2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
5K5QA 4ZYGA 1HQCA 4J8DA 4R8HA 1BBYA 5FJYA 5LBQA 3IEGA 3EYYA 3MQ0A 1CGPA 2P7CB 4H0EA 5FD5A 1ON2A 3C18A 2PQNA 1B59A 1KA8A 3CLOA 4JBAA 3AS4A 1J0RA 2JSCA 4KN4X 4UUVA 3DFGA 1RI7A 4YFXF 1A04A 2EWNA 1ZRDA 1VTNC 1P4AA 4LG0A 4I17A 3R4KA 3HHHA 3WTVC 2MLKA 2FBKA 5CHEE 1KU2A 4BQAA 2Z9OA 2EA4A 4GYYA 2J5PA 4YVQC 1L0OC 3QPHA 2HOEA 4KFCA 5JJ7A 2ETHA 4HX8A 5K5RA 4A0EA 2UXNA 2XGSA 5ARGA 4LK1F 3J80K 2VC1A 1GHCA 4FX0A 3MEKA 2QENA 4LLLA 3KE2A 4GA1A 3RIRA 1NHAA 2EFWA 2HR3A 2HQNA 4PGHA 1HW2A 2XEVA 5HDKA 3GFLA 3CKCA 4CICA 3CUQA 3JW4A 1J4QA 2UWJG 3PFIA 2X0LA 4HLXA 2HQRA 3H3UA 3OUNA 3CK8A 2PI0A 3HSRA 1LB2A 3LWFA 3V7CA 4DNCA 3KAEA 3RJVA 5HOOA 2UY1A 4N9IA 3ASFA 2K02A 5F64A 2JPEA 3J81Z 4NRHB 1KQ8A 3KP4A 2VXZA 5FD6A 4GCNA 2VT2A 3T1BA 4U0VA 2PJPA 3QPTA 3WTWC 1PDNC 1GXPA 3F8BA 4HAMA 2E1NA 2TDXA 2HYFA 3PO8A 3ASGA 2CO5A 2ISYA 4EJUA 4L18B 2FRHA 4G25A 5HDNA 5LGUA 2STTA 3SHFA 1OKRA 3HTSB 2ZJ2A 2A61A 3V4GA 4RG9A 3S7DA 4HF0A 2O03A 5FZSA 4NQ0A 4JA9A 3KCCA 1XDUA 2KIFA 2C2LA 4AWXB 2UZKA 1W7PB 1YJMA 4AY5A 5BPIA 1HW1A 2FNAA 2FEZA 2EFNA 1EV7A 1U6GA 2Z3YA 1G3GA 3T8TA 3OOPA 4XI9A 4ZH4F 1Y0UA 2BE5F 3TO7A 3R9AB 3SZTA 2ZO4A 4APOA 4N3AA 1O57A 5EEHA 4MEYF 2GQQA 2VOOA 1UHWA 1R5GA 4BH9A 4JQFA 1OYWA 4EV0A 1Y8MA 3FMQA 3IRRA 3L7WA 2VBWA 4RGXA 3MA5A 2ZMEA 2RN7A 3E6MA 4XI0A 2LKPA 4UV9A 5AONA 2G9WA 4IHSA 5ILVA 1Z05A 2O3FA 4U0UA 1PP8F 2VGXB 4I9CA 1MDMA 1F5TA 4I1AA 3FM8A 4WXHA 4P96A 2IW5A 4UI9C 3V8KA 3KP3A 4A0YA 4L0ZB 3BROA 1DPUA 1MGTA 1J4LA 1U8RA 2Z99A 2BRFA 2GA1A 1U5TA 4MHGA 2F5FA 4IRGA 3RPQA 4M74A 1F4KA 1LQ1A 4HX4A 3Q15A 3AS8A 3ZP5A 4M9SA 1OUVA 3BDDA 4ZYHA 3ZQ7A 3DXJF 4G2VA 4Q48A 3DPTA 3K1MA 5CCMA 3KEOA 3IL2A 1P6RA 5CCLA 4NB5A 2HGCA 2RGVA 3Q9SA 3EQLF 2H6BA 4IPAA 4UVAA 1QZZA 5H20A 4MTDA 1G3SA 1TLHB 2DBBA 2XRNA 3JSOA 1S7OA 6PAXA 3COAC 1EH6A 2CSOA 3FMRA 3EYIA 1MJAA 5KVRA 1KLXA 1YW9A 5E20A 2FF4A 3VFZA 2O8XA 1MZKA 1K2MA 4L9VA 5ARFA 2H6CA 5BPDA 3C1DA 2NNNA 2XHKA 2DU9A 3RKYA 4AIKA 4OIPF 3TDZC 2ESNA 2MHKA 3VODA 4KMUX 1UJXA 1DDNA 4RGSA 4HLYA 4PGGA 3UUXA 1TW2A 4Z2YA 3HYMB 2JQIA 1OYIA 1RUOA 3ZGQA 2K27A 2QWWA 2EA2A 1ZLKA 1U3EM 2G7HA 4LEUA 2PIEA 3D0SA 3AS5A 2GIVA 4KICA 4WXCA 4AIHA 4HYEA 2QQ9A 3J80Z 2KATA 4JL0A 3LQRA 5ICFA 4EM0B 5D6EA 1KQ9A 2EV0A 4LJZF 4EJOA 4XSZF 4UNOA 3DP7A 4G7OF 2ONDA 4J8FA 1MJ9A 3U3WA 3W6KB 4OMYA 5FZQA 2M1BA 5ILUA 4KMFA 1R1VA 2COMA 3SZPA 1JE8A 1B6AA 4I2ZA 1XCVA 3WTYC 2CYYA 3QU3A 2ISZA 1TBXA 2KB3A 1IXCA 3L00A 5BQTA 5A6CA 5J8FA 4ME2A 4H7XA 5DCMB 1EH8A 1I6XA 1SMTA 5JI6A 1E17A 3I53A 2Y0MA 2FMLA 4A5NA 4N9HA 1J5YA 3D5LA 2WPVA 2DI3A 4I9EA 2DT5A 3P7NA 3RPUA 4ZZLA 3DV8A 1J7KA 2P7VB 3DQVC 4XBFA 1FT9A 3TAXA 3UV0A 3ASHA 4UHTA 1WWXA 2C6YA 1XGOA 2L6JA 1HW5A 5BW8C 2KB4A 5K5OA 2NYXA 2OD5A 1TQIA 3F6OA 3TGNA 3CV0A 3I54A 1P2FA 2RC4A 3F8CA 3QWWA 3GO5A 2CWEA 4HV5A 1ZGJA 1QQEA 4G23A 4L5JA 4G2SA 5DUKA 1XGNA 2CW0F 3CUQC 4KT5C 2D2WA 5CJ9A 1H0MA 4Q47A 4CDGA 2VT3A 2DQLA 1ZYRF 3GLXA 1QZ2A 4RB2C 3L9FA 3T0YA 4YG2F 5FB2A 2L3DA 1ZG1A 4OU0A 3GEZA 4O6JA 2VBXA 3E6BA 2YX4A 1FP1D 2HFHA 2ZXJA 3ESKA 2XGXA 2IVMA 2QQBA 1ZBPA 4XIFA 1JHHA 3WTTC 3LQQA 3KFWX 3QP6A 3NF1A 4ESFA 4M6YA 2LF8A 3I71A 2DLLA 2PZIA 1PC2A 1JGSA 2A68F 1LEBA 1LEAA 3GFMA 2K4BA 4KIBA 4AVPA 5HS7A 1FC3A 2RKHA 1XSVA 1SMYF 4EJQA 3UMZA 4Q5SF 1BIBA 5LRSA 5FLXK 1D3YA 1D8JA 2NRAC 3BY6A 3KLNA 1GVJA 1XCBA 3FXQA 2UWMA 2GWRA 5DV5A 3HX1A 1KT0A 3DPLC 3R0AA 4EJVA 3ZMUA 1K3QA 2V5FA 3ZMZA 2LNBA 2KJCA 4YIIA 3HSEA 4JONA 1HXIA 5H6QA 1K3JA 2L4AA 1YTYA 4MEXF 3L2CA 4N3BA 4LD5A 2LSUA 3R61A 1R1TA 5F6FA 5IT9Z 4KYOB 3RKWA 3GZ2A 4KIFA 3Q4AB 4RB1A 4EM1A 4U07A 1HZ4A 1IXRC 1SFUA 1OR7A 1ON1A 3M8EA 1RZ4A 3TO9A 3KD7A 5HLHA 1NA3A 4YNDA 2FMYA 3NEUA 3WGHA 4OIQF 2FSWA 2Y4TA 2ZBKA 3B73A 3ZPJA 1ZHFA 1O7FA 1KU9A 2IA0A 2W84A 1JHFA 2XCCA 3RDIA 2QQAA 5HQ8A 4KA4A 1STZA 2MA3A 3FXUA 1IYGA 4BHPA 1R00A 3BJOA 5KJMA 4ENKA 4ENJA 3IKVA 4IXAA 3VTXA 4EVIA 3R60A 3GFJA 3O3KA 5E1ZB 1K78A 2M8EA 1ELRA 2MLGA 4HQMA 4YVOA 3UNNA 4S05A 4Y17A 4BHBA 2DFIA 1MKMA 1LGPA 3F8FA 3TGOA 2Q2EA 2DO7A 3CO6C 4AIJA 3TOAA 4ZYDA 3ULQA 3K1PA 4A1SA 1PUEE 1ZN2A 4I09A 2A3SA 5D5VB 5E18F 3N97A 2M45A 3ZHEB 1BI3A 5DJOA 1XGMA 3WTUC 4GXOA 1I1SA 4IRIA 1T98A 5LHIA 2AXLA 1LDDA 4TV7A 3WU1B 2PL2A 2A6EF 1R5HA 2VGYA 1PP7U 4AM9A 1ULYA 4WCGA 1Z1DA 1TW3A 1UCRA 4J8EA 4BT8A 4KBQA 1IN6A 3F21A 5G04J 3TG5A 3RKXA 2IT0A 2QVOA 1R21A 4BWRA 2P8TA 3HHGA 3O2PE 1WKMA 2H09A 3P9CA 2VC0A 1K3NA 3ZMVA 4YFKF 4JA7A 2Q8KA 1FY7A 3P9KA 3V8LA 3HOTA 3POAA 5HS8A 3ZMDA 2O61A 3O48A 3HYIA 1S8NA 3CEQA 1IN8A 3HIFA 3MV2B 3IHUA 2KCLA 5D6FA 1NZNA 4IVNA 1K78B 3EDTB 2YHCA 1FYKA 3V7RA 3UPVA 3JTGA 2YX7A 2XPIA 1KU7A 4G24A 3F6VA 1B9MA 1V4RA 5ILSA 3SFZA 4XRFA 4B09A 4A0XA 1ZLJA 3I58A 3SXYA 4Y6WA 5L3GA 2MC3A 4N2SA 1KQ0A 2VOPA 2HS5A 3IC7A 5EX3A 1QPMA 2FE3A 2JRTA 5LCWJ 1DP7P 2KIUA 3GQSA 4U0ZA 2HEOA 4YIFA 2IPQX 1HKTA 2KIMA 2YSRA 1O3QA 3MKRA 4OOIA 3ZN0A 2EV5A 5DCFA 3GZ5A 3C3WA 3KP2A 4HOBA 3WE2A 5D0OD 1G6GA 3EUHA 4LFUA 4EQQA 3V7SA 1K7AA 3RKVA 1S29A 1Z9CA 1BI1A 5DD4A 4WUYA 1WQ2A 