMOA 2RV8A 5FD6A 3R7RA 3E5XA 3MAJA 3MKZA 3FXUA 4I76A 4L9NA 2DK8A 2JZYA 1HCRA 1TW3A 3HOTA 4AM9A 3HPGA 4LNBA 1FNNA 4M6XA 4A63B 3PQJA 1D0ZA 1HC8A 2L9BA 1OCZH 2MSYA 2V1DA 3OYAA 1YIOA 3NAWA 3T8KA 4D9VA 5B1BH 4BXFA 4U0VA 2F48A 2P81A 2QLZA 1S5LC 5DYMA 1AWCA 2P9IG 3JCKC 4Q96A 5G05J 3SO8A 2H1LA 4A3MJ 2COBA 2LRDA 3TEDA 3FM3A 3A03A 4RAFA 1ZBPA 3ZVVA 1HFAA 4WWNA 2R5YB 2DA2A 1QZZA 5GPAA 1XGNA 4AC0A 4XL9A 1I50J 1D5YA 3R61A 4JD2G 5A23A 1WRJA 2GIZA 4U87A 3I56I 1BC8C 2OA4A 2LXMA 3LSJA 4GTQA 5ICEA 5IOYA 5ENSD 5DBKA 3T5VA 3BTJA 4AY6A 3RYRA 1OCCH 3UMZA 1MIJA 1JJ8C 1HF8A 2XB5A 3AKZA 1GT0C 1Z9CA 3PVLA 3ECHA 4NURA 2FOWA 5AJLA 3Q5FA 4YDEA 3J80K 2HGCA 1FT1A 3TAXA 3MCZA 3VTYA 3I5PA 1QNFA 2EJRA 1WH5A 4P9FA 3CMEI 4BETA 5E17F 1Q1VA 4I0AA 3FTXA 3G3ZA 3DXJF 4FX0A 1D0XA 3ESKA 2L9SA 3S1QJ 5D5XB 4M3OA 3DBRB 3Q9NC 3VWBA 1SFOJ 1R58A 3QPHA 4Q5SF 1W36C 1APLC 4FP7A 3KCCA 1U9OA 3BC8A 3WU0A 1AA7A 1IXVA 3G6EI 3SGHA 2OD5A 3FULA 3RZDJ 3L1PA 1BIBA 1AWCB 5JEMA 4WRRA 1Z0XA 3BDDA 5DHSA 2ZXJA 2P9PG 2WXJA 3ZUVB 3AFOA 2HVSA 2Y30A 1TW2A 4CYMD 2RC4A 4HNVA 5C4JJ 4KT5C 4WAFA 4XSXF 2DDAA 3IL2A 3ZQQA 4TUMA 3DBHB 2CG4A 5KJMA 4LRZA 3JW4A 1MSFC 3AL0B 4UXNA 4B89A 1FYLA 3R7QA 2COMA 3SZTA 1TT5B 4G26A 4GU5A 1VQMI 4YFXF 4E4HA 4DY6A 2JJ7A 1JWGA 1JGSA 1VF9A 1SUWA 3BP8A 3HRUA 3CJRB 4BGDA 4W9RA 3SJMA 4RS8A 1W1WE 4EM1A 3LOCA 5FWQA 3K69A 4F7AA 3S14J 2DI3A 3RCOA 1YCSB 4HF0A 2J4BA 4I43A 2KJCA 3PJRA 2RQPA 5AARA 2R92J 2KZVA 1XTAA 2GA1A 3TWXA 1GV5A 3QC1A 3FUMA 1LVKA 1PC2A 3GW2A 5HS7A 4C3JJ 2DFHA 4QWQA 2CH0A 1WJCA 1LTXA 3EETA 2L5QA 5EZHA 2R7FA 3G71I 4WWOA 2WMOA 5C3EJ 1FSHA 2EK5A 1ZN2A 3CQGB 2HKXA 4G7OF 3V8MA 1IUYA 3E32A 1J0RA 5DTDA 3L2QA 3J80Z 5EEHA 5BPPA 4BHCA 3FDHA 1Z0UA 4A3GJ 3CO7C 2CWEA 4Y3OA 1FX7A 2CUEA 3UINC 3FTUA 2F5CA 5AQBA 2V4JC 4AP2A 3VYSB 3ML8A 4AIJA 1HG5A 3HZJA 4KJZA 1TWCJ 3GO5A 5LFAA 3PNYA 3P5JA 1ENHA 4XLFA 4Y7NJ 2J07A 3HXCA 4AIHA 1HKQA 2RKHA 1NA3A 5HODA 4IN3B 4A0YA 2XGXA 3V4GA 3ZQCA 2O5RA 3ASNH 4HAMA 4U95D 2VQCA 4TXRA 3DWLG 1TLHB 4NUBA 3PZ3A 4I99C 2JSPA 3HOVJ 2Y3AA 1UFMA 4I1MA 3PUKA 5HQ8A 1IXSB 3V31A 3CHOA 3GTKJ 3DPTA 3CCRI 3FP3A 5EZGA 1H89C 2K02A 2W48A 3T5PA 1PUFA 2XZDG 3BEEA 4XLPF 1X4PA 4E7ZA 4EGXA 3CTAA 1YJMA 2M0CA 3HGGA 5FLMJ 4EMSA 4G7ZF 2P1RA 3FXMA 4JIWD 5F1JA 2VXDA 3C98A 3I6WA 3L2CA 4BX9A 4G8LA 3Q79A 3FMSA 1NI1A 4HQDA 2A0TA 1U2WA 4OWRB 3A4CA 3GFLA 1D1CA 2GXGA 5EG0A 2GLOA 4BACA 5G04J 4MQVA 4N2SA 1X81A 2G1LA 1I1GA 1J4LA 4NBQA 4WNFA 3GX4X 2XIGA 3FHNA 3Q0WA 1K3ZD 2MRIA 3HIZA 3VB2A 1FTTA 2H1KA 3DLLF 2CW7A 3BG0B 3ONKA 5T8IA 5M3MJ 1Z67A 2EQXA 3JXJA 4LCTA 2CUZA 3AG2H 2GM4A 3CCYA 1V55E 2MYSA 3X2QH 1GV2A 1U0RA 5C4VA 2M7AA 2WXKA 1DP7P 2EWNA 1WQ2A 1JUQA 1MX6A 5GADJ 3FUNA 3DFGA 3FXJA 3ZQFA 2DA3A 3LSIA 2VODA 3ZCOA 1E8WA 1NL4A 1BM9A 3PUBA 2V5QC 1U7FA 2BV6A 2E7XA 2P4WA 5L3GA 3PO8A 2NS8A 5CVJA 4A3DJ 1FP2A 4M9ZA 1WSUA 2CG2A 4NIKA 3H9QA 3MZLB 3UT8A 3ZFWA 3K6GA 3KZIC 2P5KA 3HXLA 3WHCA 3HDDA 3NF1A 4U96D 1ODDA 1UG3A 2BVLA 2ZO4A 1GUUA 4PFPA 5AENA 2IA2A 1ON2A 4UUCA 1UMQA 3L13A 3A77A 1IN5A 1T0FC 5JR3A 2DOEA 4CYCB 3MZHA 2LTPA 4XRSG 4RDUA 3H5RA 3HXFA 1P7IA 5EG0B 1NTCA 3I6UA 4RQIA 1VDYA 4LSZE 2FUG2 4C2MJ 2EIME 5BXUA 3MKYB 1KONA 3SEQA 1OCOE 3ESWB 2QA4I 2LKSA 3R0JA 1N0RA 2XGOA 2ZISA 1SVMA 4GYIA 4XLEA 3HOSA 4GTPA 4AJWA 4N4NB 3FTVA 1Z7UA 5IP6A 3F8CA 2ZBKA 2IS1A 1KYZA 3C72A 1S9HA 3U64A 4LFUA 3S3MA 1TNBA 1OWLA 3ZQ7A 1XG1A 1BR1A 2NS0A 2X6YA 