2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
5E8GA 4MTDA 4N9HA 4A0EA 5D5VB 1IRFA 2R3SA 5JJ7A 5KJMA 1MJ9A 5BMZA 1KLXA 1J4QA 1AOYA 2CFXA 3BZ6A 1KGSA 1ZG5A 3KT9A 5AIPA 3SFZA 3F8CA 3EDPA 3CJNA 4CGWA 2IA1A 4B09A 4HF2A 2QYOA 4OU0A 4CO8A 4HDVA 2A6EF 4HLXA 5AIQA 4IF4A 1Z05A 5AYWD 2VSNA 2RGVA 2ISZA 2CGPA 3O3KA 2JQIA 3VPYA 2ZKZA 2Q2EA 4UV9A 5DCMB 3HUEA 2E7XA 1NZNA 2EB7A 2JRTA 3J7AO 3JTGA 3F8FA 5K5RA 4I9EA 5EKQD 5BNWA 5DIZA 2E1CA 2LKPA 2QENA 1F4KA 2PQ8A 4L5JA 4AIKA 1FBSA 2JQJA 4N2SA 1IYGA 2K4BA 4BH9A 3M1EA 4N9IA 5ARFA 2VOPA 2ZXJA 1HH8A 3Q9SA 1FHRA 4Y13A 3DP7A 3F8BA 3Q49B 2ADUA 2XGMA 1W7PA 3RDIA 4G7OF 5JVTA 1HW2A 4GA0A 4KDPA 2XPIA 4YG2F 5D6EA 4ENKA 4XSZF 4IN3B 2K4JA 4N39A 3F23A 2DFIA 1FZPB 3IHUA 3OOPA 3ZMUA 4M71A 5JI6A 2KJCA 4XBFA 3RYPA 1P5QA 3CK7A 1CF7B 2BRFA 4WNFA 2FBKA 1FT9A 1TW2A 3OXGA 1YW9A 4ZYGA 3QDNA 2R7DA 3OUNA 1FWZA 5G05C 3HSRA 2A0TA 4RB0A 3GYHX 1TQPA 3J81K 1RI7A 2EV0A 5JJ6A 4M73A 3SZ7A 3G73A 1LJ9A 1FOKA 4P9FA 4FX4A 2HKOA 4A5NA 1U6GA 1S7OA 3JAMZ 4F3VA 3RO3A 3MFKA 4RAZA 3MDBA 1FNNA 2BBYA 4QWQA 1O3RA 2MLKA 3I71A 5F64A 1P4XA 2K02A 5E1ZB 4DNCA 2BUGA 1YS7A 4R1HA 1KU2A 4HX8A 4WXCA 4U0UA 2L3DA 1SD6A 1H0MA 4I9CA 2Y4TA 4BXUA 4WWCA 2DK5A 4UI9J 3UQ3A 2F5FA 2LF8A 2JKDA 5FLXZ 1Z6TA 2ESNA 1B1BA 1R5HA 4RAYA 1KU9A 2XIGA 4AIHA 3GFMA 3HYIA 3FM8A 4IXAA 1E96B 2M8EA 2WTEA 2ONDA 2VGXB 3BROA 2Z5UA 4EGYA 1FP2A 2G7HA 3HUFA 4A1SA 2FI7A 1EH7A 1KQ9A 4HYEA 5EX3A 3VTYA 2WQHA 1KQ8A 1K2MA 4WCGA 5JJTA 2STWA 2FNPA 4KIBA 3CK8A 2XCBA 2VBWA 4OIRF 1BIAA 1EH8A 2E7WA 1XDSA 2R7FA 1OR7A 5L3FA 4GZ6A 1K6OA 4KN7X 2JLBA 4KUMA 1BM9A 2KATA 3ELVA 3RKYA 2HTSA 5TJJA 4U04A 1D8KA 3CO6C 3K1MA 2OQRA 1ZU2A 5L3CA 3LPZA 1QZZA 1SMTA 3WTUC 3UPVA 3R0AA 5FFXA 2PJPA 3BOQA 3MAJA 2JPCA 5CHEE 4HOSA 3KP2A 4XLNF 2EV5A 3CUQC 2D2WA 5HLGA 2YU3A 4Y17A 3GW4A 3K9IA 4MNUA 2HR3A 4AIJA 3I0NA 2VONA 3KLNA 2OZUA 4N3BA 4BWRA 1L0OC 1ELWA 5LEKA 5DV5A 5LRRA 3T1BA 2C2LA 3CVLA 1I5ZA 2Z99A 2GWRA 3RI4A 3URZA 1UFMA 1FSHA 1OYYA 1GHCA 3KD7A 1IN5A 1TNSA 2O61A 3KE2A 4I0AA 4YVQC 1J59A 2F5DA 4N3AA 3QOUA 4UUVA 1JE8A 1XD7A 4JHRA 1MZBA 2RNJA 5L3GA 1UHTA 3KP5A 1UB9A 2FBHA 4WK8F 2VSYA 3VTXA 4GCVA 1HKSA 2COMA 4EM2A 1R1TA 3P9CA 2QBYB 4HV6A 3WODF 3TKYA 5A2QK 2Z9OA 1J75A 4M9XA 2KFUA 4UNOA 1Z7UA 2DU9A 5FFZA 3GWZA 1P92A 3CUOA 3FF5A 1U5TB 3WTSC 3ZN0A 2KIUA 2VGYA 5J6XA 4ME2A 1MJBA 1IXCA 1BI2A 2VBXA 3LQRA 1REPC 5CVVA 3R6SA 3E6DA 3VB2A 3VA4A 2J9QA 3LQQA 2F5EA 2WWYA 3EETA 4UHTA 2LF7A 1T98A 2NS0A 1USSA 2XASA 3P9KA 5D4SA 3CUQA 3GYZA 3R9AB 2JT1A 1DP7P 2E1NA 2YX7A 4Y6WA 3LSTA 1KU3A 4EGXA 3PDNA 2VT2A 4HZFA 2EFQA 3P7NA 3KP6A 3Q9VA 3RKVA 2VE9A 1ODDA 4HX4A 3HRUA 5HS8A 3EQLF 1X3UA 3SF4A 3FHZA 3R4KA 2ZNZA 2QQ9A 4JA9A 3ASFA 3W6KB 2KCLA 1F9NA 3AS8A 2I6HA 4RGXA 4YFKF 3PE4A 1FC3A 5CVIA 3M8FA 2HR2A 3E5QA 2PL2A 4G94A 1QQEA 5D6FA 1FP1D 1LDKB 2O0YA 2W84A 4RGRA 3FXQA 3T5XA 3LY9A 3ISPA 1LNWA 1LDDA 2RC4A 4GA1A 4L9TA 3KLOA 4KYOB 1FPQA 