4EJTA 5KJNA 4J0UA 2V9VA 1AOYA 4MQVA 3BEEA 3S7FA 2JT1A 4GCVA 4QWQA 1W7PD 4B8XA 2F5DA 4WX9A 2JKDA 4ABNA 3GUDA 1ZG3A 4MQ9F 1CF7A 5FLXZ 3BJAA 4UQXA 4P55A 2P5LC 5J6XA 1R7JA 5DEQA 3ZHEA 1UFMA 4A6EA 4XLPF 4HV6A 4ENMA 4U88A 2QLZA 3RYPA 4N39A 2WTEA 1X3UA 4AD9A 3HTUA 3OV8A 1ZGAA 2BYVE 5E17F 2XKOA 4EGXA 1I27A 2WV0A 1IF1A 1WV3A 2AFFA 4U0SA 1ZAOA 1ELWA 1G6NA 3BP8A 1O3RA 3E4BA 3CVNA 1SFEA 2ZKZA 1D5VA 4UV8A 1TQPA 1R22A 1MJBA 2G1LA 2R5SA 5H6RA 2OAZA 2J9QA 4GYOA 2GXBA 4HDUA 5D5XB 1OPCA 2FO7A 1HXDA 4LLGF 1YS6A 4G7HF 1MZBA 3MFKA 1ZG5A 5KK1A 2XROA 5A7DB 3LKUA 2XGOA 3KZYA 1IRFA 4CGZA 1ODDA 4UVCA 2PMHA 3I6UA 2VODA 3ZMSA 2HKXA 3G73A 3FX3A 2V1XA 2KCKA 1G3YA 4UXNA 5DD8A 5A2QZ 2UY1B 1W5TA 3MDBA 1BM9A 3ELKA 3WTSC 3KETA 3QWVA 1F1ZA 1YYVA 3TOBA 1BI0A 3GF2A 2XAQA 1G3TA 5JVTA 3HUFA 3FWVA 3OXLA 4HOUA 2HTSA 4ENNA 3LAPA 3REOA 4WNFA 1ZREA 4IRHA 2XCBA 4GO1A 4MNUA 4QLCU 4D9VA 4MGRA 2R3SA 3RU0A 5KJLA 1KGSA 3FFLA 2FI7A 4K2EA 3I5UA 2JPCA 2IA1A 5L3DA 1SD5A 2G7UA 2KKLA 1KYZA 1MD0A 5BMZA 1HH8A 3K69A 2NNYA 2BV6A 3NQOA 4I2WA 4PDKA 2C0LA 4KYWA 3ZN1A 4B94A 2JZYA 2KCVA 2WQHA 5L3EA 5ICCA 1W7PA 4EGYA 3CTAA 4GA2A 1D8KA 1U2WA 2NS0A 4JHRA 3S7JA 2E2EA 1R23A 1JXSA 3VTYA 2V6CA 1IAWA 1DPRA 3JAMZ 4YFNF 4G7ZF 5FO5A 2QFCA 3HUEA 4HW0A 5HI7A 4NHJA 5M72A 1ZRFA 4GZ5A 1FHRA 3I4PA 2PBIA 1Q1HA 4UVBA 1WLNA 2P58C 3MZHA 3PDNA 4HBLA 5HVQC 1LVAA 3I64A 1NA0A 5EKQD 2E1CA 2YR2A 1USTA 3B02A 2VE9A 3H92A 3OXFA 4WXDA 2W25A 1ZU2A 3UNMA 3F22A 4Y13A 3I0NA 1KYWA 4AY6A 3MEXA 1IN5A 4A6DA 1TTYA 1UHTA 5D8KB 1TNTA 2NC9A 3LPZA 4RGUA 2AS5F 5D4RA 5J8CA 1C0WA 3Q5FA 3ZMTA 3I59B 4P9UA 3F23A 1XDSA 3QWPA 4BAYA 1W4MA 2VN2A 3VPYA 5JR3A 1YG2A 2RDPA 1FPQA 1QO0D 4GGGA 3RO3A 2HWVA 5E8GA 1GXCA 5HDGA 4AIFA 4GCOA 3GWZA 2HDCA 3CUOA 5AIQA 4A0ZA 4N0BA 2L4MA 5AYWD 4EGZA 2PQ8A 1T0FA 2PMUA 3S2WA 1T6SA 3S7BA 2R7FA 1QZYA 3HRSA 5LEJA 4RB0A 5JHUA 3ULQB 4A5MA 3CDHA 5EX0A 4OINF 2XKPA 1SAXA 1IHGA 3CVLA 3ERED 4BYYA 2P4WA 2W3OA 4GZ3A 2EV6A 3BPVA 3TDUC 5LLQA 1SFXA 4IJAA 4NQWA 1S6LA 2X4HA 4RG6A 4HDVA 2KRFA 4R1HA 1YA0A 2V1UA 2JLBA 4U04A 2YQ8A 1FHQA 3MZYA 5BS6A 2FBHA 4M9ZA 5HS9A 3PE4A 3E5QA 2RQPA 2HTJA 1W3BA 5E50A 3VA1A 3SF4A 2LC1A 1YW7A 3UQ3A 2FQ3A 1HKQA 2W85A 2KKOA 4RAYA 1R58A 3KT9A 1TQMA 4HF2A 2A5YB 1BIAA 4G6DA 1WM5A 1KU3A 2F5EA 1FX7A 1U5TC 3LY9A 1B1BA 3KS2A 3QKYA 4ETSA 5CVIA 4Y15A 4G8XA 3Q49B 4ZZDA 3ISPA 2JQJA 4HORA 3I59A 2LDUA 1OYYA 4CDRA 3K2ZA 5DIZA 2RVCA 2AVPA 4HOQA 3ZPLA 2A69F 1TNSA 3ZN3A 4M73A 4ON0A 3URZA 4FX4A 5DYMA 1P5QA 1T38A 2ZNZA 2Y48A 4L9TA 1O3SA 2DPUA 2WC2A 4CO8A 4OMZA 3QAHA 1XMKA 3ECOA 4I0BA 1W5SA 4G9YA 3BPXA 2DBAA 5CLSA 4MTEA 3BZ6A 5L3FA 3R0JA 4EJWA 1P92A 4CGWA 2YPRA 2OU2A 2Y75A 3ABTA 1WAO1 5BOXA 3PQJA 2DQRA 2ACJA 2HYGD 1QU5A 2LSVA 2EFOA 4G6QA 4E70A 2STWA 5BNWA 2C0MA 4HF1A 5A8IA 1ZRCA 2LNIA 2XUBA 2BBYA 4RS8A 1AWCA 2MH9A 1QQIA 5TJJA 1SD4A 1YQAA 4U7BA 2A0TA 2HYZA 3KEQA 5LGNA 2DW4A 5FGMA 2V1DA 2ELHA 4L9NA 2EJRA 1J4KA 4WNEA 3ELSA 2M87A 3UN0A 2IF4A 2RV8A 3AAFA 3WE3A 4XSXF 1YW8A 3HOSA 1T2KA 2HR2A 1E2XA 2DK8A 2O0YA 4IF4A 4BHCA 1WSUA 2ESHA 3G3ZA 4CHUA 1XMAA 1YS7A 3FZVA 4CXFA 1YIOA 2H27A 5D0QD 1OMIA 4LK0F 2EH0A 3LA2A 2CGPA 2QBYB 2PEXA 4WWCA 3GW4A 2O6GE 4ESBA 3WTXC 1O3TA 3FM3A 4WNDA 2P5KA 2DAOA 3M9AA 5JJ6A 2XT9B 2IA2A 2YU3A 2IP2A 1G4DA 4KXKB 2UXXA 1SD6A 3SZ7A 2DTRA 4PCQA 1FSHA 1F9NA 4CGVA 2EB7A 4CZZA 5DCMA 5AIPA 3IKTA 3EETA 2DPDA 2K7LA 3NRVA 1J4OA 2FA5A 3RJPA 5KJKA 3I0MA 2D1HA 4A2UA 2GA2A 2OZUA 1T39A 1FYLA 3BWGA 2VONA 3CVPA 1XB4A 1WI9A 3K9TA 3LA7A 2HZTA 5G05J 2Z5UA 2XAGA 2PN6A 3T5XA 4U0WA 2HKOA 3DEUA 2F2EA 5FTPA 3QU6A 3DF8A 5CVJA 2W24A 4HZFA 3TG4A 2P6TA 1QGPA 3JSPA 4G94A 3W6JB 2MH2A 2XAHA 4I98B 2VSYA 4KDPA 1XN7A 4GA0A 1I5ZA 1IUYA 2CQKA 3WTZA 3QP5A 3K1NA 1K79A 3J7AO 3KLOA 3JTHA 3Q47B 3GFIA 2FXAA 2MD5A 2R7DA 4KUMA 3TKYA 4N5CA 3MAJA 3KP6A 3E5XA 1HSJA 1J9IA 3I6WA 1S3JA 1H9TA 3EDPA 1LDJA 3WGIA 1HBXG 4W9RA 3MCZA 3FF5A 4ESJA 1Z6RA 2W57A 5K1YA 3PE3A 2QUFA 3T8RA 3GVAA 3GXOA 3RIBA 2HO1A 3IRQA 3M8FA 2PG4A 1IZ1A 2ZFWA 4LLNA 1UHMA 1G3WA 3WGGA 2OA4A 2QM3A 1HKSA 4RGRA 3GX4X 4JK1X 2ZNYA 5ICEA 4DQ2A 5E1WA 1XGSA 2L54A 4UI9K 2GAUA 2Y4UA 3LYAA 4S04A 1REPC 3GYZA 5CVRA 4LGWA 5C1DA 1O7LA 3VEPA 3F72A 5HLIA 1USSA 3ROUA 4O6FA 2ADUA 1I1GA 5D8LB 1FBSA 3QDNA 2VBZA 4WK8F 3M7GA 3P9IA 3TQNA 4HX7A 1P4WA 2VBYA 2Z33A 5FT9A 3F8MA 3TO6A 3HRMA 3E6DA 1GXQA 2FBNA 2MBFA 2DK5A 4OIRF 3CK9A 2I6HA 2M5WA 5LGTA 1B89A 3O6BB 3ML6A 5LCWC 4EM2A 1XSDA 1QBJA 4LG0B 1BC7C 4UQYA 2F5CA 3GZ1A 1IXSB 4FHTA 2K86A 3CO7C 2PQRA 2VE8A 5CYVA 5E8IA 4BNCA 4FT8A 3KP7A 4GZ6A 4GYGA 4N2QA 1EH7A 5LEKA 2D1VA 3N4MA 2FBIA 3F3XA 2XIGA 4ZYEA 2XVCA 2PFBA 3RO2A 2IFUA 2EFQA 5G05C 2VSNA 4KN7X 5FFZA 3KZZA 4N3CA 5EEGA 4I01A 2BGCA 4I2OA 2CFXA 2EK5A 5TRDA 4RAZA 1FZPB 1BN5A 1YFHA 2E7WA 4A12A 4I02A 4M9XA 3U4TA 3GYHX 4L5IA 2IJLA 3OXGA 3UOTA 2VYIA 1YJ5C 1BI2A 4D0PA 1XD7A 3SQNA 2VGXA 3GW2A 3ASDA 3CUQB 2Q0OA 3WU0A 3VB2A 4F7ZA 3FMSA 3LA3A 5E1XA 3GZ6A 1IW7F 3LAJA 3LSTA 1FOKA 1FP2A 3H3ZA 1P4XA 3E3VA 3BOQA 2BUGA 4BTAA 3LCAA 2KJBA 2L02A 4I7HA 3WG9A 2V79A 1DMZA 1XNFA 