4FJZA 2ZFUA 4XNFA 1U7FB 4BXUA 5F0FA 3ZW3A 4JQFA 1H8AC 5E79C 1BC7C 2EA4A 4RB2C 5E50A 1O4XA 4U0WA 2CV1A 1XMKA 3H35A 4GO1A 3I4NJ 3DSUA 1K79A 3JRDA 3HRMA 1OWNA 3CCVI 5B3SE 2PQRA 4XRMA 1EH6A 4HPQA 3HRTA 1T95A 1T56A 1FIAA 3PFIA 2O9LA 1IV6A 1XGWA 1VQ4I 3UI2A 2CG3A 4XIDA 3KLNA 1V3FA 4F92B 3EJNA 1ZAOA 2A6TA 3KZYA 4HLYA 4OIQF 3EHRA 2BHZA 1Z6TA 4ANJA 1TNTA 4IX7A 4RAGA 1G3TA 5L3DA 4BQNA 3LSTA 4ABZA 3FIWA 3HXEA 4HZFA 3QWLA 2QBYA 4J6IA 1TJFA 4CXFA 1LPQA 5KVRA 4N9IA 4KZCA 1HA8A 2RD0A 3FU5A 1W5TA 3SZ7A 4BHPA 2DT5A 4EZLA 2I2AA 1V5FA 3ZXPA 1JHFA 1ZQ3P 4LITA 4RBOA 3CC4I 2XEVA 2TRTA 3HSRA 2QFCA 1V5EA 4M71A 3WGGA 1JTYA 2PX9A 1LVAA 5GTIC 1Y39A 4MLOA 1VQLI 2E19A 2XHKA 3NQOA 3M1CA 5AN8A 4UWLA 2DU9A 5CHEE 1JE8A 3QARA 1H19A 1UW4B 1O7LA 3OYMA 3UKRG 2KKLA 2KRHA 3NZUA 4A0ZA 4BS9A 2L02A 4HV5A 3QOEA 4BYYA 4LG3A 1B8IA 3CVPA 3DQVC 3EQLF 2WV0A 3M1EA 5HDKA 1FJLA 2E0IA 2AFFA 2WQ6A 1W7PA 3BLYA 5FQ6A 1MGTA 3O4ZA 1N78A 4C3HJ 3HX1A 2HPIA 5FD5A 3SHFA 1H2UA 3SEZA 5GAHJ 2KFUA 2K27A 2GXAA 1SD4A 1OJLA 2JPCA 2VQHA 2XRYA 2P5LC 2FI7A 1IDZA 2Z2SB 2LKPA 1FPPA 5K7HA 3EHNA 4A93J 1LDDA 1VQ8I 1YGSA 3B7UX 2MD5A 4MTEA 2VPLA 1DPRA 3BPXA 4DYRA 3HBLA 1BIAA 2PJRA 1IRFA 5EJHA 2XAGA 3TG5A 1S7AA 3MCXA 4PSWA 3T9KA 2KFDA 3J7YJ 4A3FJ 1IRGA 1W3BA 3GW4A 2ADUA 2QV7A 1Y0NA 1BU9A 2A68F 1G88A 4BWRA 2DA1A 3HPHA 1ELRA 2B0LA 3CIAA 3TW6A 3CCJI 5EILA 2PIEA 1WI9A 3IP4B 5BV1A 4GTSA 2QY7A 2OQGA 3RTRA 3DTIA 2GIVA 4PS8A 3K4MA 1QRYA 3U66A 1HOMA 1LUJB 2HOSA 2XGDA 5KNLA 2JPEA 3KEQA 4OIOF 2XSDC 2Y69E 3KYCB 3PO3J 2KCLA 4K2EA 4LLLA 4XMYA 2BVMA 4BESA 2VSOE 4IHSA 1MH4A 1QYMA 1SVXA 3K4NA 1T0FA 3DSHA 3ZQGA 2QKMB 2E5NA 2MH9A 1MNMC 3FU0A 2EB7A 5JVGF 4O60A 1G2HA 3LSGA 5JJ7A 2X4HA 1J09A 3GXOA 1ZR4A 1S6LA 4YNDA 5M3FJ 3K9TA 1XMAA 3VLEA 1HO8A 2G0EA 3Q0VA 4CRWA 3P9IA 5DV5A 3CZ6A 1JT0A 3RSEG 2PJRB 1FMWA 3IWZA 2ZJQF 4JZYA 4DLOA 4R7LA 1WWXA 3PNLB 4HLLA 3HDXA 2FBIA 2W57A 4BJ6C 3OYNA 2EZKA 5CMYA 2XV4S 2M7BA 4G12A 4L0YB 1VQ6I 1OR7C 4OIRF 1J7KA 3NWTA 2KCKA 1HLVA 4FC8A 2DYSE 2DK5A 3OWTA 2RDPA 1N25A 3LWFA 1JGGA 2K9NA 4IXAA 3FTYA 1DQUA 2WV1A 4AV7A 4EATA 4QQIA 4B8AA 4IRHA 2PQ8A 2E2JJ 2X6JA 2MC3A 4WX9A 4U0SA 1MJ9A 5ILSA 5E3NA 2HYJA 2WPVA 2CSOA 4DBQA 1MZBA 4FJYA 5CCLA 2KQRA 3OR1C 3JSOA 1ELKA 4BKXA 1RW2A 4DUIA 4HAOA 2VBYA 4MTDA 4BE0A 2VKVA 5AIPA 1TC3C 2IEJA 4G8KA 4A1GA 2OOEA 4DJAA 4MS6A 3EU9A 3M07A 5FZQA 3K1PA 5JFRA 1LJ9A 5FKLA 1E0EA 1MH3A 4LIVA 3OIQA 2OV8A 3OOPA 3PUJA 4ACKA 2HPMA 3VZDA 2P9LG 5D0QD 4U8HA 3A01A 4Z68A 3CDLA 4V24A 5A2QZ 3KEZA 2LBFA 1X1DA 4W1UA 5K7ZA 1JPLA 3MDBA 4XR6A 5M5WJ 3E5QA 3FH8A 3L08A 3NOCD 1FCHA 3K4JA 1V55H 3VTXA 5LGUA 5IT9K 2GW1A 3FBIB 4YEJA 5T4YA 1YW7A 4LK0F 1CF7A 1J9IA 4BX8A 1JUMA 4CDGA 3R9MA 5KCMA 1MX4A 4P1WA 1XGMA 4I6GA 3BQYA 2V4HC 5FZSA 2I2CA 4ILGA 4ZH4F 3B7SA 1X2NA 2E1CA 3RO2A 1Y0UA 3G1LA 2EFOA 3V30A 4BH9A 3EUAA 3CUQC 3WTXC 2WB1A 1FZPB 3OXGA 2ZMEC 3BR2A 3CF2A 3ASDA 1X19A 4P9UA 4NB5A 2ETBA 3PZ1A 2IJLA 3E30A 1VFCA 5AQ9A 5IY5E 4RB3C 1RUNA 4A12A 1X4OA 4LB5A 4EJWA 2ZXHA 3LJNA 2BW3A 2R02A 1KT0A 3V8PA 3JQ1A 2R0QC 1DNPA 2R4GA 1YIJI 1A36A 5EJFA 1E2XA 3FUKA 2LBFB 1IAWA 5EYLA 2XAHA 1SW6A 1MQSA 3BUAA 4GA0A 3CVXA 2EIMH 2WXOA 2L7FP 2XPYA 1OCOH 3BCAA 1FPQA 5CERB 3RRNB 2LNBA 1MJBA 4LB6B 2M3AA 3SFXA 3UQ3A 4C9BB 3POAA 1EJ9A 1TTYA 5AONA 3RIRA 2LK2A 3UM3A 3AG3E 1CF7B 3FKIJ 1X1BA 3E0JB 2V9VA 3HSEA 2L9RA 3F22A 2JVHA 4JHRA 3H92A 3AU5A 3CVNA 2LY9A 5FFZA 4YRVA 