3HTUA 4ABNA 4ZZDA 4WX9A 1YW7A 2A69F 4EGZA 1K78A 4I02A 1FBQA 2LNIA 3CTAA 1WWXA 4WXDA 3U3WA 5HDKA 3K1NA 5FZQA 3Q15A 2ZFWA 3F21A 2VC0A 1WQ2A 3T8TA 3K2ZA 3GZ5A 4MTEA 1D8JA 3ZN3A 4I7HA 4CGVA 1P2FA 4U0ZA 4G23A 2Y4UA 3GEZA 1XMKA 1YW8A 5LHGA 3U2RA 4EQQA 2H6BA 1R1VA 5DCFA 5LGUA 4U0SA 2L02A 4BAYA 3P9IA 1FSEA 1ON2A 5E18F 4EQFA 1T0FA 2CYYA 2P4WA 1C0WA 2FBIA 2YPRA 3I0TA 2PZIA 4BT8A 2IW5A 4S04A 5D8LB 4M9SA 1DMZA 1B59A 3V8JA 2X4HA 3TG4A 2OAZA 2NNYA 4UXNA 4AY5A 3V7RA 2HDCA 3ZPJA 3I59A 2STTA 4Q4ZF 2V1XA 5CYVA 4KMFA 5DEQA 4CYDA 3I0MA 3HRSA 2MC3A 3IWFA 2KC7A 2A61A 5ED4A 2FMLA 2H94A 2XUBA 5E1WA 1W5TA 2K27A 2DT5A 5DBKA 2FXAA 2RN7A 4R8HA 4F7ZA 4JA7A 1STZA 5EEHA 4IRHA 1GXCA 4LK1F 4M6XA 2OOEA 1WLNA 2VODA 4EJQA 1B89A 4O6JA 1HZ4A 1KQ0A 5CVRA 3V4GA 3ECHA 4MQVA 2DTRA 4FHTA 4P5OA 3Q47B 1BI0A 4RB2C 2FNAA 2W57A 1HXDA 2EFNA 3DPTA 4AWXB 4HAMA 2PI0A 2Y75A 4GO1A 3H3UA 2KB3A 1K3QA 2LNBA 3WTYC 4IPAA 3ASGA 1E17A 3ZFWA 1ONVA 4ESBA 1YA0A 1W7PB 4YIIA 3T0YA 1HW1A 4KIFA 2IFUA 5IT9Z 5D8KB 2QWWA 3DFGA 4KFCA 4IVNA 4O3MA 2WC2A 3WTZA 1K2NA 3F6OA 4LLNA 4HA8A 2LSVA 3I5UA 4LG0B 3GZ2A 3KAEA 3PE3A 2ZNYA 1E2XA 2XAQA 2GW1A 4CDGA 5E20A 1SFXA 1ZH5A 5HLIA 1K78B 3B73A 2BGCA 4O6FA 2OBPA 2Q8KA 1GXPA 3I4PA 1S29A 1J5YA 4QLCU 1UHWA 2H09A 3FP3A 3H3ZA 4FX0A 4BHCA 5ERIA 2CSWA 3F8MA 2FA5A 4AY6A 1J4KA 1SD5A 3L9FA 3IKVA 5E17F 5JHUA 2DQLA 3HUGA 3WU1B 2EFPA 1IF1A 3HIFA 4ZH4F 4ENMA 5DJOA 3ABUA 1JGSA 3W6JB 4GYIA 2GIVA 3E5XA 3U4TA 4O5VA 4Z2YA 5KJLA 2FRHA 1U3EM 5BPIA 2F5CA 3U1DA 1MDMB 4OIOF 5G04J 3V7CA 2CW0F 4UVBA 2KIMA 3K9TA 4M74A 5FD5A 5L3DA 1XCBA 5LCWC 4OOIA 4LD5A 5CLSA 2Y48A 3ULQB 3CVNA 3L09A 2LC1A 3F8NA 2O6GE 3J80Z 4N5CA 3F72A 2C0LA 3UNMA 2HTJA 3O6BB 4G6DA 4XIFA 1HW5A 3ELSA 3KS2A 3FWVA 3BY6A 3G3ZA 1XGSA 1UCRA 2CQKA 3FMRA 1FYMA 3T8RA 3M7GA 3KP4A 3Q5MA 3O2PE 2ACJA 4A0XA 1YLFA 5D4RA 1HKQA 4KNYA 2VQ2A 3TGOA 1CGPA 4I2OA 2DK8A 2J5PA 4ASNA 4KYWA 3Q4AB 1LDJA 2HWVA 2MH9A 5HS9A 2W3OA 1BIBA 4LB5A 4EV0A 3LY7A 5D5WB 1S7AA 3K0LA 1PP7U 3ZHEB 2VE8A 3SZPA 3RJPA 3J80K 1ON1A 3V8LA 1S6LA 2PN6A 2M45A 2P5VA 3QPHA 2OU2A 4KA4A 1I1SA 2EJRA 4RB1A 1J4LA 2DO7A 3L00A 4L9NA 2XV4S 1G6GA 2G1LA 1ZGJA 1DDNA 5EX0A 2HYFA 3UUXA 4I09A 1TBXA 4LEUA 3L7WA 4U7DA 1U2WA 5HLHA 1WSUA 2ZBKA 1W4MA 2W85A 1HSJA 1ZARA 4RS8A 2IJLA 5ILVA 2UWMA 3DPLC 1QPMA 2V9VA 5E8IA 1H9GA 4J8DA 3M8EA 2OZ6A 1QQIA 1SD4A 2J5OA 1U8RA 1R58A 2L4MA 4CDRA 4ZYEA 2UY1A 5ARGA 1HKTA 4G2VA 4AVPA 3BP8A 3WTWC 4H0EA 4XI0A 4ESJA 5K1YA 2DLLA 5FD6A 4H7XA 2PLYA 1BC7C 4HF0A 1PUEE 5LHIA 3DKWA 1IRGA 1AWCA 4HV5A 5CVUA 3CVQA 2HYGD 4GGGA 2GXGA 1FX7A 4KIGA 3JYSA 4EJWA 3KETA 3KEOA 2X0LA 3HHGA 1LGQA 4A0YA 3LA3A 2ETHA 4GCNA 1FLIA 4EJOA 2XAFA 5ILSA 3RKXA 3HTSB 3HX1A 3UNNA 1G3TA 2ZMEB 3NRVA 4DQ2A 4LG0A 1OPCA 3MZHA 2PEXA 2HS5A 4ZZLA 2MLGA 4BTAA 3TDUC 4NB5A 4L18B 1ZRFA 2XRNA 3JAMK 2L54A 4NQWA 4ESFA 2XEVA 1QBJA 4CXFA 3N71A 2AVPA 2NC9A 4WNEA 1V3FA 3OXLA 3DEUA 4KT5C 3I6UA 4IHTA 3HRTA 2MHKA 