3CKBA 4G1TA 3E5UA 3Q9VA 2OBPA 2FNPA 2PLYA 2E7XA 4ASNA 2OOEA 4GPKA 3N71A 5D4SA 2A6HF 1E96B 3KP5A 1TJCA 3FM5A 2H94A 3CK7A 3LY7A 3RI4A 1WRJA 1K6OA 3CVQA 1YLFA 3MV3B 4U7DA 3WXXA 4XLNF 4LB5A 1DUXC 4LMYA 3VOEA 1R1UA 5IT9K 4HOSA 2RNJA 2NAZA 1LJ9A 4RB3C 3ABUA 4R79A 1L3LA 2XAFA 3QOPA 3IWFA 1ZH5A 2D45A 2WWYA 1IN7A 3I0TA 1LDKB 4KIGA 3E97A 1FNNA 2JTVA 3ZFWA 3FWEA 2JPBA 4UQZA 1Z7UA 3ECHA 2OQRA 4Q4ZF 4BTBA 4HOTA 4M72A 2EFPA 1FCHA 3HSFA 5A2QK 5CVUA 5CVVA 2VQ2A 5DUIA 5D5WB 1RNLA 4UI9J 3RTRA 1RIOH 1Z6TA 3LY8A 5FZRA 5ICGA 1J75A 5FFXA 3FP3A 2K4JA 2P5VA 2JQLA 3WODF 1KT1A 4BXUA 1FBQA 4BT9A 4HA8A 1A17A 4P5OA 1FBUA 2M30A 5DBKA 1BC8C 4EQFA 3FXRA 3CJNA 4KNYA 1FLIA 4I0AA 1IN4A 4GYIA 3V8JA 2GW1A 4P9FA 2KC7A 3PQKA 4QCJA 1K2NA 2CG4A 1U78A 2OZ6A 5G04C 3U9GA 4HQEA 4U0YA 1MDMB 1FWZA 2ZMEB 4GYWA 1J2XA 1UB9A 3E6CC 3M1EA 3F8NA 1LNWA 2XGMA 2A07F 5L3BA 2QYOA 1ZARA 3QOUA 3DKWA 4O5VA 3HUGA 1SD7A 2OQGA 1FSEA 3C7JA 5HLGA 4WNGA 3BJ6A 3J81K 1H9GA 5LRRA 3JAMK 5JFRA 3K9IA 4G26A 4F3VA 1QNTA 4WF2A 4IHTA 2FOKA 1BOAA 1U5TB 2XASA 2GXGA 5LHHA 3U1DA 5IT3A 5JJTA 4CYDA 5BT1A 1S7AA 3QRFF 3L09A 4IN3B 5L3CA 2LF7A 1IRGA 2B0LA 3FHZA 4EMSA 3R6SA 5ED4A 2BEOA 2J5OA 2P6SA 5LHGA 3HRUA 3K0LA 1CF7B 5ERIA 4M71A 5F1RA 1B4AA 1HSTA 5D5UB 3IWZA 4OIOF 2LSOA 4L0YB 1J59A 4O3MA 4Y6CA 1ONVA 4PZJA 2CSWA 5DDGA 3HRTA 2FU4A 1B9NA 1R36A 1XSXA 1LGQA 2ZCWA 4H7YA 3RYRA 4M6XA 2QBYA 3JYSA 2QZ8A 3Q5MA 2Q7FA 1YO5C 1BJAA 3VA4A 3LFKA 1RUNA 3ELVA 1V3FA 4LB6B 2L01A 2GZWA 1J4PA 1Z91A 3U2RA 4H87A 2XAJA 2XV4S 3MWMA 1FYMA 2KFUA 4L9JA 2IRFG
chains in the Genus database with same CATH superfamily
2MSYA 3T5PA 4ZHBA 5K5QA 4CRWA 4ZYGA 1HQCA 1K8KG 3LEWA 2LTPA 2P9SG 2QSHX 4R8HA 1SA5A 1E3OC 4J8DA 1BBYA 5FJYA 5LBQA 2BRFA 3HXLA 3IEGA 2ZGDA 3EHMA 3H5NA 3EYYA 3BTCA 3MQ0A 1CGPA 1A31A 4F1PA 5CQEA 2P7CB 2CG3A 5AQ7A 4H0EA 5FD5A 3ABLE 4IRUA 1ON2A 3C18A 5FROA 3FU5A 3LNQA 2PQNA 1J09A 3LSKA 5IOYA 2R03A 2KZTB 2WXMA 4EZLA 3V8PA 4JW1A 2WXQA 1B59A 1KA8A 3EU5A 2VQGA 5HKPA 2DDBA 4URKA 3CLOA 4JBAA 1ETOA 3UTMA 3AS4A 1JKPC 4UUCA 1J0RA 2JSCA 4KN4X 4UUVA 1VI0A 3DFGA 4BFRA 1RI7A 1H2TC 4YFXF 1A04A 4N4OB 2EWNA 3DPYA 3V2OA 4DYRA 3LFUA 4CYCB 3B13A 2VL8A 1VTNC 1ZRDA 1P4AA 4LG0A 2NVXJ 4I17A 2F4MB 3R4KA 1DEVA 3HHHA 3WTVC 2MLKA 1OCRH 3A77A 2FBKA 5CHEE 2OVBA 4HNAD 2GXAA 1KU2A 5EJCA 4B3AA 2IS4A 4BQAA 1HA8A 2XXSA 2Z9OA 4LITA 2EA4A 1RC9A 3G4SI 2J5PA 4GYYA 4YVQC 2DMQA 1WJAA 3Q75A 1BJZA 3U64A 1X1PA 1L0OC 3QPHA 2CMPA 2JA5J 5BXUA 1Z0UA 3GMJA 2HOEA 3I5PA 3CHSA 1VQ9I 4KFCA 4IHXA 1XS9A 3V7YA 4UWFA 3LSMA 5M5WJ 5JJ7A 2ETHA 2Y69E 2BXYA 1WHUA 4HX8A 5K5RA 3CMMA 2MYSA 4A0EA 5BVIA 3B7BA 3JUIA 1HF8A 3ABLH 2UXNA 4DGWB 2XGSA 5ARGA 1B72B 4LK1F 3J80K 2VC1A 4AUXA 2HU9A 2LH9A 1RR8C 1GHCA 4FX0A 3DLAA 3DTIA 3CLJA 4EZKA 3QOEA 3MEKA 3A0BC 3V42A 1MH3A 3CVUA 2QENA 4LLLA 3KE2A 4GA1A 4FETA 3RIRA 1NHAA 3FXMA 2EFWA 2A6TA 3IH3A 2HR3A 2HQNA 2M9HA 2CJJA 4PGHA 3HL2A 1HW2A 1TWAJ 1FTZA 2XEVA 2FULA 5HDKA 3GFLA 3CKCA 3I4MJ 4CICA 2LBFB 4AEZC 2BW3B 3CUQA 3JW4A 1RRJA 4ILGA 4LSZE 1J4QA 1PUFB 3GLLA 1X2NA 1O1SA 2UWJG 1F43A 4RQIA 1FIPA 3AL0B 3AAAC 3PFIA 3MGBA 3FUEA 3OYCA 2ZMEC 3Q3SA 2HZDA 2X0LA 2Y2ZA 3CCLI 4HLXA 2AJAA 1GV2A 1DGWY 2HQRA 3BTJA 3H3UA 3SFIA 2WXKA 3OUNA 3AL0C 3E30A 3CK8A 2PI0A 2XZDG 3G2UA 3B6AA 3HSRA 1LB2A 4JB8P 3LWFA 4LNBA 5AQBA 1Z67A 2P1RA 4WERA 3HIZA 3V7CA 2LC2A 4DNCA 3ZEFA 3KAEA 3RJVA 3L2VA 5B3SE 5HOOA 2UY1A 4OVUA 4TXRA 4N9IA 3CIAA 3ASFA 4GRIA 2K02A 3OR2C 3GTKJ 4FLBA 2ZXWE 3U9WA 3K70C 4DBRA 3ASNE 3HXCA 3FULA 5F64A 3UT4A 2EZIA 2NVYJ 2JPEA 3J81Z 4NRHB 1KQ8A 3KP4A 3HJEA 2VXZA 5FD6A 1W5CC 2IAIA 2Q1ZB 1YJNI 1HC8A 4GCNA 4HRLA 1MMGA 2VT2A 3T1BA 4U0VA 5DHPA 2PJPA 1MMSA 3QPTA 1GV5A 2AO9A 3WTWC 1PY1A 5CKTA 2E71A 1PDNC 1SQMA 1GXPA 2L9BA 2FD5A 3F8BA 4HAMA 5BNGA 2E1NA 2TDXA 4J6IA 2HYFA 3PO8A 3ASGA 1JPLA 2CO5A 2NSZA 1SFOJ 2ISYA 3JQ1A 2F4OB 3E34A 4EJUA 1IDYA 4L18B 1OCOE 3BR2A 2FRHA 5C2YA 1QYMA 4G25A 4K5BA 5HDNA 1OWMA 4D7MA 5J1YA 2Y9YA 5LGUA 1NL4A 3OIPA 3I4RB 4ILIA 2X6XA 2STTA 3SHFA 4KZ0A 2H1KA 1OKRA 3HTSB 2VIXA 1N25A 2A61A 2ZJ2A 4M3BA 2M2EA 3V4GA 4RG9A 2LY9A 4BJTA 3PS6A 3S7DA 3IP4B 1H6PA 2LLKA 3CDIA 2O03A 4HF0A 3NZUA 3QK0A 4TRQA 5FZSA 4NQ0A 3OAWA 5JHAA 1QZEA 1SW6A 4JA9A 2V4LA 4C0MA 2DWZA 1HG5A 1G88A 4NDLA 1K3ZD 4V24A 1VQ8I 1IRZA 1D1CA 2ZJRF 1K4TA 4I43A 3KCCA 2L9VA 4II3A 1XDUA 2DVWA 3ZW3A 2KIFA 2VQCA 2R7OA 2C2LA 4AWXB 2UZKA 3OSFA 1W1WE 1W7PB 2OCCH 1YJMA 4L23A 3I3LA 4AY5A 2J07A 3ESWB 2XC7A 5BPIA 1HW1A 2FNAA 3MZ8A 2FEZA 4BKXA 3UINC 1TN8A 5AARA 2EFNA 5FQ6A 1EV7A 1U6GA 3CHRA 2Z3YA 3HG9A 2GM4A 3FUJA 3T8TA 1G3GA 3OOPA 1ETWA 2VKEA 4XI9A 4ZH4F 3BQZA 3D9IA 3OIOA 3PFYA 1SAUA 4YDEA 1Y0UA 2BE5F 2Y30A 3TO7A 1N4QA 3S2DJ 1VQPI 3R9AB 4D9JA 3CHOA 2RFAA 5HNFA 3SZTA 1KHXA 2OC6A 3ZXSA 2ZO4A 2R7ZJ 1BLXB 4APOA 3Q73A 1BR2A 3QQAA 1LF8A 4N3AA 3FKJA 1O57A 3HKZN 5EEHA 4MEYF 4TV3A 2GQQA 3QODA 1X3WB 4B3XA 2VOOA 1UHWA 1Y6IA 1R5GA 3AG2H 3UIPC 4II2A 4BH9A 3DU5A 4JQFA 1OYWA 4EV0A 3JREA 4F53A 1Y8MA 3ZQIA 2OTLI 4LUNU 3FMQA 3JRBA 3FU0A 3IRRA 3L7WA 2VBWA 4RGXA 3MA5A 2F5VA 2DCPA 