2M87A 1VQKI 3AS5A 3DBLB 3KYLA 3DEUA 4RLQA 1K3QA 1W36D 1AOYA 3I5UA 4DPRA 4HVBA 1K3JA 5BPIA 4UUSA 3JYSA 2HDCA 4N39A 4MKTA 4JX4A 1N94A 4HG2A 5J8FA 3H5NA 3L6AA 2Y75A 1OT8A 5F1RA 2XS8A 4NRHB 3FUFA 5CECB 5B3SH 1WPKA 2CS3A 1IQUA 2BGCA 1ZARA 4GTTA 5EYPF 3KP7A 2JQ7A 1YG2A 1U3DA 4EJTA 4IHTA 3FMQA 4HS2A 1REPC 3VFZA 1FYMA 1UJ8A 3F72A 2BW3B 4R1HA 2JA5J 2NC9A 4DX2A 1O3QA 3J7AY 4RG9A 2E34A 2XCBA 2EZHA 5IT9Z 3F8BA 5CYVA 3TGOA 1B9MA 3TDUC 4QCJA 3REOA 1KT1A 2AQFA 4OINF 3S3OA 2HEOA 2VSYA 2JWTA 3GZNB 4KYOB 4HOSA 1UCRA 5FTPA 5E20A 1R6RA 3TQNA 1XGOA 1K6OA 3E6BA 3D1NI 1WJBA 2CSWA 4JX5A 2LMDA 3WTSC 3IEGA 1HKSA 5H6RA 1OR7A 2B9SA 2L01A 1DDNA 3HIFA 4N5CA 1OWMA 5LX8A 4RA2A 3L2WA 2E5ZA 1X3UA 3FHZA 2CQQA 2LF8A 1PDNC 2H6HA 5ENTD 1U8RA 3LVRE 2YNQA 1YW8A 4M3BA 1VQ5I 3RJVA 1XN7A 2WAEA 3FXRA 3E34A 4F1SA 1YT5A 2E35A 2AXLA 4J8SA 2X9DA 3BTIA 3FF5A 5IYCJ 3DBSA 4F93B 2RQQA 2X51A 3KP4A 3VOEA 2R93J 2CFZA 4XRSA 5ITZF 2GRMA 2IBDA 2BYVE 2H94A 3C3QA 3JR9A 4A3KJ 3FXLA 4TXQA 2FMYA 3OS1A 2LAHA 4XICA 1RIOH 4ANWA 1LFUP 4JOMA 1ZRCA 4KNYA 4E6HA 4G6QA 2LNIA 3CV0A 1VQOI 1FOWA 3F6OA 1SAUA 1R22A 3HRSA 4GMRA 2F37A 3TGNA 3BR3A 3JCUC 5AYWD 3OTNA 3BCBA 4U0UA 3CVVA 3HUFA 3VA1A 3LA2A 3PE3A 3AJIA 5E3LA 3TWVA 3V42A 4GTOA 1E7UA 2XSJC 3QNKA 1JKPC 4BBSJ 2KIFA 4RMNA 2NNYA 2R7UA 4X8QA 3AL0C 1UHSA 3OYCA 3GZ6A 3ONQA 2DMPA 3GMEA 3DSTA 3G2VA 2RKKA 1YFHA 3OR2C 4EZKA 1R36A 3KIOA 3CUQA 4A2UA 4OVUA 1W7PD 2DTRA 4KA4A 1XGSA 2Y0MA 2Q0OA 5HLIA 2HQNA 2DZNA 2QKLB 2A69F 2IA0A 3WTUC 2LO6A 1HU3A 2JT1A 2Y69H 4KITB 3FTZA 2FXAA 1OUVA 3C5RA 2FOKA 4XLNF 3LJ3A 4BSXA 2EILH 3E5UA 1K8KG 1IYGA 3M8FA 1D0YA 4BY7J 3HG0D 2YSRA 3KP5A 1E17A 2KJBA 2XGEA 3OL4A 2X6IA 1MJAA 3TMOA 3W2AA 4LOCA 3Q78A 3M3YJ 2UWJG 2PQNA 1TNYA 5JEOA 3WGIA 2DA7A 4Q48A 2IEKA 3CLOA 2MW8A 3HB9A 3LSRA 2WXQA 3DEOA 1ZELA 2V1UA 5K1YA 1J4KA 3LAPA 1LF8A 1IN6A 4CZCA 1H0MA 3S7FA 3UMVA 4BSZB 4HRLA 2I2FA 5J47A 1N11A 5CKTA 5FFXA 1MZKA 3VPYA 2X6WA 1SFEA 5GTHC 1EDUA 4QPQA 4F7ZA 3OS0A 3TW7A 4CT4A 3QWVA 1JUPA 4GA1A 4Y6WA 4XN0A 1K6YA 1O57A 5LEKA 4JONA 4G2SA 1TJCA 1V5GA 2LREA 2DYSH 4N3BA 1R5ID 3EUVA 2L0TB 3S15J 3UNGC 3CUQB 2Y2ZA 4A3EJ 5BS6A 1N77A 4E6KG 5CVRA 4I7HA 4IOAF 2W4SA 3DU6A 2NVXJ 4JX6A 2OBPA 1W0UA 3SFYA 2KB3A 3RI4A 3QOUA 4MFDA 3BG5A 5FO5A 4ESBA 5B5EC 4HF1A 2M0MA 2V6CA 4I1OB 4OAVB 1UJJA 3R60A 3WE2A 3PNVA 3S17J 5ANLA 3ZN3A 4HFGA 5H2FC 4PS3A 3GTLJ 2AXVA 5CEDB 1ETXA 3PH0C 4G25A 4F1PA 1EA3A 1JUSA 2Q1ZB 4PUSA 3JSPA 5FRNA 2GXBA 3CKBA 1JI8A 2X0LA 3RJPA 2LOOA 3SFIA 2M30A 3B02A 3KETA 2CYYA 3KLOA 5FLXK 3MKLA 2R5YA 2A61A 3ML9A 1S70B 4AOFA 3HEFA 2BY1A 1PJRA 1O1RA 2V0PA 4QFVA 1HXDA 1O3TA 5BNWA 4RB1A 2HOAA 2VGYA 3LY7A 3LS8A 3OYHA 2MBFA 3RKYA 5JLXA 2K9QA 4OVVA 1BOAA 1LFPA 4DGWB 3OYGA 4A3LJ 1VNDA 2ICWG 3UT4A 5HLHA 4W97A 1MYOA 3OOUA 4ZDLA 2ZU6B 3FY4A 1BI3A 4KYWA 2DODA 2IP2A 4U0YA 1OQYA 3IBEA 3BG3A 2NXNB 4M6YA 4CYDA 2HOEA 4EPZA 2VGXA 2OTJI 3ZKJA 3GYHX 2BE5F 4V3IA 5D8KB 1F43A 3IKOB 4CZ2D 1RC9A 3FEXA 2HVQA 3ISMC 4BNCA 1BL0A 3ENEA 3D9PA 3VZCA 3C18A 5BXOA 3JTHA 3JREA 2P9UG 3E7LA 3OXFA 3EIJA 3J7AO 3WXXA 3QP6A 3UT7A 5A8IA 4CCAA 1SD5A 3TOBA 2V26A 2W85A 4CO8A 2BXYA 3I4RB 5J08A 5CVUA 1MDMA 3IKTA 3U9WA 2NRAC 3V8KA 4C2TA 1OY3D 4OMZA 4UVBA 5KK1A 2M4KA 4B93B 1IDYA 1JXSA 2MLGA 5HOOA 2TCTA 2M4GA 3EU5A 2ZXWE 1RNLA 1JHHA 1B72A 4J00A 2KATA 2PG4A 1SANA 3AG3H 4XK4A 2DMNA 5JI6A 4D10C 4AWXB 1L3LA 2HQAA 1BA5A 2XPZA 3PEVB 2QSHX 1TWAJ 5LGNA 