1MZKA 4OMYA 5H20A 1QO0D 3FMSA 1ZLJA 2YX4A 4LGWA 4HOQA 3V7SA 3POAA 1KA8A 5BQTA 2B0LA 2FE3A 2FU4A 1T2KA 3I6WA 3GZ1A 4H87A 1K79A 1XSVA 5A2QZ 1R21A 4I2WA 2FSWA 2E2EA 3F3XA 2IRFG 1TLHB 3TG5A 4U0VA 3RIRA 3LCAA 2RKHA 4HOTA 1HSTA 3NEUA 1KU7A 4LB6B 2VBYA 2CSOA 2IPQX 4KN4X 3CUQB 1W7PD 4WF2A 3ML6A 5ICGA 2DI3A 4XSXF 3MWMA 3TAXA 3HSEA 1U5TC 2AXLA 4OIQF 1LB2A 4G1TA 5FLXK 1ULYA 1JXSA 3GUDA 3FM3A 2VT3A 4CHUA 1K3NA 3MCZA 3DV8A 1USTA 3LYAA 3K1PA 3ULQA 1QNTA 3ZQ7A 2KKOA 3AS4A 3B02A 1KYWA 2FBNA 4MHGA 1BI1A 1XGMA 3RPQA 1A17A 3L2CA 1LQ1A 2O03A 4G7ZF 1SMYF 3PFIA 2BE5F 4G25A 1S3JA 5D0OD 4HW0A 3LA2A 2A07F 3SXYA 3TOBA 1A04A 1ELRA 1B9NA 3CV0A 1TTYA 1J0RA 5IT9K 4GPKA 4HX7A 1R22A 3LAJA 1TQMA 3F22A 4IJAA 1ZG3A 4JBAA 1MDMA 1UJXA 4BNCA 2IA2A 2IP2A 4OIPF 4P9UA 2DBBA 4EJTA 2R5SA 4UI9C 2DPDA 1T39A 1ZLKA 1DPUA 2K7LA 2GQQA 2ZMEA 5A6CA 1XGNA 1WKMA 5HQ8A 3I58A 3ASDA 3UV0A 4XI9A 1BBYA 2IF4A 2YSRA 5KVRA 2KJBA 1YIOA 4M72A 2P58C 3FZVA 3OV8A 4H7YA 3QWWA 2A6HF 5FTPA 3ELKA 4YFXF 1G3WA 3FM5A 5LCWJ 2P6SA 3D0SA 3GX4X 2F2EA 2RDPA 3BJ6A 5FGMA 4LLLA 1Q1HA 1IHGA 3KP7A 2UZKA 4UI9K 3WGGA 3WTXC 2EK5A 4BHBA 1YS6A 1OYIA 3PQJA 2XGOA 3UMZA 1G4DA 1XSXA 1QU5A 1YG2A 3QRFF 1SD7A 5FZRA 3N4MA 1O7LA 4W9RA 2OQGA 1I6XA 2QZ8A 4PGGA 3ABTA 3C18A 3M9AA 1U5TA 4M6YA 3ZMZA 4XRFA 4ETSA 1D3YA 2HQRA 2QQBA 2M87A 1IW7F 3WGIA 3JSPA 1J7KA 2C6YA 2A5YB 2VOOA 1FY7A 3KP3A 3GLXA 1ZREA 3GW2A 4I0BA 4K2EA 4AD9A 4JK1X 1ZGAA 3FWEA 3JSOA 3QU6A 1T6SA 5DD4A 2MH2A 4MEYF 3FX3A 2QFCA 4A6EA 4Q47A 2VGXA 3MKRA 5LRSA 5FJYA 3BJAA 4B94A 2BYVE 2FF4A 3H92A 2K86A 1I27A 3WXXA 4EM1A 2JSCA 2WV0A 2ISYA 4HOBA 5ICCA 1EV7A 3RKWA 4HQEA 1RUOA 3VODA 1XGOA 3F6VA 2M5WA 4KMUX 2Q7FA 3AS5A 2L01A 2PMUA 4L5IA 1GVJA 2XAJA 2Q0OA 3QKYA 3VA1A 1G3SA 4KBQA 1R36A 4U0YA 1FYLA 4PZJA 5A7DB 1Y0UA 3TQNA 3QAHA 1BI3A 1H9TA 4EMSA 4E70A 2FEZA 1OYWA 4N0BA 3JTHA 1IN8A 4RGSA 1OKRA 1R00A 1JHFA 2OA4A 4UVCA 2H27A 2EFWA 4XLPF 3IC7A 4JQFA 3BJOA 3LFKA 2HO1A 5BOXA 2EWNA 5DD8A 1G6NA 3GO5A 3BEEA 1J4PA 4KXKB 4UV8A 3GFIA 4AIFA 3SZTA 3ECOA 5BS6A 1F1ZA 3V8KA 1RUNA 3LA7A 3IEGA 3UOTA 4IHSA 4G2SA 4WUYA 4ZYHA 1D5VA 4A0ZA 2FMYA 3R0JA 5CJ9A 5EEGA 4HDUA 4P55A 2EV6A 4RG9A 2YR2A 3KFWX 2UXNA 3E6BA 1HXIA 5LLQA 4U0WA 1OMIA 3HYMB 4UVAA 4LFUA 2D45A 4I17A 2TDXA 4HF1A 2GZWA 3S7DA 3COAC 2VN2A 3GFJA 2O8XA 2PQNA 3IKTA 2XGXA 4GYYA 2XROA 2MBFA 2L4AA 2Z3YA 4LLGF 2V1DA 1RZ4A 1Y8MA 1GXQA 5H6QA 3PO8A 2EFOA 1Z91A 3ROUA 2BEOA 4HBLA 1IN4A 4A12A 1YO5C 1BN5A 1TQIA 3WE3A 4G6QA 4HQMA 1LEBA 4ENJA 3FXRA 3CO7C 2LSOA 4AM9A 3RIBA 3CLOA 4LJZF 4A2UA 1KT0A 3FXUA 1XNFA 4G24A 3KZZA 3GF2A 1G3YA 3O48A 1MJAA 4G7HF 3HOSA 3KZYA 3WTTC 3K69A 4RGUA 2ZCWA 4N3CA 3WU0A 1WAO1 4L0ZB 2XCCA 3GFLA 2LDUA 1OUVA 5HVQC 2QVOA 2VYIA 4U7BA 2ZJ2A 1FCHA 1O57A 1O7FA 2PG4A 5C1DA 1YTYA 2VBZA 2H6CA 2KIFA 3VFZA 1RNLA 4G8XA 1DUXC 3FMQA 3MV2B 1O3QA 4YVOA 5LHHA 5CVJA 5L3BA 5FB2A 4ON0A 3SQNA 2XT9B 1LEAA 2P7VB 1QZ2A 4Y6CA 2FQ3A 3E97A 4Q48A 2FO7A 