2VQLA 2ECCA 3ZQGA 1IV8A 2ZMEA 4MKTA 2K5CA 2K9SA 2DXIA 3CC4I 2RN7A 1OCZE 4QFVA 1ZR4A 3E6MA 2L0IA 1D0ZA 2LKPA 4UV9A 1MYOA 4XI0A 5AENA 5AONA 3LS8A 1HG2A 2G9WA 4NC7A 4IHSA 1K61A 5ILVA 3I4NJ 3FY4A 1Z05A 2DOEA 2O3FA 4RA2A 2EILE 4GZDA 2VQHA 3HUGB 1PP8F 2VGXB 2X6IA 4XIDA 2R5ZB 4U0UA 3VLDA 2Z16A 4I9CA 1MDMA 4U63A 4E4HA 1F5TA 3S1RJ 4I1AA 2I1WA 2WXLA 4UUTA 2CRGA 4M3FA 3FM8A 5B5EC 1WJFA 4WXHA 4P96A 2IW5A 2Y3AA 4PDXA 4UI9C 4OAUC 2EIME 3V8KA 3KP3A 4CZCA 5EDSA 4A0YA 1PYVA 4L0ZB 3BROA 3DWLE 2CV2A 1DPUA 1MGTA 1DC2A 5ENQD 1J4LA 1TWCJ 2Z99A 5KCMA 3SDGA 2GA1A 1U8RA 2AWIA 1U5TA 1O4XA 2EIJE 2JEKA 4MHGA 3HOYJ 1QWTA 1A36A 2F5FA 4IRGA 3HGYA 3RPQA 4M74A 1SEUA 1F4KA 4F3QA 1LQ1A 4HX4A 3MD2A 4ZYAA 5E3LA 4BDYA 3Q15A 4E7ZA 1K1BA 3AS8A 5LX8A 5JERA 3ZP5A 2H6IA 4M9SA 1OUVA 3BDDA 2R0QC 4ZYHA 3NB2A 4BBRJ 4BETA 3ZQ7A 3DXJF 3IHVA 4G2VA 4MFDA 3DPTA 4Q48A 4CA0A 3K1MA 5CERB 3OOUA 5CCMA 3BG7A 3J7AY 3KEOA 3PIOF 3IL2A 1P6RA 5CCLA 2YNQA 4NB5A 3OS0A 2HGCA 2RGVA 1HDPA 2MABA 3EQLF 2H6BA 1WI3A 3Q9SA 3MN2A 2M0MA 4TUUA 4IPAA 1MNDA 4UVAA 1YJ9I 5AN8A 2I2DA 1QZZA 4RBOA 3HXDA 1H6KA 5H20A 4MTDA 3LJNA 1G3SA 1TLHB 2DBBA 2XRNA 3LOCA 4Y7NJ 1S7OA 3JSOA 2QEXI 6PAXA 1TNZA 1R4NB 3FTSA 3LL7A 3FUFA 1AWCB 3COAC 1EH6A 2CSOA 3FMRA 4Y52J 3EYIA 3FUIA 1MJAA 2XPUA 5KVRA 1KLXA 1YW9A 4PUSA 4B89A 5E20A 2FF4A 3VFZA 2O8XA 1MZKA 2JUCA 4NUBA 4F1SA 5AJLA 1K2MA 4L9VA 5ARFA 2H6CA 5BPDA 3C1DA 2NNNA 1I50J 2XHKA 2DU9A 2GBYA 3A4CA 3RKYA 4AIKA 4OIPF 2VSXE 3TDZC 2ESNA 4XKCA 2I2BA 2MHKA 3VODA 4KMUX 4XORA 1N52A 1UJXA 3CR3A 2XPVA 5CPRB 1DDNA 4RGSA 3L9TA 2RFMA 3LSPA 4HLYA 4PGGA 1KPSB 3Q0UA 1MX6A 3UUXA 5JHBA 1TW2A 3L2QA 4Z2YA 1OCTC 4XRSG 2LUHA 3HYMB 3FHEA 2JQIA 1OYIA 1RUOA 4GB9A 2K27A 3RPUD 3ZGQA 4NQWB 2QWWA 1T95A 5K7ZA 4L2LA 2I1KA 2EA2A 1FIAA 4LG3A 1FOXA 1ZLKA 1NG6A 3ZXPA 4DW6A 1U3EM 1QPIA 2G7HA 4LEUA 2PIEA 3D0SA 4K5AB 2BKKB 5EYRA 4V2GA 3AS5A 2GIVA 3D5RC 2ID6A 4KICA 3D9PA 2XB5A 2WAQA 4WXCA 3OIQA 4AIHA 4HYEA 2QQ9A 3J80Z 2XSJC 5B3SH 2GROB 3P1UA 2KATA 4M3GA 4JL0A 3LQRA 4IL6C 2FQ4A 2JWTA 5ICFA 2HI3A 2NVUB 3GTLJ 2DCEA 4EM0B 1LFUP 5D6EA 1WJBA 3AFOA 1KQ9A 2EV0A 2ICWG 2L9RA 4LJZF 4XSZF 3SZGA 3ASNH 3DP7A 4B43A 4EJOA 3CCEI 4UNOA 2HM8A 2V8SE 4GTVA 4DK5A 4MIMA 3NARA 3S3NA 4A3EJ 1JT0A 3S2AA 2YU9J 4G7OF 2ONDA 4J8FA 1MJ9A 1J2FA 3DLLF 2RNGA 3U3WA 3W6KB 4OMYA 4FCYA 5FZQA 1X4PA 3FKIJ 2M1BA 2ZB9A 4JYKA 2ELJA 4BXFA 5ILUA 3BC8A 3PNTB 3PZ2A 4KMFA 3DXMG 3HOZJ 1R1VA 2COMA 2R7TA 3FXLA 4QSHA 1B6AA 3SZPA 1XCVA 3ZQQA 1JE8A 2DTZA 3A02A 1DCEA 3WTYC 3UT8A 2I10A 3VLFA 2CYYA 3QU3A 2W1OA 5FLMJ 3H9QA 2ISZA 2V5QC 4LG6A 1TBXA 5J1RA 4HXIA 2KB3A 1IXCA 3SBSA 3L00A 3ZQLA 3FDYA 3S15J 3B7SA 2CQQA 2UUZA 4MBGA 2Q5FA 5BQTA 5KAIC 5A6CA 1TWHJ 1ENHA 5J8FA 4ME2A 3MKZA 1POGA 1H2VC 1HE8A 4G12A 3D9HA 4H7XA 5DCMB 1EH8A 1I6XA 1SMTA 5JI6A 1T8IA 1E17A 1Z0SA 3I53A 1K4SA 3FEXA 1ZKGA 1ZGWA 2IO3C 2WB1N 5JEOA 2K9QA 2Y0MA 2FMLA 4A5NA 2XS8A 4N9HA 1HCRA 3R7QA 1J5YA 5TISC 3D5LA 2RQQA 4DYQA 2BHYA 4BS9A 1B72A 2WPVA 3TL5A 2DI3A 2H8RA 4I9EA 3SI5A 3DRAA 2DT5A 3P7NA 3FBIB 3RPUA 3DV8A 4ZZLA 3C2GA 2X6HA 3Q47B 3FH8A 1J7KA 2P7VB 3B7TA 3DQVC 2HNHA 4XBFA 1FT9A 2WXNA 3TAXA 4CT4A 2OCCE 2CU7A 5DM6F 5EEAA 4QPOA 1N78A 3UV0A 5HS0A 4P29A 3ASHA 4IULA 4UHTA 1WWXA 2C6YA 1XGOA 4ACKA 4IOCF 2P9PG 2GLOA 1IKND 2L6JA 4BE0A 1HW5A 5BW8C 3VYTB 3OL3A 5K5OA 2KB4A 4B8AA 3AU5A 2NYXA 2OD5A 1TQIA 5BXOA 3F6OA 2VKHA 5AAOA 2W82A 2ZXWH 3PUJA 3TGNA 3CV0A 3I54A 3RAUA 2YUSA 4PJJA 1P2FA 2RC4A 3MKWB 2DFEA 5JHFA 2EZHA 2XENA 3F8CA 3L82A 4HLLA 4V2FA 3QWWA 2XF5A 3GO5A 1B8IA 3ZIMA 4ANWA 2R5ZA 2CWEA 2KT0A 4HV5A 1ZGJA 1MSEC 1QQEA 4G23A 2IU1A 4L5JA 2LY1A 2BONA 3DSVA 2R5YA 3E33A 4G2SA 5DUKA 4RM3A 1XGNA 2F6CA 4YDWA 1I6HJ 1EPUA 2OJED 2CW0F 3CUQC 4KT5C 4LOCA 2D2WA 5CJ9A 1SANA 5GAHJ 4F92B 2E60A 4Q47A 3IV5A 1H0MA 2J08A 3G2VA 4CDGA 4QQIA 2XF7A 3APCA 2VT3A 2DQLA 3H36A 4V19K 1V5FA 1ZYRF 3GLXA 1QZ2A 2V0PA 3PM1A 4RB2C 3L9FA 4J19A 3T0YA 4YG2F 1ZQ3P 4E6HA 5FB2A 4A4YA 4V3IA 5J4YA 3MX3A 3U21A 1UN9A 2L3DA 1OCZH 5EJGA 4IO9F 1ZG1A 3ABKH 5FKKA 4OU0A 5B1BE 3APFA 3GEZA 4O6JA 2X51A 2VBXA 3TWUA 2B7EA 2BXZA 2WA0A 2E2HJ 3E6BA 2YX4A 1IRXA 3FTYA 1FP1D 5FRNA 2HFHA 3FEYA 4KITB 3D9LA 3MJWA 3TWVA 5GPAA 2HVSA 2ZXJA 3ESKA 1U7FB 2XGXA 4RMNA 2CUFA 2RG8A 2IVMA 3EHNA 2QQBA 1ZBPA 1KZHA 4XIFA 4NIKA 1JHHA 3WTTC 2AXVA 2W48A 3LQQA 2EIJH 4XK4A 3KFWX 5IY5E 3ZUVB 1Y1VJ 3S16J 2I2AA 3QP6A 1IV6A 3BCAA 4ESFA 3NF1A 4ZC3A 4M6YA 3L08A 2I29A 2PJRB 3A2KA 3QYFA 4BY7J 2LF8A 3I71A 2DLLA 5FLVA 2PZIA 1PC2A 5AQAA 1JGSA 2A68F 2H6HA 3MKQA 1NK3P 3JRCA 2Q2EB 1LEBA 1LEAA 3GFMA 2K4BA 4KIBA 4AVPA 5HS7A 4Z6YA 2VPLA 1QHHD 4S0HB 1KZOA 1FC3A 3SJMA 2RKHA 1XSVA 2H8WA 1SMYF 3DEEA 1K6YA 4GTTA 4AC0A 4EJQA 2HYJA 4GAAA 3O8HA 4Q5SF 4A3TA 3UMZA 1BIBA 2IOSA 5LRSA 2LAIA 2WXJA 2JGRA 2IEKA 2L9NA 5FLXK 1D3YA 2JQ7A 1D8JA 4YIRX 2NRAC 1UN8A 2QYJA 1R49A 4ILHB 3S2HJ 3BY6A 2KXPC 3KLNA 1GVJA 3DSTA 1ZELA 2OPTA 3FUHA 1XCBA 4E7LA 4DOZA 3ABMH 4E7SA 4AM3A 5EZGA 3OYNA 3FXQA 1MHQA 2EINE 2UWMA 2DMUA 1P7JA 2GWRA 5DV5A 1TNUA 1KT0A 3HX1A 1N4RA 4XOTA 2X1DA 2V6EA 1XGWA 