2FBHA 2HTSA 3OIPA 4KUMA 3ELSA 3T0YA 2STWA 5C2YA 5J1YA 3CVYA 2QQ9A 4WK8F 3UTMA 3D0SA 1GLNA 1H88C 1G4DA 2O61A 3FK6A 3DPYA 4B4CA 2VGXB 2YHEA 3F9KA 3PM1A 1TNUA 2VOOA 5FLXZ 1K2MA 1ULYA 1B6AA 1L0OC 2V9PA 1USTA 2RAEA 1K1BA 3LL7A 4WNGA 4B44A 1XDSA 2PMUA 2L9VA 4Y17A 2ISZA 3CC7I 1TP4A 3V80A 2DFIA 1QZYA 3GTMJ 2BY3A 3PSIA 1R9TJ 2X1DA 1VQPI 1MDMB 3KD7A 3HRAA 2DTZA 3Q9VA 3RPUA 3D5LA 2HS5A 3OS2A 4G1TA 3S2DJ 1K1AA 3KSLA 1GXQA 2V7FA 1HDDC 1J2XA 3PL8A 1B72B 2KZGA 4FE7A 3OY9A 2R59A 4RGRA 5CQGA 2VJ4A 4CCOA 3G4SI 4GDFA 3D5SC 1BOBA 2XAJA 3ISPA 5HLTA 4QPOA 1Y8MA 3ULEG 4U7DA 4HX7A 2K4JA 4LNGA 3PIPF 4I9CA 3BR1A 1VQ9I 4XE0A 5DHRA 3RYPA 3BG6A 3C2HA 5JMND 2VE9A 1UOHA 3TBIA 4G9YA 4KXKB 3L2RA 1BJAA 2KIMA 3FUIA 4BDZA 4L0ZB 4EJUA 4DZPA 5HDNA 4WNEA 5J1RA 1OMIA 4C9YA 2DT6A 3L7WA 3MEXA 2VQGA 1ZRDA 1W5SA 1UHMA 2PM6A 1O7FA 4HX8A 3CSFA 5KNHD 2OVBA 1Q2ZA 4B8CB 1IZ1A 1G3YA 2RNJA 4HQMA 4A69C 3BROA 4I17A 3PREA 2H6FA 2JA6J 2W00A 3C1DA 4O1PA 1LEBA 4OAZA 3S1RJ 4PK4A 2BF0X 4CEMA 4EZJA 1K83J 3VLDA 2WTEA 2UXXA 2I5UA 5J6XA 3OL3A 4I01A 3RK6A 3GTQJ 2R3SA 3U21A 1R49A 2WXIA 2XQ0A 3MV2B 3I0NA 4G7HF 2R2LA 4YDWA 2WWYA 3HC7A 3PZ4A 4S04A 2R7DA 3O3KA 1WI3A 3NEUA 3FH7A 1CGPA 3BJ6A 1VTNC 3D9LA 4E7JA 1T38A 4K5BA 2WADA 3QPSA 4Y13A 1OYWA 1T2KA 1FT9A 2CW8A 5FGMA 4BQQA 3I58A 3V7SA 1WJAA 1QHGA 2YU9J 2OZ6A 3D9OA 4NACA 4HQEA 4PJNA 4XLHA 1O3SA 3KP6A 4DQ2A 1E8ZA 4EJVA 1QVUA 3D5RC 3IWFA 4FU3A 5FJYA 2JQJA 4FQGA 3DLAA 1RESA 4M6VA 3IHUA 2P0WA 3RIBA 2FQ4A 1R23A 2IVMA 4X6AJ 5FQ7A 2UWMA 4OOIA 3OYEA 2BRFA 1J4OA 2M8GX 5DUIA 2ZGGA 4UV9A 1WG0A 1NP7A 2GGFA 2ELKA 2KDZA 2F4MB 3L17A 5EKQD 3UR3C 4CYCA 3ONLA 4F53A 2ETHA 2VT3A 5CLSA 4XX5A 3CK9A 1KU9A 1LDKB 5EDSA 4J8EA 2OCCH 4MO7A 4B43A 4S05A 3GFJA 4N0BA 4JPSA 3OYFA 2YINA 5EX3A 5LRSA 2E2IJ 1DCQA 4K0RA 5BV0A 2EINE 2Y0SA 3LFUA 5J90A 4CGWA 3E97A 3LA7A 3S93A 2BKKB 5CPRB 4KIBA 2CQNA 1PUEE 3ULQA 2YUSA 1SAXA 4RG6A 4M9XA 1XCBA 3QAQA 2XEHA 5EEAA 3QWPA 2IJGX 2KRFA 3E3VA 3NQPA 3TKYA 4E7KA 2V1XA 2I10A 4GZ3A 2IGMA 2K9MA 2ETAA 3NBNB 2L3DA 2I2OA 4D5FA 3AS8A 2QVOA 3ZMVA 4ZYGA 3HTUA 3P9CA 2OV7A 3VYTB 3LPZA 1HXIA 3ABKE 4Y15A 3I55I 3ZGKA 1N95A 1ERDA 1V54E 1LNWA 1BR4A 1BI1A 1WJEA 2GZWA 3HJEA 4M72A 4CCLA 2HFHA 3GTOJ 2GA2A 2DYRE 1FEXA 4CCJA 1Z7LA 5BNGA 1YJNI 5BW8C 2R7ZJ 1OYYA 2ELJA 3I3LA 3QODA 1K2NA 1LE8A 4WUYA 3UUXA 2XUBA 1RKTA 3FUHA 3PE4A 1WDYA 2CO5A 4U04A 5FIOA 1PYVA 3VSLA 4KMUX 4A5MA 5L3BA 2A6EF 5CJ9A 5FKMA 4WWPA 4NC8A 3FXQA 3H0GJ 4OAYA 1G59A 2EQRA 3ZU7B 2M45A 2ELHA 2EH3A 4F55A 2KBXA 3Q3SA 2DQRA 3V8JA 4WXDA 2OEWA 3CP8A 4BT9A 5FQ4A 4MFEA 4DX7D 1IO2A 1BW6A 1K61A 2VJ5A 3CSTA 2WC2A 1IUFA 5DCMA 2Y31A 3ULQB 5M5XJ 1E3HA 1B9NA 1O1TA 5F04A 1U0TA 5DHUA 1Z05A 1OKRA 1KQ0A 3FM5A 3Q49B 3ELVA 4IF4A 3M7GA 3BPVA 2WXGA 1LDJA 5HRYA 2O8KA 4BJ5C 1T39A 5DUKA 2EA2A 2K40A 4N3AA 1BBYA 4DX5D 1DU6A 1R71A 2E7WA 2HQRA 3D9IA 4N5QA 4PJLA 4GAAA 4A5NA 2XZTG 1XS9A 3NZSA 1HS6A 4IHVA 4IL6C 2HR2A 1ETKA 3E4BA 4KVOA 2EIKE 3U3WA 2KKOA 2NVUB 5EN5D 4M74A 3S7JA 2I9CA 1DU0A 2FEZA 4GTMA 5FQ8A 1TBXA 1Z91A 3G1OA 1LE8B 2JPBA 5HDGA 3T8RA 3IHYA 3QP5A 1KHXA 2IY0C 1A6QA 3QDNA 2ZC2A 1ZG3A 1BD8A 1MBEA 1S0PA 1U2VG 3ASHA 3UOTA 3Q7AA 3OUNA 5M5YJ 5CBNA 3IUOA 2Z99A 5LHGA 1X1AA 1YX3A 3HKZA 2CGPA 1B89A 3B95A 4NDLA 1B1BA 3KE2A 2JA7J 4L1BA 3TWSA 3IAS2 3SYTA 2R7XA 1DUXC 4KVMA 3K10A 4OU0A 5DCMB 3CDHA 2R7VA 3Q73A 3K4CA 4UI9K 2ZXWH 4HRIA 1BI8B 3DITA 3FKJA 2MD0A 2VN2A 3DPUA 