1NA0A 3HOTA 1B9MA 4APOA 5DUIA 3RJVA 5J8CA 3TO6A 1YYVA 1W5SA 4BYYA 2P5LC 2DQRA 5CCLA 5K5QA 1LGPA 1YQAA 2NYXA 2D1HA 5KJKA 3ESKA 1J9IA 1SAXA 4J8EA 2C0MA 3N97A 3MEXA 1K7AA 3GVAA 2IT0A 2MD5A 3EYYA 3QWVA 4YIFA 4NHJA 1FBUA 3QOPA 4RG6A 4MQ9F 2AFFA 4CGZA 2JQLA 4KICA 2HGCA 2HOEA 4UQZA 3KEQA 3ZMDA 4EJVA 5J8FA 4G26A 1K3JA 3TDZC 3QP5A 2CWEA 2UY1B 5HDGA 4BQAA 1SFEA 2UXXA 1FHQA 2V6CA 3BPVA 5ICFA 1WRJA 3RTRA 3HRMA 4EJUA 1B6AA 2KCKA 1NA3A 1HBXG 3GQSA 4J8FA 4WNGA 3E5UA 1R1UA 1XMAA 1P4WA 1ZAOA 1R23A 3E4BA 2HQNA 3UN0A 3IWZA 5ICEA 6PAXA 4HOUA 4HLYA 4NQ0A 5HDNA 4IRIA 2PBIA 1YJ5C 4R79A 3D5LA 4S05A 3LKUA 2RV8A 4LK0F 1BC8C 3RPUA 3QWPA 4D0PA 2VC1A 2V79A 3HHHA 2XVCA 1SFUA 2RQPA 3IL2A 4ENNA 5LBQA 2XKPA 1DPRA 2GXBA 2JPBA 1WM5A 1BJAA 1MKMA 3C7JA 4PGHA 3DQVC 1IXSB 3I64A 5TRDA 4N2QA 4OINF 2HZTA 5KJNA 2XHKA 2KB4A 3U9GA 2P7CB 5M72A 5DYMA 2KRFA 3WGHA 1O3SA 1WV3A 2P8TA 4OMZA 3MV3B 3EUHA 5FO5A 2A68F 3ZP5A 2M1BA 3IRQA 2HYZA 5CCMA 3QPTA 1R7JA 2L6JA 3CKBA 2VXZA 4BT9A 3R61A 3JW4A 5JR3A 1YFHA 1T38A 3GXOA 4WNDA 1MD0A 5E50A 3LWFA 3R60A 4J0UA 2W24A 4CICA 1L3LA 4M9ZA 5F1RA 3DXJF 2IA0A 1IZ1A 5G04C 2XAGA 4ZYDA 4I1AA 3ZPLA 2WPVA 5A8IA 2PFBA 4A6DA 1ZBPA 1IXRC 2HEOA 4LMYA 5HOOA 2KKLA 2EA4A 3WTVC 1ZRDA 2EA2A 1ZN2A 4IRGA 1O3TA 3ASHA 1V4RA 4CZZA 3ZN1A 1UHMA 5H6RA 3HSFA 2M30A 1R5GA 1IN7A 1I1GA 2DPUA 2JZYA 3FFLA 1CF7A 1IUYA 3BPXA 2DAOA 2DBAA 4GZ5A 5BT1A 2ELHA 3RYRA 3LY8A 5D5UB 1PC2A 3I53A 4UQXA 1LVAA 5FT9A 1TW3A 2HKXA 3OXFA 2GA1A 4B8XA 4RB3C 3CKCA 1XB4A 3NQOA 4GZ3A 3EYIA 1TJCA 4A5MA 3EDTB 4MEXF 3TOAA 1ZYRF 3S2WA 5DDGA 4EVIA 4YFNF 3RO2A 1YJMA 3QU3A 3MA5A 3VEPA 2GA2A 4L9VA 4YNDA 3NF1A 5G05J 4I01A 4PCQA 3WG9A 5L3EA 4NRHB 3ZMSA 2NNNA 4Q5SF 4MGRA 5K5OA 3J81Z 4I2ZA 1J4OA 1J2XA 1KT1A 2XAHA 5BPDA 1IN6A 1ZG1A 2W25A 2ESHA 2LSUA 3ERED 3E3VA 5IT3A 3Q5FA 2PQRA 3CK9A 3LAPA 1U78A 3SHFA 2YHCA 5LGTA 2CO5A 1P4AA 2KCVA 3TGNA 1G3GA 1VTNC 2G7UA 5AONA 4P96A 2A3SA 2NAZA 5FZSA 2GAUA 3MEKA 4GYOA 3TO7A 5DUKA 4JONA 2XKOA 3ZMTA 4I98B 3WE2A 1Z1DA 3CEQA 3E6MA 3S7BA 1EH6A 1XN7A 2IVMA 3BDDA 4EM0B 3KCCA 1MGTA 3C1DA 1Z6RA 4PDKA 2QBYA 2P6TA 1NHAA 5D0QD 3PQKA 4GCOA 1QGPA 2CG4A 2D1VA 4BTBA 5DCMA 1B4AA 5KK1A 3TO9A 4G9YA 1QZYA 4JL0A 4Y15A 1Z9CA 2OD5A 2HFHA 1KYZA 2O3FA 2Z33A 2JTVA 2QM3A 2MA3A 1RIOH 3REOA 3DF8A 5JFRA 2UWJG 5LEJA 4FT8A 1TNTA 2PIEA 3IRRA 3S7FA 1ZRCA 5HI7A 1FYKA 3E6CC 2YQ8A 3CDHA 5D5XB 2FOKA 3CVPA 4UQYA 1W3BA 2Y0MA 3AAFA 1XCVA 4L0YB 5LGNA 1F5TA 2AS5F 4U88A 2XGSA 4GYWA 3GZ6A 3QP6A 1WI9A 3I54A 4TV7A 5HS7A 4D9VA 1P6RA 4L9JA 1IAWA 3I59B 4GXOA 1PP8F 5E1XA 2RVCA 1S8NA 4HORA 4BHPA 1XDUA 2ZO4A 3VOEA 5BW8C 2DW4A 3ZMVA 1XSDA 3C3WA 3ZGQA 4U07A 4WXHA 4GA2A 2NRAC 1PDNC 1HQCA 3ZHEA 2EH0A 2JPEA 3S7JA 2G9WA 2QUFA 3MZYA 5ILUA 2PMHA 5F6FA 2QLZA 4QCJA 1JHHA 3RU0A 4GYGA 2V1UA 2P5KA 2QQAA 2V5FA 3BWGA 2BV6A 1BOAA 3MQ0A 1ZHFA
chains in the Genus database with same CATH superfamily