3DPLC 4RDUA 1FVFA 3R0AA 4GFBA 3TWQA 4EJVA 2IXSA 1RPWA 3ZMUA 1MMAA 2V5FA 1K3QA 3LSIA 1UOHA 3ZMZA 2LNBA 4B1RA 5AIJA 1Z7LA 2KJCA 1AHDP 2ZGGA 4YIIA 2K40A 3HSEA 1VQNI 4RVBA 4JONA 4PSXA 5IY5H 1HXIA 5H6QA 3RQIA 1A6IA 2CQ7A 1VQ5I 2IQCA 2L4AA 1YTYA 1OXJA 4MEXF 3L2CA 4JD2G 4N3BA 4LD5A 3H0DA 2LSUA 5DM7F 9ANTA 1XPXA 3R61A 2R7RA 1T08B 2LD5A 3S14J 2XPZA 5ENNA 3PEVB 1R1TA 3FU6A 5FQ8A 3UIOC 5F6FA 3JCUC 5IT9Z 4KYOB 1I39A 3KEAA 3RKWA 3GZ2A 3DSSA 4KIFA 4J8SA 3Q4AB 5FQ7A 5GP9A 4RB1A 2GGFA 1OCOH 4EM1A 4ABZA 4U07A 1HZ4A 3T8KA 3PNTA 5GADJ 3HOWJ 4X6AJ 2I2FA 3DBHB 1U7VB 1YE9A 1IXRC 3HPHA 1SFUA 1LE8A 1OR7A 3CZ6A 1ON1A 3M8EA 2WMOA 3BG1B 1MK2A 3R7RA 1RZ4A 3TO9A 1Z3XA 4FE4A 5HLHA 1O5MA 1MX2A 1NA3A 3KD7A 4LRZA 3DEPA 4YNDA 5DHTA 4X0GA 3BG0B 1DD1A 2FMYA 3NEUA 3EU9A 3WGHA 4XRMA 3BT9A 2R4GA 4OIQF 3CJTB 2WXPA 1OCCH 1TNYA 2FSWA 4HQDA 2Y4TA 3ONQA 4AJWA 2ZBKA 3B73A 3PIPF 1ZB1A 1U2VG 3ZPJA 1ZHFA 1IG7A 2DODA 2KIQA 1O7FA 1YX5A 4I76A 1KU9A 2BVLA 2IA0A 1JI8A 3BQOA 2W84A 1JHFA 2XCCA 2V26A 3DEOA 3RDIA 4KJZA 4BQQA 4C2TA 5EIDA 2QQAA 2HDWA 4NURA 5HQ8A 2M7BA 4KA4A 1STZA 2MA3A 3FXUA 1JKRC 1MNMC 2X3MA 4BHPA 2LKSA 1IYGA 1R00A 3BJOA 5HODA 4CZ2D 1X5BA 2DA6A 4HEA2 3HM5A 3ESLA 3K4JA 5KJMA 4ENKA 4ENJA 3IKVA 4IXAA 3H3VK 5B1AE 1VQ4I 4EVIA 3VTXA 3R60A 2L7KA 4CGWA 3GFJA 3O3KA 5E1ZB 1K78A 4A3DJ 1JCRA 2M8EA 4X1EA 2MLGA 4HQMA 2ME6A 1SC7A 1ELRA 2F8YA 4YVOA 3UNNA 3PRZA 4S05A 3B7UX 5ANLA 2HQ5A 4OAZA 4Y17A 1Y3HA 4PFOA 4BHBA 4RLQA 4EBAA 3FUMA 3OS2A 2DFIA 1MKMA 1LGPA 4FHKA 3F8FA 1A35A 5E3OA 1VQ7I 3PREA 3CHMA 4XX5A 3TGOA 5EJIA 2Q2EA 4Q96A 5FKOA 3MZLB 2BOLA 4CUGA 2DO7A 3W6VA 3PSIA 1V55H 1FMVA 3C3QA 1BI7B 3CO6C 2WADA 4AIJA 3TOAA 3ZQFA 4ZYDA 3ULQA 3K1PA 2DOFA 1PUEE 1ZN2A 4I09A 2A3SA 3QB2A 4AVZA 4A1SA 1E8YA 4I1MA 5D5VB 4IZZA 1FEXA 5LP0A 3V80A 4FQGA 5E18F 1OFCX 2XAUA 3N97A 3NWSA 2M45A 1H88C 3PO2J 3UXGA 4GMJA 3DEWA 2D5VA 2X48A 3L6AA 4I6EA 1YT5A 3VSKA 1BI3A 3ZHEB 3MYVA 2NS7A 4F91B 5DJOA 1XGMA 3WTUC 3CSFA 3BR1A 3OY9A 3PZ1A 4GXOA 1I1SA 4AV7A 4IRIA 1T98A 5LHIA 2A5EA 4JXTA 5E75A 1WH7A 2AXLA 1LDDA 3E37A 4TV7A 4I6JA 3WU1B 2MFZA 2PL2A 3ULEG 5ENOD 2A6EF 2LO6A 3ASOH 1R5HA 3VYSB 4A3BJ 2VGYA 3TP0A 3A01A 5C4XJ 5JVGF 1PP7U 4AM9A 1D1AA 3CD6I 1ULYA 3NAUA 1OLTA 2JRMA 3HB9A 4JOMA 4WCGA 1Z1DA 1Y0NA 1TW3A 1UCRA 1HLVA 4AU7A 3OYLA 4GMRA 4J8EA 5B1AH 2VTBB 4C3IJ 4BT8A 3CSTA 4KBQA 1TWFJ 1N11A 1AP7A 3VZCA 1WVRA 1IQRA 1IXVA 1IN6A 3HZJA 2PJRA 4B93B 1FOWA 1WZ2A 4JPSA 3CF5F 3F21A 4U8VD 4Y33A 5G04J 3TG5A 3RKXA 3T9KA 3PL8A 3GTOJ 2IT0A 4AOFA 2E1MC 2QVOA 1R21A 2I9CA 3FUNA 3DU6A 4Y3OA 4HRMB 4BWRA 3ZU7B 2Y31A 2GOXB 2E0IA 4XLEA 4F52A 2P8TA 3HGGA 3HHGA 3O2PE 2OEWA 1WKMA 3C3OA 2H09A 4AP2A 3IBEA 3P9CA 2VC0A 1UG3A 2M0CA 1K3NA 3HDDA 4GTSA 2JA7J 3ZMVA 5HRYA 1U9OA 2NS8A 4YFKF 4JA7A 1Q2ZA 2Q8KA 3UKGA 1FY7A 1E8ZA 3P9KA 3V8LA 4CCJA 3HOTA 2DA3A 3FXKA 1XX5A 3GMEA 3POAA 5FKLA 1SZ9A 5HS8A 3ZMDA 2O61A 4WWPA 2EILH 3BU8A 1BPOA 3KZIC 5FQ4A 3W9FA 2P9LG 2LG4A 3ZYQA 3O48A 4IX7A 1OWLA 2DZOA 3HYIA 1S8NA 3CEQA 3H1CA 3TWSA 1ACIA 1K3JA 3EJNA 5DTDA 1IN8A 2E36A 2NXNB 3HIFA 1EDUA 2X6FA 3DSXA 3E0JB 3MV2B 3IHUA 2KCLA 5D6FA 1ZK8A 1NZNA 4IVNA 1K78B 2I1JA 3EDTB 3PEUB 2YHCA 1FYKA 3V7RA 2F4IA 2F48A 1JUMA 3JTGA 3UPVA 2YX7A 2XPIA 1KU7A 2ZU6B 3FTWA 2MD0A 4BE2A 4G24A 3VYRB 4MLPA 3F6VA 1B9MA 1V4RA 5ILSA 1NK2P 1H19A 1MQSA 3SFZA 4L02A 2F37A 4OVVA 4XRFA 2EIKE 4B09A 4A0XA 5B66C 1ZLJA 3CVWA 2K9LA 4ANUA 2EINH 4U8HA 3I58A 3SXYA 3K70D 4Y6WA 2Z1DA 5J08A 2WB2A 5L3GA 2MC3A 2X6OA 4N2SA 4DYCA 1KQ0A 3L1PA 2VOPA 4HSTA 2HS5A 3IC7A 3SEZA 5EX3A 1QPMA 3CCUI 2AN1A 2JSPA 3TMOA 2FE3A 5IYBJ 2JRTA 4AIDA 4L2YA 2BHZA 2QSGX 1IDZA 4LNGA 5LCWJ 3QPSA 2KIUA 1DP7P 3BG3A 3GQSA 1TP4A 4U0ZA 4WRRA 2H6FA 4DX1A 2L9SA 3K6GA 2HEOA 4YIFA 2IONA 2IPQX 3KEYA 1MMDA 4BUPA 2VSOE 1MR1A 4BQNA 1HKTA 2KIMA 2YSRA 3HEFA 1O3QA 2VKDA 3MKRA 4OOIA 1UG2A 1SUWA 3D9OA 3ZN0A 4TXPA 2EV5A 5DHQA 5DCFA 4FLHA 1QU3A 1TEZA 3GZ5A 3C3WA 3KP2A 4HOBA 3VSLA 3WE2A 4YRVA 5D0OD 2OV8A 3EUHA 4LFUA 4C0EA 1G6GA 4EQQA 4IHVA 3V7SA 3W2WA 5J1UA 1K7AA 1KZPA 3P2BA 1S29A 3RKVA 1T56A 2R05A 1Z9CA 5CEDB 1BI1A 5DD4A 4WUYA 5ENTD 2HE0A 1WQ2A 1H6OA 2XPYA 4J00A 4BERA 2K3FA 2BKGA 3W9GA 4EJTA 1OCRE 4B4CA 1N0RA 3LVRE 4GZCA 5KJNA 1FTTA 3G6EI 4F55A 1QVTA 2JN6A 3ZYMA 4WAFA 3DITA 1QVUA 2KPMA 4J0UA 2V9VA 3MMYB 1INZA 1AOYA 4MQVA 3BEEA 5KAFC 3S7FA 3WU2C 4BY1J 2JT1A 4GCVA 4LNUD 4QWQA 4A3KJ 4A1GA 1W7PD 2XGDA 3CCRI 1DU0A 4B8XA 2F5DA 4WX9A 4HRIA 5JMND 2Y69H 4ABNA 2JKDA 1LD8A 3GUDA 1LFBA 1TC3C 2L7ZA 2EBIA 1ZG3A 3VWBA 4MQ9F 1TT5B 2W00A 4C3HJ 1CF7A 5FLXZ 3BJAA 1UJKA 3C72A 2EH3A 5M3MJ 1HS6A 2WXHA 2ZIRA 4UQXA 4P55A 2P5LC 1K1AA 2BY1A 4XR6A 5J6XA 3FIWA 2KLOA 2MYOA 3UM2A 1R7JA 1BL0A 5DEQA 1EF1C 3OTNA 3ZHEA 4B47A 1DGRM 2P9KG 2B0OE 1UFMA 3K4NA 4E7KA 2CV0A 3JXJA 3PH0C 4PS7A 3IH2A 4A6EA 4XLPF 1NTCA 4HV6A 4U88A 4ENMA 3PNYA 5ITZF 2QLZA 3RYPA 4N39A 2ILRA 2VXDA 1LVKA 2WTEA 2DJIA 1X3UA 3Q0VA 4AD9A 3HTUA 2LXMA 3OV8A 3FUKA 1SVLA 4I99C 1YRNB 2J09A 3M8JA 1MSFC 1ZGAA 2BYVE 5E17F 3HBLA 4PSWA 3EIJA 4K0RA 4A63B 1SVOA 1PAQA 2XKOA 3JRAA 2LP0A 