1U78A 2X38A 4HOQA 4UI9C 1FIPA 5EGOB 4C0MA 1PP7U 3OAWA 3ABUA 3VEPA 2QM3A 1YS6A 3OYLA 5ARFA 3ABME 4J0UA 3ZNGA 4ASNA 2KISA 2CFOA 3AG4E 2OC6A 2DCPA 2VC0A 2DDBA 2OF7A 2VI6A 3R4KA 3BU8A 3C2GA 5HI7A 1A04A 4ACLA 2JUGA 2L0KA 2M1BA 3DTKA 3DRAA 2EV6A 2I6HA 4XRFA 3T8TA 2DA4A 5TGTA 3ERMA 4J01A 3IC7A 4MEXF 2KPMA 2L7MP 5TJJA 3WTTC 3DEWA 1PVEA 1MX2A 2ACJA 2QYUA 2JEKA 4L9PA 4ZJZA 4JVSA 4JHKA 2HKOA 3WE3A 1R1UA 4AU7A 1A6IA 4FHTA 3M4OJ 3ZYMA 2VTBA 2E36A 1YMPA 3FISA 3RQ4A 3FU3A 2JKDA 4M3DA 3KYDB 2STTA 2TDXA 2LSUA 2ZJ2A 4M73A 3GZSA 1OLTA 1ZYRF 2RREA 3A1YA 4MRUA 1MJ0A 2JA2A 4J7WA 1LEAA 2ILRA 3KEYA 1TQMA 3TP0A 1SFXA 2O6GE 1IQRA 1O1SA 1KQ9A 2VLAA 2WY8Q 1RR8C 1R1TA 2HE0A 1TQPA 3S1NJ 4XQFA 2HM8A 2FO1E 1XC5A 1GVJA 2EFQA 4BQOA 3PIOF 5TRDA 4I6EA 2VXZA 4PDXA 5EDNA 4PJMA 2QSFX 3CCSI 4YIIA 4I98B 4WXHA 2DAOA 5J4VA 2WXPA 1XSDA 4HOUA 3V8NA 3EPZA 3ROUA 1JKRC 2FNPA 4GZCA 3H9JA 4U8VD 3GEZA 4MIMA 1MNDA 2OZUA 3I71A 5FRMA 4C48B 2QF7A 1ACIA 3CMYA 4HI8A 1WJ5A 2MG4A 2EIJE 5EIBE 3SDBA 2Q5FA 1BI0A 3OV8A 3L9FA 1QBQA 2EFWA 3AG1E 2N8GA 4NC7A 3C3WA 3W2VA 4KDPA 3I4PA 4AYBA 2BBYA 1IXCA 3M8EA 4EJOA 3L16A 2JVGA 3SQVA 1P9QC 1LQ1A 2Z3YA 2XAFA 3ELKA 5D6FA 2IXSA 1YX5A 2BKGA 2VTBB 1MK2A 1QA6A 2RVCA 1UZCA 3VODA 2LAIA 1NZNA 1DP3A 2PI0A 2CFUA 1IHBA 3RZOJ 5FLVA 2GRPB 4II2A 4QSHA 2MA3A 2K3FA 4O1OA 4IJAA 3R9AB 2ZSHB 5B1AE 2NAZA 2PFBA 4UQXA 3ZMUA 2R7RA 5CRUA 2R7TA 4A3IJ 3FXOA 2DA6A 2WMNA 5BQTA 2FNAA 4LD5A 2DPDA 4M7CA 4XORA 4FA6A 4BE1A 2H6CA 2KB4A 5EJIA 4L23A 2FMLA 4GFBA 1SFUA 2X6OA 1D1AA 3U2RA 1E7VA 1TN6A 4ZFHA 2Z5UA 1OYIA 3BZ6A 1IRZA 1Y1VJ 1Z0ZA 1D1BA 2LSOA 3V2XA 1UN9A 2CUJA 4RLFA 1O5MA 4GPKA 5JEKA 4B1RA 4GXOA 3VA4A 3LVQE 2I2DA 2ZIRA 2F8YA 3ESLA 2KHMA 5D4RA 3GFIA 2L4AA 1FSEA 3BZKA 1X3WB 4HYEA 3QK0A 1PAQA 3LSPA 4G24A 3KP3A 3RDIA 5HNFA 1Z5SC 2DIWA 2OEVA 2L6BA 3IAM2 4FISA 4ATGA 3SNXA 1MKMA 2CW0F 4C3IJ 4IOCF 5BOXA 4E70A 3GQSA 3F6VA 4A4YA 4TV7A 4B09A 4UV8A 4AD9A 1A35A 3FEYA 3QQAA 3P7NA 3V7WA 3ZIMA 1RR7A 2DMQA 3HXBA 4LGWA 4XKWA 1UHWA 4N2QA 2NVYJ 5ICFA 4PCQA 4AEZC 2A5UA 3FK7A 1FOXA 1S29A 2A5WA 2EINH 3BTCA 3ZMZA 4M3GA 4K5CA 1SMYF 1YLFA 4WCGA 1HG2A 2FA5A 2WAQA 3SFZA 2XB0X 3CCMI 3C2BA 3K1MA 3FWVA 3RKVA 1BN5A 1SVLA 2GBYA 4B8XA 3PSFA 3TO7A 1GHCA 3E33A 2R7QA 4L9TA 5CMWA 3BG7A 2M63A 4L5EA 4A0XA 5DD8A 2P2CP 1AP7A 1R4MB 4R8HA 5FKKA 2J4DA 3DEEA 4YG2F 2KXPC 3GVAA 3R0AA 3ABKH 3I53A 3ASFA 3U1KA 3ZOBA 1V54H 2F5VA 3PFYA 2P6TA 4JB8P 2X3MA 2DYRH 1X1CA 2Z33A 1D8KA 5KWDA 3CCLI 5FROA 1X58A 3HGYA 2M9HA 3WTYC 2CHWA 2NS7A 2KP6A 1B4AA 5EEGA 2AJAA 1FC3A 2ID6A 3NRVA 3DSXA 2NOGA 4L2LA 3SI5A 5D2MC 2W7NA 5DHTA 4AUXA 1H0AA 5JVTA 4MHGA 1EH7A 2IPQX 2JTVA 4LLNA 1I39A 3HHHA 3UM0A 3L2VA 2Q8KA 2QSGX 3V8LA 3WODF 3JRFA 5F0HA 3V7CA 3VLFA 2EFNA 4GZDA 1WJDA 4RVBA 1TQIA 5ANRA 4JW1A 4WWCA 3S16J 3SDGA 1KPSB 2VBXA 4G94A 5EX0A 2O7OA 3CEQA 1F36A 4L02A 4N4OB 4JA9A 1WKMA 5FJ8J 2AQEA 1HDPA 5HLGA 4KFCA 2VL8A 1RRJA 1HSJA 1VZ0A 5EJGA 4DZJA 1ETYA 1ZLKA 4WXCA 1GW6A 1SZ9A 2EIKH 5EF6A 5D8LB 4HRMB 4V2GA 4I6JA 3ZHEA 4KMFA 1MZCA 1E8XA 3KT9A 2VT2A 2LH9A 2A5YB 3MFKA 2CRGA 5J40A 1S7OA 2GRLA 1V4RA 3CD6I 4ZTJA 2Q7FA 3S7DA 2K85A 3O8GA 4ME2A 3V79K 4WF2A 3ZYLA 3V8RA 3S2AA 2F5EA 5KJNA 4U63A 4JL0A 1PP8F 3GZ2A 4U0ZA 2QENA 1MBKA 4HSTA 2JGRA 3TWUA 2ZNZA 3H3VK 3S40A 2HU9A 3PUFA 4BEPA 4BTBA 2W24A 3H5AA 1XPXA 3L82A 2LF7A 2ZKZA 4OAUC 3KP2A 3F3XA 1UHTA 1NFIE 3IH4A 1N4QA 2KL4A 5L3EA 2NVTJ 3ZRHA 2VOPA 