4GZCA 5E8GA 2ZFUA 1OCTC 5EYPF 5FLVA 2Y0BG 1HA8A 4MTDA 1YGSA 3S40A 4N9HA 4JIWD 4KITB 4A0EA 1XS9A 3L16A 5D5VB 2OV8A 3PO2J 1IRFA 2R3SA 3MN2A 5JJ7A 5LD2C 1MJ9A 5BMZA 3RZOJ 1F36A 1AOYA 2CFXA 2CUFA 3BZ6A 3U21A 1KLXA 1KGSA 3JCUC 3HOVJ 4K03A 1ZG5A 3KT9A 3GTQJ 2JK3A 5AIPA 3RPUD 4XRSA 3SFZA 3DEEA 3F8CA 2VL8A 3EDPA 5HNHA 3DBLB 3CJNA 3PH0C 4CGWA 2KMUA 1P7JA 2IA1A 4B09A 4B4CA 4HF2A 2QYOA 3MD2A 3ZKJA 3BU8A 4OU0A 2IS2A 1AP7A 3DBHB 4CO8A 4HDVA 3FTYA 2A6EF 4BESA 2DYRH 4HLXA 1T95A 5AIQA 2D5VA 4IF4A 3IH4A 3PZ2A 2XPWA 2CFOA 2DJIA 1Z05A 5AYWD 2M3AA 2VSNA 2RGVA 3GMJA 3AG4H 1ZOQA 2Y69H 2DOAA 3LNQA 1LPQA 2L7FP 2P9KG 1PUFA 4LOCA 2ISZA 4PSWA 2CGPA 3HBLA 1T0FC 3O3KA 2E2JJ 3CZ6A 2ZGDA 3WG7E 1ENHA 2JQIA 3S32A 3VPYA 2ZKZA 2K3PA 2Q2EA 4UV9A 5DCMB 3UM3A 3HUEA 2E7XA 1NZNA 3UI2A 2EB7A 2DA6A 1B8IB 3E30A 4C2MJ 3X2QE 2JRTA 4CCKA 3J7AO 3JTGA 3MGBA 3F8FA 3U9WA 5K5RA 4I9EA 1WFXA 5EKQD 3DBSA 1IDZA 5BNWA 3I3NA 3Q79A 2XPUA 5DIZA 2E1CA 5AN8A 2H8WA 2EH3A 2LKPA 2EBIA 2LLKA 2QENA 2ZXIA 1F4KA 1OWMA 2VQHA 2PQ8A 4L5JA 3ASNH 1ETVA 1FBSA 4AIKA 1TN8A 1RKTA 4N2SA 1IYGA 2K4BA 4BH9A 1N94A 3M1EA 3PNLB 5T3RA 1D8EA 4N9IA 5ARFA 2VOPA 1ETOA 2XDVA 3ZXSA 2ZISA 2ZXJA 1HH8A 3FTUA 3PSFA 4NDLA 3S2DJ 1JPLA 3EUVA 3Q9SA 1FHRA 1UHSA 4Y13A 3DP7A 5FRNA 5FQ8A 3V79K 2R7WA 4MO7A 3F8BA 3Q49B 2ADUA 1TL8A 4CT0A 2DMUA 1HCRA 2XGMA 4B48A 1W7PA 2GRNB 3RDIA 4G7OF 5GP9A 5CBNA 2PJRB 5JVTA 2ME6A 1OT8A 4OWRB 2GLOA 1HW2A 1GDTA 4GA0A 2CV2A 4LIVA 4KDPA 1MSEC 2XPIA 4PDXA 4YG2F 5D6EA 4ENKA 2JEKA 4UUTA 2R7VA 1WPKA 4E6KG 4XN0A 1LTXA 4XSZF 2HVRA 5B3SH 3BR2A 2Z2SB 4IN3B 4KT6B 2K4JA 1U7FB 4N39A 5J40A 3F23A 4V24A 3T8MA 2DFIA 1FZPB 1MH3A 3IHUA 2F4IA 3OOPA 4J01A 1E7VA 4A63B 4K5AB 3NARA 3MZ8A 1JUMA 3ZMUA 4A3IJ 2JQJA 4M71A 5JI6A 2KJCA 3EUKL 4XBFA 2CV0A 3RYPA 1P5QA 2WADA 3PNTB 3CK7A 1CF7B 3QK0A 2JUGA 3H9JA 4WNFA 1B72A 2BRFA 2FBKA 5EIBE 4AV7A 1FT9A 2CW8A 3FDHA 4DYCA 1TW2A 4FTHA 2IQCA 3OXGA 1RKWA 2DYRE 2HDDA 1E8XA 1YW9A 3VZBA 4BS9A 4ZYGA 3QDNA 2R7DA 4QFVA 3CCEI 3OUNA 4BY6A 5J1UA 4ZDLA 4EATA 3H0DA 1FWZA 5G05C 3CJTB 3HSRA 4RB0A 1OWOA 5FWQA 2A0TA 2QVLA 3GYHX 1BU9A 1TQPA 2E71A 3V8MA 1UMQA 3J81K 2M9HA 1RI7A 2EV0A 1ETKA 3LSKA 2CQXA 5JJ6A 4M73A 3SZ7A 5T8IA 3G73A 2R7ZJ 4DX5D 1LJ9A 3OMYA 1FOKA 4P9FA 1FTZA 2DJNA 4FX4A 1U3DA 2GXAA 2L0TB 1H89C 2HKOA 1LVKA 2M34A 4A5NA 1U6GA 1S7OA 1IXVA 2DMPA 5F27A 2WXPA 3JAMZ 4F3VA 1U7VB 3RO3A 1IQRA 3MFKA 1H6OA 4RAZA 1EF1C 3GTJJ 4M7CA 3MDBA 1FNNA 2BBYA 4U96D 2ID3A 4QWQA 5CPRB 1O3RA 2MLKA 3I71A 5AARA 5F64A 1P4XA 2K02A 4UWKA 5E1ZB 1MBGA 1SAUA 4DNCA 1LF8A 1YS7A 2BOLA 1JUQA 2BUGA 3WHCA 4NNJA 4R1HA 5LX8A 1P9QC 3K7AJ 1KU2A 4HX8A 4WXCA 2WMOA 2L3DA 4U0UA 1GLNA 1SD6A 1H0MA 3GTPJ 4I9CA 4RMNA 2Y4TA 1KZHA 4BXUA 3G2UA 4WWCA 2DK5A 4TRQA 4UI9J 3UQ3A 4AVXA 2F5FA 2LF8A 3FBNB 3K4JA 5J4YA 4MFEA 1X3ZB 4MFDA 5HLTA 4I6GA 2JKDA 2CUEA 5FLXZ 1Z6TA 2ESNA 3D9JA 1B1BA 1R5HA 5E3NA 2Y9YA 4RAYA 1KU9A 2FULA 5CERB 2XIGA 4XX5A 4AIHA 3GFMA 3JQ0A 3HYIA 3FM8A 4IXAA 1K1AA 