2DA1A 1XC5A 1I27A 3DSWA 5KBAA 2WV0A 1IF1A 5J90A 1KHUA 1WV3A 4QIWN 2AFFA 1UZCA 3A01B 2UV1A 4U0SA 2VASA 2V1NA 1ZAOA 2LRDA 1ELWA 1G6NA 5ENRD 4BSXA 3BP8A 3ZYKA 2ETBA 1T33A 1O3RA 5EYPF 3S1NJ 3E4BA 2DIWA 3E1SA 3CVNA 5G55A 2RREA 3G1MA 1SFEA 2ZKZA 5B1BH 5KNHD 2AQEA 2OCEA 3QWLA 1D5VA 3CC2I 2VJ8A 4UV8A 1TQPA 5TGTA 1G3NB 5J47A 1S7EA 4G11A 4ACLA 4JIVD 3HXBA 3W2VA 4DZJA 4MLOA 3CP8A 1R22A 1MJBA 5FWQA 1MBFA 2G1LA 2R5SA 5H6RA 4DI3A 2OAZA 2XF6A 2XSDC 4NACA 3S8PA 4HLEA 2J9QA 2RKKA 2CQXA 3IXEA 2XRLA 2OF7A 5GAGJ 2LFBA 4XQFA 4GYOA 2GXBA 4HDUA 4YELA 5D5XB 1OPCA 2LBFA 2FO7A 1HXDA 1MMNA 1WFXA 1S70B 2KISA 4MRUA 1LUJB 4LLGF 4DLQA 1MW7A 4XL9A 1N75A 1YS6A 4G7HF 1NFIE 1MZBA 3MFKA 4A3CJ 2H1LA 1ZG5A 5KK1A 2XROA 5A7DB 3LKUA 2YHEA 3PUBA 4PFPA 4CCOA 2XGOA 4APFA 4MFEA 1ITYA 3KZYA 2BZTA 1UG0A 1IRFA 4CGZA 1ODDA 4JVSA 1U3DA 4I2ZA 2XPWA 4A3FJ 4JEHA 4UVCA 1Y8QB 2X6JA 1MIJA 2PMHA 2M4KA 3I9V2 3I6UA 5LD2C 3A1YA 1U7VA 3KIOA 1Q1VA 2HVQA 3C2BA 4XKBA 3ZMSA 2VODA 2HKXA 1HU3A 3G73A 3FX3A 2V1XA 1S72I 1AU7A 2KCKA 1G3YA 2WAEA 3FDHA 4UXNA 5DD8A 5A2QZ 3CMAI 1MX4A 2UY1B 1W5TA 5F27A 1H2UA 1TR4A 2DT6A 2M3AA 4BL0B 3ABME 3JCKC 3MDBA 1BM9A 2AQFA 1X58A 3ELKA 3FUDA 3WTSC 2R7QA 3KETA 3QWVA 1DP3A 4FASD 1F1ZA 1YYVA 3TOBA 5F04A 1E90A 1BI0A 1AKHB 3GF2A 2J4DA 2XAQA 1G3TA 3CQGB 3LDZA 2CUEA 5JVTA 1YYHA 2R93J 4CSWA 3SBTB 3HUFA 1IGNA 1TZLA 3FWVA 3C2HA 4LIVA 3OXLA 4HNTA 4HOUA 1VZ0A 4EHMA 5A23A 2HTSA 4ENNA 3LAPA 3OYGA 2M63A 3IKOB 3FTVA 5BUZA 3PFNA 3REOA 4WNFA 2XDVA 3CHPA 3DWLG 2N8GA 1IQUA 1ZREA 4IRHA 3CVVA 2AXUA 3S1MJ 1U9NA 2XCBA 4GO1A 3BUAA 3BZCA 1APLC 4A3VA 2WQ7A 1H8AC 5ANRA 1LTXA 3HOXJ 2KQRA 4MNUA 4QLCU 4D9VA 2CG2A 2CUJA 4MGRA 4HAOA 4KT6A 2R3SA 3L54A 3RU0A 5KJLA 1KGSA 3FFLA 1JT6A 1YI2I 1NI1A 4K03A 2FI7A 4K2EA 3I5UA 2KZTA 4BACA 2JPCA 2IA1A 5L3DA 1A6QA 2QF7A 1SD5A 2WXRA 1GVDA 5H7PA 2G7UA 2KKLA 3DSUA 1KYZA 1MD0A 1U7FA 5BMZA 4EBAG 2E1OA 1HH8A 2KDOA 3K69A 5JELA 3VLEA 1YRNA 4B0ZA 3OYHA 2GRPB 2NNYA 3CVYA 1UJ8A 3I56I 1H89C 2BV6A 5CEAA 3NQOA 5J40A 1Y3IA 1N9AA 1G8XA 4I2WA 4PDKA 1YHQI 2C0LA 4KYWA 5AJDA 2IS1A 3ZN1A 3OYJA 2JZYA 4B94A 2KCVA 2L5QA 2WQHA 2VPRA 1N4PA 2ZSHB 4DZPA 5L3EA 5CBOA 3E32A 5ICCA 1W7PA 5CBNA 4EGYA 1MJSA 3LY9A 3CTAA 2VLAA 4GA2A 1D8KA 1U2WA 1I3AA 1QRYA 3BZKA 3GZSA 2NS0A 4EATA 2DOAA 4JHRA 3S7JA 2E2EA 3APDA 2P2CP 3PVLA 1R23A 2JVGA 1JXSA 4BX9A 2V4HC 2V6CA 3VTYA 3WHCA 3JRGA 1IAWA 1DPRA 3JAMZ 4YFNF 4G7ZF 5FO5A 2E5NA 2DN0A 2QFCA 3HUEA 4LIUA 2VTBA 4HW0A 3GZNB 3PUFA 2QKLB 4NHJA 5HI7A 5F0HA 5M72A 1ZRFA 4GZ5A 1WG0A 3UKUG 2NVTJ 1FHRA 3AJIA 3I4PA 1WGXA 2PBIA 1Q1HA 4UVBA 3TWTA 3V8RA 1V54E 1RKTA 4D10C 1WLNA 5DHUA 2P58C 4UWHA 4DUIA 3MZHA 3PDNA 4HBLA 4FHJA 4ZDOA 3OYMA 4NBQA 1WH5A 1LVAA 4CH7A 5HVQC 2JA8J 2AXTC 3D1NI 4C3JJ 4ZTJA 3I64A 1NA0A 3QC1A 5EKQD 4A3JJ 1N4SA 2E1CA 4U96D 2YR2A 1USTA 2EQXA 2YINA 3GBGA 2NVQJ 3B02A 4XEIG 2P0WA 3H92A 2VE9A 3OXFA 4WXDA 2W25A 1ZU2A 3NBNB 3UNMA 3F22A 4FTHA 3M07A 4XOPA 4Y13A 3Q7FA 4MO7A 3I0NA 4A3MJ 3TEDA 5EYLA 1KYWA 4A3IJ 1VDYA 3HRAA 4AY6A 2ETAA 5FJ8J 3MEXA 1IN5A 4A6DA 3EUAA 1T0FC 3RRNB 4HVBA 1TTYA 1IUFA 2ZJQF 4TXQA 4DX6D 4UY8I 1UHTA 3DBLB 5HNHA 2QQ8A 1TNTA 5D8KB 2NC9A 2CHXA 3LPZA 3CP2A 1PJRA 4RGUA 2AS5F 2BY2A 5D4RA 5J8CA 3GTJJ 1C0WA 2MG4A 2IGKA 1Z5SC 2G0EA 3L2WA 3K7AJ 4XLCA 3SGHA 3TJPA 5M3FJ 3Q5FA 3RSNA 3ZCOA 3I59B 3ZMTA 4P9UA 5DHSA 3F23A 4CDMA 2OTJI 1JUSA 2DYSH 2WAFA 2VJ5A 1XDSA 3QWPA 4BAYA 1W4MA 3WG7H 3UKRG 5EGOA 2VN2A 3VPYA 5JR3A 2XGCA 1FT2A 4UWKA 1B8IB 2DDAA 2L2OA 2HXOA 1DNPA 3O4ZA 3WHBA 4FJYA 2FOWA 3TBIA 1YG2A 2RDPA 4BJ5C 4F6RD 4OYSA 3PNLB 3BCBA 4UUSA 1FPQA 1Z0XA 1QO0D 4GGGA 3RO3A 4W1UA 2HWVA 2L0KA 5E8GA 3MVPA 1GXCA 1QA6A 1JUPA 2X6WA 4RAGA 4BDZA 4XZ4A 5HDGA 4AIFA 3K4LA 4GCOA 1MBKA 3GWZA 4C9YA 2VB6A 2HDCA 3KYCB 3CUOA 5AIQA 3T5VA 4A0ZA 4N0BA 3Q7AA 2KFDA 1Z0ZA 2L4MA 5AYWD 4RLYA 4EGZA 3NWTA 2LY2A 2PQ8A 1BU9A 1T0FA 2PMUA 3S2WA 4CCNA 2WB1A 1T6SA 4FU3A 5DHRA 2VJ4A 1LD7A 3CCSI 3S7BA 3Q0WA 2JMWA 3DPUA 4U7EB 1P7IA 3HXEA 2R7FA 4CCAA 2IGOA 1SVXA 1QZYA 3KSLA 2Y1LE 3HRSA 2P81A 4UWLA 3VZBA 5LEJA 4RB0A 4BXXJ 1EYHA 3FXOA 1X2MA 1YX3A 2KRHA 4RAFA 5JHUA 3ULQB 4A5MA 5K7HA 3CDHA 1RW2A 3HXFA 4G8KA 5EX0A 4OINF 2XKPA 1SAXA 1IHGA 2IY0C 1EA3A 1Z77A 3CVLA 3ERED 4BYYA 4BEHB 3TW6A 3LJ3A 2P4WA 1BOBA 3CJQB 4GZ3A 2W3OA 4HBDA 3AU4A 2DMNA 2Y0SN 3AG1E 2EV6A 3BPVA 3TDUC 5LLQA 1SFXA 4OAYA 4IJAA 4BESA 1RKWA 3B7RL 2NOGA 3A03A 1W36D 4NQWA 1S6LA 1S0PA 2F8XK 5IYCJ 1Y39A 2X4HA 4RG6A 2HPIA 1BR4A 4HDVA 3G1OA 3CQCB 1OT8A 2KRFA 2EIKH 2NYJA 1V5EA 4R1HA 4XICA 1YA0A 2V1UA 4EEFG 5F0CA 2WBMA 2AW6A 4HNVA 2JLBA 4U04A 2YQ8A 4R9PA 2PMZN 3DPDA 1FHQA 1OCPA 2JUGA 2IGNA 3MZYA 4N4NB 2FBHA 4XKVA 5BS6A 4M9ZA 4DX5D 2JVHA 3H5RA 5HS9A 1ETYA 3PE4A 3U66A 1U0TA 3EUVA 3E5QA 2RQPA 2M8GX 2HTJA 3EIQC 4RSYA 2L7MP 3ZYLA 3RRMB 1W3BA 1G2HA 3LSJA 5E50A 2JABA 3SF4A 4HS2A 3VA1A 2HQAA 2LC1A 1YW7A 1CQTA 3UQ3A 2FQ3A 1HKQA 4BU2A 2HDDA 2W85A 1HO8A 2DMTA 2KKOA 2WXFA 4RAYA 3KEZA 4OAVB 2XEHA 4DX2A 1KONA 1R58A 1XG1A 3KT9A 1TQMA 4HF2A 1E8WA 4CT0A 3F0CA 2A5YB 2IS2A 4OWRB 4JC8A 1BIAA 4G6DA 4XLAA 