1Z21A 5JLWA 3ABLE 1S3JA 2MC4A 4RAYA 1EKEA 5LD2C 4NQWB 1D5VA 5E1ZB 2QUFA 3ABMH 2R7SA 3QJZA 4KBQA 1Y3IA 2DA5A 2H8WA 2CV0A 3AG4H 3FX3A 2V6EA 3GMJA 2NSZA 3SF4A 2FE3A 2HYZA 1N75A 3DPDA 3SZPA 5BUZA 4RAZA 3KSQA 4AIFA 5LHHA 3OYJA 3HOYJ 3DSSA 2FBKA 4M9SA 4O3MA 3ZHEB 3LY9A 2ZB9A 3QYEA 4GYGA 3UPVA 4HBDA 4XOTA 2A05A 2H27A 4UI9J 1BR2A 3K2AA 4KN7X 4G8XA 5AJDA 2XDVA 1KZOA 4DK5A 2EZIA 3I0MA 1W4MA 1XMXA 3DV8A 1ZREA 4PUCA 2I29A 2YPRA 1EPUA 4IHYA 2IS4A 3N05A 9ANTA 4AY5A 4R9PA 3VZBA 1P92A 1FOKA 2YR2A 1QPIA 5IP7J 1D3YA 4HSRA 4IQJA 3UKGA 4UQZA 5JHFA 2WM9A 2X1EA 2W82A 3MEKA 4DIQA 3E6CC 1MBJA 3PS6A 2X85A 1K3NA 1USSA 2Z16A 1QNTA 3MWMA 1KGSA 5JHUA 1T98A 3RPQA 4ZYDA 1BPOA 3G2SA 3JQ0A 3KS2A 1ETQA 1LGPA 2CMPA 3CHPA 3COAC 1P5QA 3AU4A 4V19K 2ME6A 2B7EA 2IOLA 4AM3A 3OYDA 2B6CA 5F0CA 3NAUA 5K5RA 3WU1B 4H4KC 4UUVA 1VQNI 1H6KA 1WAO1 1LFBA 1H9GA 2F5DA 3LQQA 2EIJH 2AS5F 4BDYA 2IQCA 3A0HC 3D3MA 2NYJA 3AG1H 4Y6CA 4BE2A 2HXOA 5D5UB 3OYBA 3S7BA 5KHDA 2J08A 1R7JA 2GRQB 1MHQA 3HTSB 2V4LA 2VIXA 1WY6A 3MMYB 4EM2A 5FKOA 3HVEB 3ULYA 4CT0A 3B6CA 3W9GA 3HUEA 4BL0B 4K03A 2EZLA 3PO2J 1YYVA 2Y0SN 3F8MA 5EJCA 1TEZA 3ASGA 2OPTA 4JA7A 3MKRA 4GMJA 1Y8QB 4ANVA 4R79A 3FM8A 2WXHA 4QIWN 2BEDA 2DLLA 3JAMK 3CCUI 5DS9A 5B1AH 3GF2A 3GZ1A 1MBHA 4J8DA 3S8PA 3UM2A 2PBIA 2WXLA 3TWTA 2O3FA 2CHXA 1QWTA 2W1OA 3OXLA 1X1PA 2E1OA 4JYKA 4Y4RA 2XRLA 2IS2A 1N0QA 3LY8A 2OCEA 4IVNA 1NHAA 3LSKA 3NOGD 4FADA 4HOBA 1UN8A 3K9IA 1R5HA 1UAAA 4A3VA 3P1UA 1F4KA 4IO9F 3TO9A 1JJ6C 3TOAA 1ZHFA 3BWGA 5HS9A 1OXJA 3FH5A 3LXUX 4XN3A 3CR3A 1S72I 1U8BA 4E7IA 4B3AA 4G23A 4YFKF 1KHUA 3X2QE 4IULA 3UNMA 4EQQA 2XROA 2PJPA 3WTWC 1H2VC 1X5BA 2LR8A 2Z9OA 3KEAA 2XPWA 3MA5A 2K7LA 2VASA 2YX4A 1ZLJA 2WXRA 3OSGA 4L7TA 4XBFA 3TXMA 1DD1A 2QWWA 3HL2A 4ZDOA 1Y8RB 3OSFA 4BERA 3FUDA 2D1HA 2OTLI 4X1EA 4D1QA 4GTVA 2FULA 4IRGA 2LD5A 4B0ZA 3K1NA 1GVDA 1NG6A 3PNTA 3Q9SA 3BJAA 4XLCA 3O2PE 2HDWA 1I6HJ 1P4XA 3CLJA 2LFBA 2J9QA 1TNSA 2HO1A 4PH4B 2XPIA 3LSMA 4ZYAA 3TXNA 2XT9B 1MBFA 1TT0A 2CJJA 4GZ5A 2EPFA 3IRQA 2AVPA 5DCFA 1QQIA 2KZTA 3DEPA 4G2VA 3ZEFA 1MJSA 3LSHA 3NWSA 4BFRA 1N4RA 2PM7A 4CCMA 3CESA 3RSNA 1G3SA 4GRIA 3W6JB 5GAGJ 1DVPA 3U1DA 3N71A 1BI7B 3BQZA 2WY7Q 3HXDA 1L5JA 2C0LA 2PN6A 2ONDA 2DXIA 2HYFA 2CUFA 5M72A 5E76A 4CGZA 2JLBA 2JMWA 3KEOA 1LKXA 1RI7A 2VQLA 1R4NB 1HW1A 3JAMZ 4L9VA 3CJNA 3H36A 3K70C 1FLIA 3MJWA 5IY5H 2DMUA 1LB2A 2Y9ZA 3TJPA 2PLYA 3HKZN 1MNEA 3F23A 3N97A 4UVAA 2FSWA 5D6EA 2FBNA 2J49A 2CQKA 4XOPA 4HNUA 3L22A 2RNGA 5B66C 3LQRA 1QVTA 5AAOA 4CDNA 4II3A 1YJWI 1AU7A 3TG4A 4UHTA 4XKVA 4HF2A 2PNNA 4HDVA 2AHQA 3PNTB 2MABA 2VJJA 4FX4A 3CF5F 1AKHA 1U7VA 4I09A 1F1ZA 2P5VA 1WM5A 3DKXA 4AIKA 3CHRA 4G11A 1ON1A 4A6DA 2F8XK 4ITVA 2DBBA 4QLCU 2KZTB 1J2FA 5DHQA 3I3NA 5ICGA 3Q75A 2XRZA 5HS8A 3QYFA 1SC7A 2W3OA 2XKPA 2XRNA 4RB0A 2DZOA 1IRXA 1QQEA 3U4TA 4G6TB 3DKWA 2BUGA 2GWRA 4LUNU 4JIVD 3UNNA 2H8RA 2BONA 1IXRC 5D66A 2BZTA 4I6ZA 4HORA 2XKOA 2W25A 4N9HA 4DOZA 5J8CA 2ZNYA 1Z6RA 2JK3A 2IGNA 1RKWA 4XKCA 4JBAA 5IPAA 3W6VA 1N54A 3LMMA 3FFLA 2DWZA 1YJ5C 2LC2A 1NA0A 1XX5A 4D7NA 2Z1DA 2BOLA 1POGA 4E7HA 1YA0A 4I2ZA 1EV7A 3JRIA 2GOMA 1FOYA 3JRGA 1IN7A 1I1SA 1XNFA 1G3WA 3HOWJ 4M3FA 1AKHB 1U7VB 4JEUA 5D5VB 1I27A 2QQ8A 3CO6C 3MN2A 4HW0A 3EUKL 1FYKA 1B59A 2LXLA 3MYVA 1KYWA 4YIFA 3TO6A 2ECCA 5H20A 4A3JJ 2L4MA 3K4BA 5DM7F 1HBXG 3PDNA 3BOQA 3R6SA 3VYRB 3ABLH 1VQ7I 3BQOA 5FB2A 1ZH5A 3CKCA 3LNQA 