1E96B 2QKLB 2M8EA 2VTBB 2WTEA 1VQNI 2J07A 2ONDA 2XGEA 3BROA 2Z5UA 4EGYA 1N78A 1H2TC 2VGXB 3UTMA 2A4ZA 1FP2A 2G7HA 5K7FA 3P1UA 4D1QA 1F43A 4JPSA 4A1SA 1X3WB 2NVQJ 2R92J 2FI7A 3HUFA 1EH7A 1KQ9A 4HYEA 3SJMA 4E7JA 5EX3A 2B0OE 3VTYA 5F1JA 2WQHA 1FOXA 1KQ8A 1U0JA 1K2MA 3A2KA 4ILIA 1FOWA 3RRNB 4LNUD 2KP6A 4WCGA 2IS4A 5JJTA 2STWA 2FNPA 1R4NB 4KIBA 3CK8A 2XCBA 2DT6A 2Z16A 1FJLA 2QGUA 2VBWA 5ENRD 1PUFB 4OIRF 1G88A 3IBEA 1BPOA 1BIAA 4XMYA 4I1MA 1EH8A 4O60A 4D7MA 5AENA 1ETQA 2E7WA 1A31A 3ABLE 1XDSA 2R7FA 3CCYA 2WB2A 5H7PA 1OR7A 3CIAA 2R2LA 1D1AA 2DA1A 3HM5A 4RLQA 1E8WA 5L3FA 4GZ6A 1K6OA 1HX8A 4KN7X 3FBIB 5DM6F 2R17C 1IDYA 2JLBA 2CRGA 4KUMA 1BM9A 3VYTB 2KATA 3ELVA 3RKYA 3DU5A 3FU3A 1IUFA 2B7EA 2VJIA 3IV5A 2WXMA 3GTMJ 3Q7AA 2HTSA 2VKEA 5TJJA 4U04A 2R5YB 1D8KA 3L22A 3EPZA 3I9V2 3CO6C 4RM2A 2HU9A 2JA8J 3K1MA 1XMXA 2WBMA 1H6PA 2OQRA 1ZU2A 3VSKA 5L3CA 3LPZA 1QZZA 1RR7A 1SMTA 3NWTA 3G4SI 1RRJA 2KBXA 5ENNA 3UIPC 1LKXA 2DCEA 5IPAA 3VLFA 3K2AA 3WTUC 3CCRI 1W1WE 2DCPA 3UPVA 3KEZA 4BDYA 1JCQA 4HBDA 2X6FA 2UV1A 3R0AA 1NK2P 5FFXA 2PJPA 3HOZJ 3BOQA 3MAJA 2JPCA 5CHEE 1N9AA 3KP2A 4XLNF 4C30A 4HOSA 2EV5A 4G8LA 3CUQC 2D2WA 5HLGA 2YU3A 4Y17A 1U8BA 2TRTA 3GW4A 3K9IA 1NK3P 4MNUA 2CQ7A 2HR3A 5B1AH 3L13A 4A93J 4AIJA 1A5EA 4FCYA 2VONA 3SD5A 3KEYA 3AFOA 3I0NA 1WJFA 2BZTA 2L9BA 3KLNA 4EECA 3EU5A 1V54H 1A35A 2OZUA 2V5QC 3JREA 4N3BA 1QPIA 5IYCJ 4KZCA 2VPLA 2IU1A 3M07A 4BWRA 1L0OC 1JCSA 1ELWA 2IGOA 3OTNA 1Z3XA 2XZTG 2FX0A 1YX3A 2LK2A 5LEKA 4DX2A 5DV5A 1GUUA 1V5FA 4E6HA 1MJSA 5LRRA 3T1BA 2C2LA 4FC8A 2HXOA 3PS6A 4CRWA 3CVLA 1I5ZA 3QODA 2Z99A 3L17A 3OYAA 4IHWA 5BV0A 2GWRA 4Q94A 2X6IA 4XK4A 3RI4A 4OVVA 3G1LA 3K6GA 4BXFA 2EINE 2FJ1A 1UFMA 3K4LA 3I4MJ 3TJPA 3URZA 1FSHA 2BF0X 1OYYA 1GHCA 3KD7A 3DPDA 1IN5A 1TNSA 3AG3E 1OFCX 2L7KA 2VJJA 1GW6A 3S2HJ 2O61A 4A3FJ 1FT1A 3KE2A 3H36A 4I0AA 4YVQC 1J59A 3BG7A 2I1JA 1MK2A 3FDYA 2F5DA 4N3AA 5F04A 2Y0SN 1NG7A 3QOUA 2DYSE 4UUVA 3QB2A 3D9KA 1JE8A 4BQQA 5CMWA 1XD7A 3HKZA 2F48A 3FTWA 3G1OA 3I4NJ 4Q96A 3FTVA 3KZIC 4JHRA 4GZDA 3L2VA 1ZKGA 3CC7I 2LO6A 4F7AA 1MZBA 2CUZA 2RNJA 5L3GA 1UHTA 3QARA 3BG6A 3KP5A 3OYIA 4XM3A 2ECBA 1A6IA 4Y7NJ 1ETWA 3ERMA 3SY2A 1UB9A 4HNAD 2FBHA 4WK8F 3L2UA 2VSYA 3VTXA 2ZMEC 4GCVA 4TXRA 3SDBA 1GV2A 1HKSA 4C3IJ 2COMA 2O9LA 4EM2A 1R1TA 3FU5A 3P9CA 2DA4A 3UT7A 1IJWC 2QBYB 2E5ZA 2HVQA 4HV6A 3WODF 3TKYA 4BUPA 5A2QK 4UWFA 3AJIA 2Z9OA 4DZPA 1J75A 2K9SA 4M9XA 3R7RA 2KFUA 4UNOA 4XE0A 1Z7UA 1OCCH 2DU9A 2V26A 5E3LA 5FFZA 3A01A 3RRMB 1YMPA 1PYVA 1P92A 3FXOA 3GWZA 1O1TA 1UG0A 3OS0A 3CUOA 3FF5A 3MKYB 2AQEA 4NACA 1ACIA 3DEOA 2EILH 1U5TB 3WTSC 3I4GA 4MBGA 3ZN0A 1DC2A 2KIUA 4HNTA 2VGYA 5J6XA 1ETXA 3HL2A 1MJBA 4ME2A 1TZLA 2Z1DA 1HG5A 2RFMA 1U9NA 5CMYA 2KFDA 1IXCA 1BI2A 2VBXA 3CESA 3LQRA 5CVVA 1REPC 3R6SA 2NSZA 2LY9A 2DVWA 3E6DA 3TWTA 3VB2A 4C3HJ 3VA4A 2J9QA 3LQQA 3EETA 2F5EA 4UHTA 2WWYA 2LF7A 1W0UA 5T4YA 1D9SA 3HRAA 1SVMA 