3J7YJ 3OYEA 1WM5A 2KMUA 1KU3A 2F5EA 2VJIA 1FX7A 1U5TC 1D1BA 4RM2A 2DA7A 4ZDLA 2R7WA 2VGEA 1B1BA 3I4GA 1TNOA 2IS6A 3KS2A 3QKYA 1NP7A 4ETSA 4HRNA 5CVIA 4Y15A 4G8XA 3Q49B 4ZZDA 2LVSA 3ISPA 2JQJA 4HORA 3I59A 1OISA 2LDUA 1OYYA 3PSFA 2WXOA 4CDRA 3K2ZA 5DIZA 2RVCA 4EZJA 3H9JA 4X8QA 2AVPA 2QSFX 3ZPLA 3JXIA 4HOQA 5D2MC 2A69F 1TNSA 4FC8A 2KL4A 1W36C 3TWWA 4M73A 3ZN3A 1RR7A 4ON0A 2WM9A 1VFCA 4A3LJ 2KHMA 4FE7A 4A93J 1R5ID 2FJ1A 3URZA 1X81A 1GDTA 2FX0A 3CF2A 4FX4A 5DYMA 3OWTA 5C44J 3ISMC 4DIQA 2QV7A 2HXIA 1TWGJ 3OYBA 1T38A 1P5QA 2ZNZA 2GRQB 2Y48A 5ENSD 3ZKJA 4L9TA 1O3SA 3H9GA 2DPUA 1X1CA 2WC2A 2ZFUA 3IHYA 4CO8A 3BR5A 4OMZA 3QAHA 1XMKA 2X6YA 3CCMI 3ECOA 4I0BA 1W5SA 4G9YA 2E34A 3QYBA 2XEEA 4FJZA 3BPXA 2DBAA 3D9JA 1XMXA 5CLSA 3UI2A 4ATGA 4MTEA 3ZRHA 3BZ6A 1IC8A 1E3PA 1DU6A 5L3FA 3A0HC 3R0JA 2QA4I 1ELKA 4EJWA 1P92A 1WJCA 2YPRA 2PNNA 2OU2A 1NG7A 2M7AA 2Y75A 3ABTA 1WAO1 3G2WA 5BOXA 2MOWA 4JZYA 2P9IG 2Y9ZA 3PQJA 1HF0A 2DQRA 2ACJA 4UWGA 2HYGD 5E3MA 1QU5A 3J5PA 2LSVA 3KPHA 3S40A 2EFOA 4G6QA 5JLXA 4E70A 2STWA 1BW5A 5BNWA 2C0MA 2M34A 4HF1A 5A8IA 1ZRCA 3KYDB 2LNIA 2XUBA 2BBYA 4RS8A 1AWCA 4WWNA 4EECA 4XLFA 4BEHA 2CQNA 2MH9A 1QQIA 5TJJA 1SD4A 4FISA 1YQAA 4U7BA 2A0TA 3BG9A 3CVXA 4M6VA 2HYZA 1ERDA 2A4ZA 3V30A 2GRRB 3H35A 4KZCA 5K7FA 3KEQA 2DJNA 4O1PA 5LGNA 2DW4A 5FGMA 2V1DA 2ELHA 3LSHA 4L9NA 1E0EA 2EJRA 1J4KA 2KDZA 1WJEA 3PO3J 3RSEG 4WNEA 2GRNB 3ELSA 5EN5D 2M87A 3UN0A 3SYTA 1WY6A 4ITVA 2IF4A 2RV8A 1JTYA 2LK2A 3AAFA 3RQ4A 3WE3A 1VQKI 4XSXF 1TN7A 2ZXIA 1YW8A 2X38A 2JA6J 3OSGA 3HOSA 1T2KA 2HR2A 1E2XA 1DCQA 2L7FP 2DK8A 2ZXHA 1BA5A 4W97A 2O0YA 4QTRA 3FH7A 1VF9A 4IF4A 3W3CA 2XZTG 4BHCA 1AKHA 3W2AA 2R7VA 3MKYB 1WSUA 2IJGX 2ESHA 3G3ZA 3T8MA 3TP3A 3KX2A 5CRUA 4ANJA 4CHUA 2F0YA 4TUMA 1XMAA 1YS7A 2WV1A 2GOMA 3BG6A 3FZVA 3EUHC 3RKQA 1SZAA 4KT6B 4CXFA 1YIOA 3V31A 4GU5A 2R17C 2H27A 2DYSE 5D0QD 1OMIA 2E19A 3TL4X 4LK0F 2EH0A 3OYFA 3LA2A 1LFPA 4HNUA 1IJWC 2CGPA 2QBYB 2PEXA 4XNFA 3OYIA 4WWCA 4GTOA 3CC7I 2V4JC 3GW4A 2O6GE 2R59A 5KWDA 4ESBA 3ZQHA 2R7UA 3D3MA 3WG7E 1D8DA 1X4OA 4IHYA 1WDYA 2XS1A 3H5AA 3WTXC 2XQ0A 3SNXA 4PK4A 4PS3A 3KSQA 3DXKG 4PH4B 2P9UG 1O3TA 3BQYA 4PS8A 5IP9J 3HVEA 1I3QJ 3QYEA 3RCOA 4AXHA 4UB6C 3FM3A 2JJ7A 4WNDA 2P5KA 2DAOA 3M9AA 3OYKA 3BR6A 2R5YB 5JJ6A 4KU0D 2IA2A 1ZTRA 1IHBA 1UJJA 4XN0A 2XT9B 2YU3A 1LKXA 2Y0SA 3N05A 2IP2A 3FISA 3JRHA 1GUUA 1G4DA 4KXKB 3CMYA 2DT7B 2GIZA 5DS9A 3I3NA 2UXXA 1ZR2A 2K3PA 1SD6A 3CCQI 2HPMA 2KP6A 3H0GJ 1N54A 2BF0X 4K5CA 3PZDA 2HOSA 3K4MA 4GTPA 4WWOA 3D9NA 3SZ7A 2DTRA 4PCQA 1FSHA 1F9NA 4CGVA 2EB7A 4CZZA 5DCMA 5IP6A 5AIPA 2PMZA 2CFOA 3EETA 2RAEA 3IKTA 2K7LA 3NRVA 1Y8RB 2DPDA 4C48B 2QVLA 2J4BA 5HLTA 1J4OA 2FA5A 3RJPA 3UT7A 3FBNB 5KJKA 3I0MA 3V8QA 2VJJA 2XGEA 3L2UA 3PZ3A 2FO1E 2D1HA 4A2UA 2GA2A 1R9TJ 1MNEA 2OZUA 2X1CA 4JHJA 1T39A 4IQJA 1FYLA 5C4JJ 3FHNA 1L5JA 3BWGA 4JX6A 4Y4RA 2VONA 2VUMJ 2DYRE 3CVPA 1BD8A 4NC6A 1WPKA 1XB4A 1E3HA 3FTZA 4PJ0C 3HOVJ 1WI9A 3K9TA 4CYCA 3GTPJ 3BG5A 4DY6A 2HZTA 3LA7A 5G05J 1YGSA 4E7JA 2Z5UA 1JGGA 2XAGA 2PN6A 3HOUJ 3T5XA 1UAAA 2BEDA 4U0WA 2HKOA 1LE8B 3R9MA 3DEUA 3X2QH 4IEJA 2F2EA 3MKQB 1JJ8C 2R02A 5FTPA 2R2LA 3DTEA 3QU6A 3DF8A 5CVJA 2W24A 4JEUA 4HZFA 4F93B 5T8IA 4HPQA 2CUZA 3C3RA 3TG4A 3RK6A 2P6TA 3AG3H 1QGPA 3JSPA 1V55E 2J8SD 4FULA 2I5UA 4G94A 3W6JB 2MH2A 2XAHA 3Q79A 4I98B 3K2AA 4H4KC 4PJLA 4D5CA 2VSYA 2KRCA 5E3NA 4KDPA 3G1LA 5BV0A 3LXUX 1YJWI 1E7VA 2EZKA 4XLHA 3GTMJ 4Q69A 3V8MA 1XN7A 3QPLA 4GA0A 1I5ZA 4DI4A 1IUYA 4RLFA 2CQKA 2JK3A 3WTZA 3AG4E 3V7UA 3QP5A 4YDYA 3K1NA 1K79A 3J7AO 5CQGA 3KLOA 3JTHA 3SEQA 3GFIA 1R6RA 1MBJA 2FXAA 2MD5A 2R7DA 1V5GA 2R7SA 3HG0D 4XN3A 4KUMA 1D9SA 5CRVA 4ANXA 3TKYA 5KNLA 1MBHA 4A69C 2IOLA 4N5CA 3MAJA 3KP6A 3EHRA 5EG0A 2DFFA 2DA4A 2MW8A 2XRZA 1R4MB 2X9DA 4D7NA 3E5XA 5M5XJ 1HSJA 1LPQA 1J9IA 3I6WA 1S3JA 1GLNA 4CCMA 1H9TA 3EDPA 2E2IJ 4I6GA 2WY7Q 1V54H 1LDJA 3WGIA 5E76A 1HBXG 3DKYA 4HI9A 4W9RA 5EGOB 4U87A 3MCZA 2J49A 3D9MA 3X2QE 3FF5A 4ESJA 1Z6RA 2W57A 5K1YA 2OEVA 3V2XA 1TJFA 4PJMA 3PE3A 2QUFA 2YS9A 3DKXA 3T8RA 3GVAA 3GXOA 4CCLA 2OV7A 3S17J 2B63J 2IGMA 2HO1A 3IRQA 3FU3A 3AG1H 3M8FA 2PG4A 1IZ1A 2ZFWA 2ZSIB 4LLNA 2KBXA 3HVEB 2QY7A 4IKFA 1UHMA 1G3WA 3HPGA 3WGGA 2OA4A 3LSRA 3I55I 3L2RA 1Y56A 4ANVA 2QM3A 4M3EA 2H6GA 3QAQA 5JLWA 1VQOI 1HKSA 3IV0A 4RGRA 4B8CB 1JTXA 3GX4X 4JK1X 2O8KA 2WVIA 1A5EA 2CS3A 2ZNYA 1O1TA 4HG2A 5ICEA 4B48A 4DQ2A 1A5JA 5E1WA 1OWPA 1YMPA 2XHEA 1XGSA 1YITI 1N94A 2IEJA 2WAQN 2L54A 4UI9K 2XRYA 2ETCA 4R7LA 2PM6A 2GAUA 2Y4UA 3LYAA 1UHSA 2KZVA 4S04A 1REPC 3GYZA 4PUCA 3BTLA 3BLYA 4LGWA 5CVRA 3BR3A 1S9HA 4CCKA 3PUKA 5C1DA 5CMWA 4DJAA 1O7LA 5GPCA 3VEPA 3F72A 5HLIA 1USSA 1EJ9A 3ROUA 3FXJA 4GTMA 2WY8Q 1EF4A 3P5JA 3HHMA 4C9BB 5EJFA 1X3ZB 3CCVI 4O6FA 2ADUA 2CV1A 1I1GA 2MC4A 5D8LB 1FBSA 2BVMA 3QDNA 4KMOA 2VBZA 4WK8F 4Q94A 3M7GA 1TN6A 5T3RA 3F9KA 3P9IA 3TQNA 5C3EJ 1TNBA 4HX7A 1P4WA 2VBYA 2Z33A 1RETA 4EPZA 5FT9A 3V7WA 2EPFA 3F8MA 3TO6A 1JKQC 4CDNA 1QHGA 1W0TA 3M3YJ 3JUEA 3HRMA 4JIWD 5IP7J 1OWNA 2WQ6A 3FK7A 3E6DA 2CW8A 1E8XA 