4N3CA 1TWHJ 3CK7A 1UB9A 5ENOD 1NG7A 4F3VA 3DWLE 2I1KA 3TWRA 1KU3A 1FBQA 5AIQA 4CGVA 4AYBN 1H6PA 5HKPA 4EM0B 2M8EA 2R7OA 2ID3A 2RN7A 4UQYA 4XKBA 5E8GA 5T3RA 5CQEA 1P4AA 4H0EA 3GWZA 5F27A 2AXZA 2K9SA 3WTZA 2AXUA 4HLEA 2FQ3A 1FY7A 4ENJA 3LYAA 2XPVA 3MX3A 5CEAA 2CFXA 3ZR8X 3L00A 1F9NA 1G6GA 2AXTC 5ARGA 4ABNA 2HNHA 2DN0A 3LA3A 1FVHA 1R5GA 2HI3A 1E90A 3H9GA 3F8FA 3HG9A 2DMTA 3BT9A 4I2WA 3J81K 4F52A 2XASA 3BTLA 3V7RA 4P5OA 4MGRA 4BY1J 2BEOA 2OQRA 1SQMA 5FKNA 5K5QA 2DO7A 4MLPA 5L3FA 4MNUA 3ZXSA 3E6MA 3BY6A 5TISC 4XI9A 3ZGQA 2L54A 3K7AJ 4RSYA 4FETA 3W9FA 2EV0A 3I4MJ 4Z6YA 3L09A 4UVCA 1YITI 4EHMA 1UJXA 1FWZA 2B0OE 3WU2C 2XEEA 1HW5A 4I9EA 4ANUA 1H9TA 2M5WA 1QHHD 4I0BA 3PFNA 3QU3A 3W6KB 4GCNA 3W2WA 2I1WA 1YOVB 1K7AA 4B48A 4EGZA 3CJTB 3QRFF 3A2KA 3P2BA 4ZC3A 3PRZA 2VYIA 1OCPA 2VC1A 1N4PA 4XZ4A 5E8IA 2J5OA 2VBZA 5AQAA 3B6AA 3GBGA 2V79A 1ETVA 1ZG5A 4CDMA 2G7UA 2VE8A 5E1XA 3OYIA 3SXYA 3APDA 3J7ZI 1WH7A 4FHJA 4BTAA 3M8JA 4XIFA 4I2OA 4A0EA 1Y56A 2HYGD 3CGHA 3ASOE 3UV0A 1UJKA 3SBTB 1GDTA 2P9SG 5IYBJ 2AWIA 4O5VA 3NB2A 4YVQC 3LAJA 2WAQN 1HX8A 1S8NA 2K3PA 3FZVA 4ESFA 4E7LA 5IYDJ 3ZRGA 1D8JA 2PMHA 3IKVA 3CCEI 1AHDP 2AN1A 5JA4D 1X3ZB 2XGSA 1I5ZA 1IG7A 2L7KA 1MR1A 2KMUA 1U5TC 2LSVA 1ZKGA 4S0HB 2DFFA 5CRVA 5E75A 2CQ7A 3QWWA 2WB1N 1OPCA 3Q0UA 1STZA 4KN4X 3G73A 1KU7A 1DGWY 4HNAD 5E18F 1QZEA 4IZZA 1JCRA 3J5PA 2V9KA 1WLNA 4A3CJ 2YHCA 3IH2A 2H6GA 4X0GA 3HYMB 1SD7A 2JA8J 4U07A 1OFCX 2QCOA 4CH7A 2BXZA 4ENKA 3J81Z 3K0LA 1F5TA 4CUGA 3GZ5A 2ZJRF 4P29A 3ZYQA 3DSVA 2R5ZA 4AIDA 3ZMTA 3UXGA 1TN8A 4IPAA 2E71A 4UY8I 3S3NA 3URZA 2F6CA 2AW6A 1TR4A 4V2FA 4Q4ZF 3PQKA 5ICCA 3K4LA 1YHQI 1SA5A 3FTWA 4ANXA 1QU5A 2PMZA 4KISA 3F21A 2LVSA 3H3UA 2RGVA 2ECBA 5F64A 1XSVA 4ETSA 5HVQC 1O3RA 1SMTA 2FJ1A 1G8XA 4TV3A 1D9SA 5K5OA 2Y4UA 5BVIA 5JEJA 2EH0A 3Q47B 1PUFB 4UUTA 1TNZA 1QBJA 3MQ0A 3CP2A 3WG9A 4XSZF 4C0EA 2FRHA 4DNCA 4UB6C 2IA1A 1ELWA 2HWVA 2JABA 2NXPA 5EGOA 4KZ0A 4DLQA 5E3MA 4FTHA 2WAFA 2HZTA 2DW4A 4UWFA 3RRMB 1KU2A 1LGQA 1KZHA 4GYOA 3WG7E 3EUHC 3MD2A 3DP7A 3IV5A 2LKXA 4EBAG 2JRMA 1TWFJ 2OAZA 2QGUA 4DI3A 3J5QB 3CCQI 3B7BA 1A5EA 3CQZJ 5JHBA 1ZG1A 1YTYA 4L9JA 3W3CA 3G2WA 4LG6A 4EQFA 1T33A 2I1JA 4UWGA 3EYIA 4ZHBA 4DBRA 2R5ZB 3B7RL 2RFMA 2F0YA 2IT0A 2VSNA 5J1UA 3BR6A 3SQNA 4JP0A 4ZZLA 2VPRA 2MYOA 4PDKA 3MZ8A 1ZGAA 3TDZC 2HR3A 5KBAA 4U7BA 1ZU2A 2XF6A 1E96B 2R03A 1I3AA 3C3RA 5KJLA 5LOZA 1IJWC 2L2OA 1WZ2A 1KLXA 2J8SD 3CVQA 2NYXA 4YIRX 1HQCA 2UY1A 2GRRB 3TL5A 2JN6A 1Z3YA 4FCYA 5F6FA 2A3SA 1R00A 1IW7F 2I2BA 3BZCA 3HYIA 3RQIA 5AIJA 1JT6A 2ZCWA 2E1MC 3U9GA 1OWOA 1S63A 2HTJA 4C2UA 1U3CA 4TXPA 1RETA 4WERA 4RGXA 1ZTRA 4FT8A 1T6SA 1HH8A 2L6JA 2UXNA 3CC2I 2RFAA 3IRRA 4ESJA 3CHQA 5ILVA 3GLXA 3L54A 3Q4AB 4YDYA 5G2NA 3LEWA 2JQLA 3OIOA 5DM6F 2GROB 4YVOA 3FUJA 3EHMA 4FHKA 1ZB1A 1SFKA 3DCFA 1OWPA 4HXIA 2O0YA 4E7SA 1M1EB 4CICA 2GRNB 3CK8A 1ONVA 2HDDA 1FT2A 1WJFA 1E3PA 1FBSA 1SVOA 1MBGA 4CA0A 4BQAA 1DEVA 1H2TC 4XLAA 5LRRA 3Q9UC 4LJZF 5ENQD 2GQQA 1JCSA 3SBSA 2QC9A 3FU6A 2YQ8A 3K4KA 3LFKA 4YFNF 3S2HJ 1QU3A 1QZ2A 1INZA 1T08B 2UY1B 4O6FA 5ENRD 4HRNA 1TL8A 1IC8A 1QPMA 2P9NG 4UNOA 2VGEA 2XGMA 5ENPD 4DX1A 3PZ2A 1ETWA 2XF5A 4F91B 1U5TA 1IKND 2ZFWA 4C30A 3T1BA 3ZMSA 4G6DA 4ZTFA 1K4SA 4IKFA 2H09A 4J8FA 4ATZD 3ZQIA 4BAYA 1ORKA 1YQAA 4EVIA 1TNOA 3IXEA 1SA4A 2LP0A 2P58C 3NARA 4IYPA 4ENNA 4A1SA 1JKOC 1PY1A 5D4SA 3AAAC 4H87A 2QBYB 2JSCA 3QKYA 