2HQ5A 1Z21A 3NBNB 5D2MC 3KYDB 1T98A 2NS0A 4RDUA 3PNYA 2Y2ZA 1USSA 2XASA 1KONA 3P9KA 2JVHA 5D4SA 4XKCA 3TWQA 3TWSA 1XTAA 4O1OA 3CUQA 4EZJA 3GYZA 2BKGA 2LR8A 3R9AB 1DGRM 3EHRA 1BI8B 3ZGKA 4GTPA 2JT1A 5J4VA 3GTOJ 1DP7P 1A5JA 2JABA 2E1NA 2YX7A 4Y6WA 2FO1E 3LSTA 3DSTA 1KU3A 3UX4A 4JEHA 3PDNA 4RM3A 5EGOB 1Y39A 2VT2A 4KU0D 4EGXA 2A5UA 4FE4A 4HZFA 2EFQA 2XSJC 3P7NA 3UR3C 4V2GA 3KP6A 1VFCA 3Q9VA 3DSUA 3RKVA 2VE9A 3OYLA 1ODDA 2LMDA 3G71I 3I55I 4YDYA 2O8KA 4HX4A 4OAVB 1OLTA 3HRUA 4BJ5C 3NB2A 4XORA 5HS8A 1TC3C 3GTGJ 5EJHA 3QQAA 3EQLF 1X3UA 3ZIMA 3SF4A 5B1AE 5IYBJ 3ESWB 3DITA 3FHZA 4A3DJ 4GTOA 2HNHA 4IQJA 3R4KA 1SFOJ 2ZNZA 2QQ9A 3ZW3A 3QAQA 2WXFA 1E3PA 1EYHA 4NC8A 2IY0C 3TXMA 3LVQE 1I50J 4JA9A 1FMVA 4WWNA 1IC8A 4CUGA 2XPVA 1X4PA 4V19K 4AC0A 5E3OA 2J4DA 3ASFA 5AIJA 2OC6A 3W6KB 1O4XA 2KCLA 1FVHA 1DGWY 1F9NA 1VQLI 3AS8A 4PUCA 3V8QA 2I6HA 4RGXA 4BSZB 2KHMA 4YFKF 4XIDA 4QTRA 1MJ0A 2WAQA 3PE4A 1FC3A 3N05A 5CVIA 3M8FA 4FQGA 2DMNA 1OCRH 2HR2A 2I9CA 3M8JA 4N4NB 5EDNA 3E5QA 1FVFA 1W36C 3NOCD 2PL2A 2R7QA 1LUJB 3E0JB 4G94A 1QQEA 1HO8A 5D6FA 4XKBA 1FP1D 1LDKB 2R7UA 2O0YA 2W84A 4Y3OA 1IHBA 3ZYQA 1QZEA 3W3CA 3SI5A 4RGRA 3FXQA 3ZQFA 3B95A 4K5BA 3T5XA 3PZDA 3CVUA 3LY9A 3ISPA 1LNWA 1LDDA 2RC4A 2ZC2A 4GA1A 2E1MB 3FKJA 4C3JJ 1MIJA 3OS2A 4L9TA 1N4QA 2IGNA 2GROB 4APFA 2GRPB 2FUG2 3KLOA 4II3A 3HXBA 2E60A 3BG1B 4IHXA 4KYOB 3S3MA 1FPQA 2I2OA 3HTUA 4ABNA 1BL0A 2KXPC 1YYHA 2ILRA 4ZZDA 4WX9A 3K70C 1YW7A 2A69F 3KIOA 2OEVA 2IGMA 3Q0VA 4EGZA 1U0TA 4JX6A 1K78A 1FBQA 4I02A 4JOMA 2LNIA 1JGGA 3CTAA 5JHBA 3IP4B 5ITZF 4HAOA 1WWXA 3TBIA 4WXDA 3U3WA 5HDKA 3K1NA 5FZQA 3Q15A 2ZFWA 3F21A 1YRNB 3AL0B 3C3RA 2VC0A 1WQ2A 4I76A 1A6QA 3T8TA 3K2ZA 3GZ5A 4MTEA 1NH3A 1D8JA 1OCZE 3ZN3A 2R7OA 4JX5A 1SW6A 4I7HA 4CZCA 3OYGA 3G6EI 1P2FA 4U0ZA 4G23A 2Y4UA 3GEZA 4CGVA 4KJZA 1XMKA 1YW8A 5LHGA 3ZU7B 5DHRA 3U2RA 4EQQA 2XAUA 2H6BA 1R1VA 1WJ5A 1TWCJ 3Q0UA 3OY9A 2JA7J 4FHJA 2H8RA 4A3BJ 1SQMA 2DA7A 1Y8QB 2CW7A 5DCFA 5LGUA 4MRUA 4U0SA 1IV8A 2L02A 4BAYA 1MMNA 1BR2A 2KIQA 1FSEA 1ON2A 3P9IA 2HOSA 2DYSH 1JCRA 2ELKA 4DX6D 4L9PA 5E18F 4KVMA 3WU2C 4EQFA 1T0FA 2CYYA 4ILGA 2P4WA 4GB9A 2I2FA 1C0WA 2EZIA 2JRMA 2P0WA 3A01B 2FBIA 2YPRA 3BR5A 3HXLA 3IAM2 4HRNA 3I0TA 1I6HJ 2PZIA 4BT8A 4M3FA 2IW5A 4S04A 5D8LB 4M9SA 2R5YA 2FD5A 1DMZA 3CJRB 1B59A 3V8JA 1N4RA 4J7WA 1K1BA 2X4HA 3IH2A 4FJYA 4WWOA 3TG4A 4OAUC 2MG4A 1VQ8I 5KBAA 5KJMA 2OAZA 5B1BE 2NNYA 4II2A 2OPTA 4UXNA 4AY5A 3V7RA 2QV7A 2HDCA 3FKIJ 3I59A 2STTA 3Q78A 4RAGA 4MKTA 3ZPJA 3BTJA 4Q4ZF 2V1XA 5FKOA 5CYVA 4KMFA 4BX9A 3HVEB 3HOWJ 2HOAA 4Z6YA 2K5CA 3ABMH 5DEQA 4CYDA 4BACA 4HXIA 1OWLA 3HRSA 2MC3A 3I0MA 3IWFA 2KC7A 2A61A 5ED4A 2E2IJ 2FMLA 1BOBA 3CP2A 2H94A 5ENSD 4IO9F 5FRMA 2XUBA 1YITI 1TYQG 3JRDA 5E1WA 1W5TA 2K27A 5IP9J 1GVDA 1BD8A 2DT5A 4ACLA 5DBKA 3ESLA 3ZRGA 2V4LA 3FEYA 2R4GA 2AXVA 2FXAA 2RN7A 4R8HA 4F7ZA 2W48A 4JA7A 1STZA 5EEHA 4IRHA 3HDDA 4LK1F 3AG1E 1GXCA 