1GXQA 2DMPA 3OYDA 2FBNA 1X1AA 5LFAA 4L7TA 5KNGA 2HOTA 2MBFA 4KVMA 2DK5A 3ZRGA 4OIRF 3CK9A 3AFHA 2I6HA 1FPPA 1ETQA 3D5SC 2M5WA 5LGTA 1B89A 3DBRB 3O6BB 5GTHC 4BE1A 3S3MA 4IHWA 2E35A 5EILA 3ML6A 2LR8A 2E1MB 1BI8B 3BTIA 1MZCA 3NQPA 3DBSA 5LCWC 1WCMJ 5FKNA 4EM2A 1XSDA 2A5UA 2IO2C 2CH0A 1R71A 1QBJA 4LERA 5F1JA 4LG0B 1OCCE 1BC7C 4UQYA 2F5CA 4GDFA 3CCYA 2DZNA 2GRMA 3GZ1A 3DSHA 1IXSB 4E7HA 3CJRB 4FHTA 4BQOA 2WMNA 3JR9A 2K86A 3CO7C 1FT1A 3Q9NC 2PQRA 3HDXA 2VE8A 3JRDA 5CYVA 5E8IA 4EGXA 4BNCA 2E2JJ 3CESA 4FT8A 3KP7A 4NC8A 5KHDA 1TL8A 3ONLA 3V79K 4DX7D 2OUMA 4GZ6A 4GYGA 4N2QA 1EH7A 5LEKA 4XRSA 2D1VA 4ATZD 3N4MA 3F3XA 2ELKA 2FBIA 2XIGA 4ZYEA 4YDOA 1FOYA 2XVCA 3LVQE 3QNKA 5EIBE 2PFBA 2CW7A 2K9NA 3RO2A 3S1QJ 3ABKE 3LSGA 2IFUA 2EFQA 3PNVA 5G05C 2E5ZA 2QGUA 1D5YA 1HFAA 3TXNA 1FJLA 2VSNA 4KN7X 5EZHA 5FFZA 1ETKA 3KZZA 4N3CA 4FA6A 5EEGA 3L16A 4UB8C 3ZOBA 4I01A 4F7AA 2BGCA 4I2OA 2CFXA 2EK5A 2OVFA 4HSRA 5TRDA 4GPMA 4RAZA 4J8YA 3ZNGA 3FH5A 1FZPB 4QPQA 1VQMI 1BN5A 2COBA 1YFHA 2E7WA 2LOOA 4A12A 1ETXA 4I02A 4DPRA 4M9XA 1Z3YA 3VPRA 2B6CA 3B6CA 3NOCD 3U4TA 3G2SA 3GYHX 4L5IA 1U0JA 2RD0A 5JEJA 2JA2A 4BGDA 2X6KA 2IJLA 3G2BA 2QC9A 3CCJI 4JHKA 3OXGA 3GTQJ 4XMYA 5H2FC 2ME0A 3UOTA 2CFUA 2HVRA 2VYIA 1YJ5C 1JCSA 1TT0A 5BPPA 5IOZA 1BI2A 4D0PA 1AA7A 1FVHA 4CEMA 1XD7A 3ULYA 3SQNA 1NH3A 5FRMA 2VGXA 3ZGKA 1UELB 3GW2A 3ASDA 2BW3A 3CUQB 2BY3A 3S3OA 3L13A 1Y1WJ 2Q0OA 2ZJPF 1VQLI 3WU0A 3VB2A 1PUFA 4UUSB 3IAM2 4F7ZA 4P1WA 4KISA 2I8DA 3FMSA 2DYRH 3LA3A 1JJ6C 1OWOA 5E1XA 2LKXA 3VDXA 1IW7F 3GZ6A 2P9NG 2V9KA 3UNGC 3LAJA 3LSTA 1FOKA 2LXLA 3ML9A 3Q78A 4M3OA 1FP2A 3L17A 1OQYA 1D0XA 4ZDPA 3H3ZA 1MH4A 1P4XA 1N77A 3ASOE 3E3VA 3BOQA 2BUGA 3FTUA 4D5FA 4BTAA 3LCAA 2KJBA 2L02A 4I7HA 2K9MA 3WG9A 2X85A 1IO2A 4J01A 2NXPA 1MBGA 2V79A 3ENEA 1YOVB 4O60A 3V8NA 1DMZA 1XNFA 5IYDJ 3CKBA 4G1TA 3SDBA 5FINA 3SFXA 2K85A 5JEKA 1ORKA 1ETVA 3E5UA 3Q9VA 4BJ6C 5T4YA 5EG0B 3VYUB 3QJZA 2OBPA 2FNPA 4BSZB 2PLYA 2E7XA 4O1OA 4ASNA 1W0UA 2I2CA 3Q9UC 3AG3E 1OJLA 2KM4A 1XTAA 1YIJI 2OOEA 4GPKA 5F08A 4A3GJ 3N71A 5D4SA 1G59A 4C2UA 2R92J 2A6HF 1E96B 2X1EA 3KP5A 2I2OA 1TJCA 3FM5A 3O8GA 2H94A 2MRIA 3CK7A 1N0QA 3LY7A 3ONKA 3LMMA 4E6KG 4LCTA 2ECBA 2L0TB 3RI4A 2DFHA 2AHQA 3SO8A 1WRJA 1K6OA 4BX8A 2PM7A 3CHQA 3CVQA 1YLFA 1SFKA 4JX5A 1OY3D 1QBQA 4HI8A 4IQ4A 3MV3B 4DBQA 4U7DA 4ZTFA 3EHQA 4XLNF 4LB5A 1HOMA 3WXXA 1DUXC 2FUG2 4LMYA 3VOEA 3PZ4A 1R1UA 3UM0A 3S93A 5IT9K 4HOSA 2RNJA 2NAZA 2GRLA 2ID3A 1LJ9A 4RB3C 3ABUA 4R79A 3KYLA 2XAFA 1L3LA 2A5WA 3QOPA 3UM3A 3J5QB 3IAS2 3IWFA 4GTRA 1ZH5A 2D45A 2WWYA 1IN7A 3I0TA 3M1CA 2EQRA 1LDKB 4KIGA 1WJ5A 1PVEA 3E97A 1FNNA 2JTVA 2BTDA 3FWEA 2JPBA 3ZFWA 4N5QA 4UQZA 1Z7UA 2WXGA 3ECHA 2OQRA 3G71I 3DTKA 4Q4ZF 1K83J 4BTBA 1VNDA 4HOTA 4M72A 2EFPA 5F0FA 1SVMA 4BBSJ 1FCHA 3HSFA 5A2QK 5GTIC 3D9KA 2AXZA 2HOAA 3OMYA 3OYAA 5CVUA 5CMYA 3AKZA 1D0YA 4JX4A 4M3DA 5CVVA 5DUIA 2VQ2A 2BY0A 3VZDA 4AYBN 2ZISA 3HKZA 2V9PA 3U1KA 3K4BA 5IPAA 1RNLA 5D5WB 1TYQG 3NAWA 4L9PA 4UI9J 3SQVA 3K10A 4HB5A 3RTRA 2TCTA 1S64A 1RIOH 2EZLA 1OR7C 2R7XA 1U0RA 3B95A 4DRXE 5D66A 1Z6TA 3LY8A 3J7ZI 5CECB 5FZRA 5ICGA 1J75A 4AVXA 3EPZA 4BY6A 2V7FA 5FFXA 3FP3A 1YCSB 5BV1A 2K4JA 5E79C 1JKOC 2P5VA 3ZR8X 1X1DA 3UM1A 5ENPD 5J4VA 2JQLA 1BR1A 4L5EA 3WODF 3JRIA 2ZC2A 4BEPA 1KT1A 1HDDC 4NNJA 3RIBA 2W4SA 2CHZA 1O1RA 5JEMA 4BXUA 1FBQA 4BT9A 4XM3A 4HA8A 1VQ6I 1A17A 4P5OA 4D1QA 4U8YD 1FBUA 2M30A 3K4CA 4XE0A 1Z21A 5DBKA 3M4OJ 2Y0BG 1BW6A 2LREA 1BC8C 4EQFA 3FXRA 1U3CA 3CJNA 4KNYA 2KZGA 1FLIA 4I0AA 1IN4A 3RZDJ 1P9QC 4GYIA 3V8JA 1JWFA 2O9LA 2GW1A 4P9FA 2QZAA 3FTXA 2KC7A 3PQKA 4QCJA 1F36A 2PX9A 5JA4D 1K2NA 2CG4A 1FMWA 2OZ6A 1U78A 2MGQA 5G04C 3U9GA 4HQEA 3OR1C 1E7UA 4FADA 2IBDA 1HX8A 3CLQA 2DA5A 4DLOA 4U0YA 3IH4A 1MDMB 2LAHA 1FWZA 2ZMEB 1WJDA 3G2TA 4FP7A 4GYWA 4E85A 2NOJB 4HFGA 1J2XA 1UB9A 3E6CC 1H0AA 3M1EA 2VKVA 3F8NA 1LNWA 3NZSA 2XGMA 1RESA 3TWRA 2A07F 3UR3C 5L3BA 2QYOA 1ZARA 3TW7A 5EF6A 3PJRA 1M1EB 3DKWA 3QOUA 4KVOA 3ERMA 4O5VA 3EUKL 3HUGA 1SD7A 2OQGA 1FSEA 3C7JA 4G6TB 5HLGA 3JRFA 4WNGA 4A55A 3BJ6A 4Z68A 1JCQA 3C98A 4GMLA 4C2MJ 5GAEJ 3J81K 1H9GA 3K4KA 3NOGD 5C4VA 5LRRA 1GT0C 4IYPA 3JAMK 5JFRA 1UMQA 5J3LA 3K9IA 4ZJZA 4L1BA 4G26A 4F3VA 4JP0A 3CDLA 5EJHA 2XB0X 1X19A 4GTQA 1QNTA 4WF2A 4IHTA 2FOKA 3ZVVA 1BOAA 4XONA 1U5TB 2XASA 3OL4A 4M7CA 1MBEA 5FKMA 2GXGA 2W7NA 5LHHA 3U1DA 5IT3A 5JJTA 1ZOQA 4CYDA 5BT1A 1S7AA 3QRFF 5M5YJ 2O5RA 3L09A 3ZQCA 1UW4B 1EKEA 5L3CA 4IN3B 2LMDA 4C30A 4ZFHA 2LF7A 1IRGA 2DA2A 2B0LA 3E7LA 3FHZA 3MCXA 4PJNA 4EMSA 1X1BA 3R6SA 5ED4A 2BEOA 2J5OA 3UX4A 1D8EA 1JWGA 2P6SA 3UMVA 2Z2SB 5LHGA 3HRUA 2VI6A 3K0LA 5AQ9A 1CF7B 5ERIA 4M71A 5F1RA 1U8BA 2EIMH 1GW6A 3MKLA 1B4AA 2WXIA 1HSTA 4XKWA 3OS1A 1S63A 5D5UB 3IWZA 4OIOF 5FIOA 2LSOA 3FK6A 4B44A 5LOZA 4L0YB 3IUOA 1J59A 4O3MA 1ONVA 3BR0A 4PZJA 4Y6CA 4CYMD 3SFYA 2CSWA 5DDGA 3HRTA 2FU4A 1B9NA 1R36A 5EDNA 3F6QA 1XSXA 3CQZJ 1DVPA 3C5RA 2L6BA 4MS6A 1LGQA 2M4GA 2ZCWA 1N95A 4G8LA 4H7YA 3RYRA 4M6XA 1QNFA 2QCOA 2QBYA 3CMEI 4U95D 2O7OA 1DQUA 4IOAF 3QARA