3HHGA 5IT3A 5GAEJ 4GA2A 2Y4TA 3DPLC 5DD4A 1U3EM 1A31A 2XHEA 3EIQC 4PJJA 3MV3B 3ZP5A 2FF4A 1RUOA 1ZR2A 4IHXA 5F08A 1T8IA 5KJKA 1P6RA 2LY1A 1SEUA 3CHSA 1R1VA 1YO5C 4Z2YA 3RPUD 4ZDPA 3ERED 5JHAA 1HSTA 5GP9A 3F6QA 4LIUA 1IN8A 5HS0A 3QAHA 5A2QK 2OU2A 2ESNA 3MKQA 1UG0A 4F6RD 3I4GA 1G3NB 2DFEA 2X6XA 2DVWA 2RG8A 1B8IB 1GXPA 4U7EB 4XM3A 1FHQA 3CQCB 3IH3A 2EILE 1W7PB 1U5TB 1WVRA 4PJ0C 4BJTA 3GLLA 3JRAA 3JRCA 4BHBA 3FHEA 4CCNA 1FP1D 4JXTA 1J4QA 2VSXE 3KX2A 4PGHA 4DYCA 1W0TA 1HW2A 4Y52J 5ENNA 2L9NA 2QQBA 2A5EA 3HHMA 3EUHA 1UELB 2QQAA 3VSKA 2HVRA 2WXMA 3D9KA 3HOXJ 1TN7A 1I6XA 4J19A 2XCCA 1BLXB 2XPUA 2VJIA 1FMVA 3K2ZA 4EV0A 2DT7B 2XXSA 2XC7A 4BT8A 2ZJPF 3MZYA 3QU6A 1I3QJ 4L5JA 2L7ZA 3DU5A 1OCTC 2IRFG 3APFA 2WVIA 2LG4A 2F4OB 3S2WA 5LEJA 3CLQA 5D5WB 4J8YA 3ZPLA 3B13A 3V2OA 2LC1A 1WGXA 5A7DB 2MLKA 5FT9A 1WFXA 3G2TA 5KAFC 1RZ4A 3MKQB 3V7YA 1YW9A 1U9NA 2BHYA 3VYUB 1JWFA 2P6SA 4BBRJ 1BW5A 2V8SE 2ZGDA 1ZGWA 3D9MA 2Q2EA 3ASOH 5LCWC 3TWQA 2DJNA 1LD7A 2D5VA 2XS1A 5H6QA 3QOPA 2WA0A 1YJ9I 4UWHA 1IV8A 4FLBA 3ZMDA 2XGCA 2ZSIB 1BJZA 3QPTA 2DPUA 2CV2A 3S1MJ 3BG1B 5G55A 5JJTA 3V8QA 2BTDA 1OCRE 3JRBA 2A07F 1K78A 4RLYA 5JERA 3SZGA 2LUHA 5KAIC 5J3LA 2IAIA 2A4ZA 3APCA 5ERIA 5JELA 2X6HA 2WBMA 2R7WA 4RM2A 5CVIA 4ZYHA 3UX4A 3L2UA 3K70D 3GCMA 1G3GA 4L5IA 4LG0A 2YS9A 3DTEA 4CZZA 1S64A 4NQ0A 1MD0A 5C44J 3MVPA 1FHRA 4MEYF 4BEHA 5J4YA 2XENA 2IFUA 4URKA 4H7YA 3O48A 4Q69A 1Z1DA 2X48A 3M9AA 3WHBA 3ZPJA 2CQXA 2PEXA 3GFMA 1FVFA 2Y9YA 1FTZA 1N9AA 3PZDA 3RKXA 5BMZA 4PFOA 1E8YA 3IHVA 2WQ7A 4AVZA 5E3OA 4A55A 3LCAA 2YX7A 5CVVA 5K7FA 1TYQG 1YE9A 3OMYA 1MMDA 2EV5A 2KCVA 3AS4A 4GCVA 4DW6A 4L18B 5G05C 1MMGA 2E2HJ 3JUIA 1UG2A 3ECOA 2UV1A 3FWEA 3Q15A 2Q2EB 5C1DA 3E37A 2K9LA 1YI2I 4CSWA 4RGSA 3L9TA 2KC7A 2E1MB 3AAFA 2DOFA 3T8MA 1NK3P 4JHJA 5JJ6A 2LLKA 4KU0D 2R5SA 4HI9A 3DXMG 4GZ6A 3A02A 1MMNA 1K78B 4ILIA 2OUMA 4QTRA 2HXIA 3E6DA 3G2BA 1OCZE 3DSWA 2IU1A 3RRUA 3Q7FA 2JQIA 1S7EA 3V7UA 5B1BE 1ITYA 3O8HA 5A6CA 4NQWA 2C6YA 2VKEA 1WV3A 3WG7H 3FXKA 1J59A 3UIOC 1IN4A 4LG0B 3ZYKA 3ML6A 5C4XJ 3AFHA 3BR0A 4HLXA 3A01B 3LKUA 3FDYA 3D9JA 4FE4A 2OVFA 4BEHB 2G7HA 2E60A 4HDUA 1MW7A 2NVQJ 2P7CB 3KFWX 3I59A 4APFA 4HA8A 1MMAA 4NHJA 4HBLA 1MMSA 2WQHA 2XVCA 3CUOA 1QO0D 2FD5A 1JTXA 2NNNA 2NOJB 2OJED 1OCCE 2IONA 3HOUJ 3RO3A 2P9KG 3I0TA 3EDTB 2BY0A 1RPWA 2P7VB 4RM3A 2IO3C 4PSXA 3CVWA 1U6GA 1BI2A 1QGPA 5EYRA 2IOSA 3IV0A 2WXNA 3Q5MA 1E3OC 5ED4A 3GYZA 4HNTA 1KZPA 2KLOA 2XAQA 4IRIA 2VKHA 1TZLA 1N4SA 4JC8A 2C0MA 2IGKA 2DCEA 3FUEA 1IGNA 4E85A 1U0JA 4GYYA 4HOTA 2K5CA 3HOZJ 3G1MA 2EFPA 5GPCA 2AO9A 3GTGJ 2ME0A 4HX4A 1N52A 3DXKG 3F0CA 4A3BJ 2IO2C 3C3OA 4IRUA 1ZK8A 4XEIG 5FZRA 5H7PA 5D0OD 1XDUA 2O8XA 4XONA 2IW5A 2J09A 3DKYA 2IF4A 4D5CA 4O6JA 2WXFA 2MHKA 3LDZA 1DC2A 4YELA 2LDUA 3H3ZA 1KQ8A 2H6BA 2L0IA 4TUUA 4Q94A 3I59B 4HEA2 4I1AA 3GTJJ 1J5YA 3VPRA 1DMZA 2K4BA 1YYHA 2IS6A 1Z77A 3ABTA 4A6EA 1J4PA 3HM5A 2LYCA 3EHQA 4HB5A 2G9WA 2D2WA 3N4MA 4Q47A 3FMRA 3OYKA 4JEHA 5L3CA 2VBWA 4MBGA 5KNGA 2PZIA 2MOWA 3B7TA 2DJIA 3HVEA 5LLQA 2MH2A 4RGUA 1K4TA 1EF1C 4U8YD 3SY2A 3RKQA 4F3QA 1SZAA 1C0WA 2X1CA 2DOAA 4FULA 3I64A 4UUSB 5BPDA 3I54A 3T5XA 5LHIA 4ENMA 3JXIA 2CU7A 4WNDA 3CVLA 2M34A 1NH3A 3JUEA 3CJQB 4IHWA 4LEUA 1ZOQA 1SD6A 4EBAA 3ZN0A 1EH8A 3ZQLA 1HE8A 2ETCA 4KIFA 4D7MA 2R17C 2R05A 2HOTA 1P2FA 2F4IA 4KT6A 4MQ9F 2VONA 2MFZA 1LD8A 4DYQA 3JTGA 2M2EA 2VQ2A 4FLHA 1Y3HA