1FIPA 1YX5A 1V55H 4M6XA 2OOEA 4ILHB 2BKKB 1WLNA 2NS8A 4UB8C 3NWSA 2YHEA 3T8KA 4U63A 5JLXA 4PSXA 3DWLE 4BY1J 4DI3A 5LP0A 3OYBA 5BV1A 3Q73A 5KNHD 2I5UA 1S7EA 2VODA 3H5AA 4EJQA 3FU0A 2EINH 2VJ8A 1J2FA 1B89A 4O6JA 1HZ4A 2AHQA 1KQ0A 5CVRA 4GU5A 3EJNA 1O1SA 5J08A 1H2UA 1TNBA 4C48B 3V4GA 3ECHA 2XB0X 2DTZA 2KZGA 4MQVA 2DTRA 4FHTA 5JVGF 3C2GA 4P5OA 3Q47B 1BI0A 4RB2C 3FISA 2FNAA 1UN9A 2W57A 1HXDA 4BX8A 2F5VA 3OYJA 3IKOB 4B47A 2J49A 2EILE 2EFNA 5K7ZA 3A0HC 3C5RA 3M4OJ 3DPTA 4AWXB 5FIOA 4HAMA 2PI0A 1ZELA 2Y75A 4GO1A 2DXIA 3H3UA 1YOVB 3MYVA 3UINC 2KB3A 4TXQA 1K3QA 2HDWA 3L6AA 2LNBA 3V42A 2WXQA 5EDSA 1X81A 3WTYC 4R7LA 4IPAA 3ASGA 4L23A 1E17A 3ZFWA 1ONVA 1UJ8A 4ESBA 1YA0A 1W7PB 4YIIA 3T0YA 3AU5A 1HW1A 4KIFA 2IFUA 4A1GA 5IT9Z 2NOJB 5D8KB 2QWWA 1L5JA 2UUZA 3DFGA 4F3QA 4KFCA 3L54A 4IVNA 2AN1A 4O3MA 3FTXA 2WC2A 3WG7H 3WTZA 3CC4I 2X38A 3PUBA 1K2NA 2WY7Q 3BR6A 3F6OA 5EYRA 4LLNA 4HA8A 2LSVA 3I5UA 4LG0B 3GZ2A 2X48A 3KAEA 2ZNYA 4AU7A 3PE3A 1G8XA 1U7FA 1E2XA 3D9LA 2W4SA 2RAEA 4W1UA 2XAQA 2GW1A 4CDGA 2BTDA 2CJJA 5E20A 1XPXA 3K4BA 1SFXA 2ID6A 5GAEJ 3V30A 3QOEA 3SGHA 3D9OA 1ZH5A 3L08A 3NZSA 5HLIA 1MZCA 1K78B 3B73A 4XL9A 3FHEA 1X58A 3V8RA 2RFAA 2BGCA 2BY0A 4O6FA 2K9NA 4JX4A 3A4CA 2IO3C 2DFHA 4X8QA 2OBPA 2Q8KA 1GXPA 4F52A 2CU7A 3I4PA 3QWLA 1S29A 1J5YA 3IHVA 5DM7F 3JQ1A 4QLCU 1UHWA 3EU9A 1UN8A 2H09A 3KSQA 3FP3A 3H3ZA 4FX0A 4BHCA 2G0EA 1ORKA 5ERIA 1VF9A 2JJ7A 4DI4A 2CSWA 3F8MA 2ZSHB 4FISA 3SEQA 2QA4I 4XLAA 2FA5A 3PUJA 3VLEA 4AY6A 1J4KA 3DCFA 2RD0A 1SD5A 3L9FA 5M3FJ 1JT0A 3CHOA 3IKVA 3CC2I 1QU3A 4ITVA 5E17F 3J5PA 5DHPA 2MABA 5JHUA 1HF8A 1TN7A 3OYKA 4KVOA 5HKPA 2DQLA 3CHRA 3HUGA 3WU1B 2EFPA 3CQZJ 1IF1A 3HG0D 3HIFA 4ZH4F 4ENMA 3VYSB 4UUCA 5DJOA 2GIZA 3ABUA 4CA0A 1JGSA 1N75A 3W6JB 4GYIA 5AQ9A 2P9SG 1GV5A 2LAIA 2WQ7A 2BVLA 4FASD 2GIVA 1VQOI 5J1YA 3E5XA 5LFAA 2QYJA 4O5VA 3U4TA 4Z2YA 5KCMA 2KZTA 5KJLA 2FRHA 3ZRHA 2XQ0A 3H9QA 1U3EM 5BPIA 3FUKA 2F5CA 2JUCA 4FULA 2E19A 1TWGJ 1X2MA 1IV6A 1SVXA 4K0RA 1OCCE 3BCBA 1G2HA 3C2HA 3U1DA 3ASOE 3CHQA 1MDMB 4OIOF 2AXTC 5G04J 2HZDA 4CCLA 3V7CA 2CW0F 4UVBA 4DX1A 2KIMA 3K4KA 3K9TA 4M74A 5FD5A 4E7IA 3DSWA 4BDZA 5L3DA 3LEWA 1AWCB 3MCXA 4FADA 2VSXE 1VQ7I 1XCBA 1MW7A 5LCWC 2X6JA 3U1KA 3MJWA 4GTMA 5C4VA 4OOIA 3RKQA 4LD5A 1D1BA 5CLSA 3FH7A 2Y48A 2XXSA 3ULQB 1NFIE 3CVNA 4N5QA 2I10A 5IP6A 3L09A 4A3CJ 3F8NA 1XX5A 2O6GE 1MQSA 2LC1A 3J80Z 4N5CA 3F72A 4J8SA 2K85A 3EHQA 3FTSA 2C0LA 2LKSA 3UNMA 5EF6A 4ANWA 2HTJA 2GRLA 3O6BB 4G6DA 4XIFA 5KWDA 2EZKA 2E36A 3ZUVB 1HW5A 3ELSA 5DHSA 4D7NA 2CQNA 3KS2A 2LFBA 3FWVA 3B6CA 3R9MA 3BY6A 3BC8A 4XLCA 2R5ZB 4CCAA 3G3ZA 1XGSA 1UCRA 3ULYA 2CQKA 3JCKC 4CDNA 3OYCA 3OL3A 3FMRA 1FYMA 4NC6A 3T8RA 3M7GA 3KP4A 4GRIA 2HI3A 4B1RA 3Q5MA 4IZZA 1SVOA 3O2PE 3VPRA 2ACJA 4A0XA 1YLFA 2ETBA 4RAFA 5D4RA 4UB6C 2LY1A 1HKQA 4KNYA 5KNLA 2VQ2A 3TGOA 1CGPA 3ZQQA 4I2OA 2X3MA 5FKNA 1OWNA 5HRYA 2EIKH 3D9PA 2BW3B 2AWIA 1JUPA 2DK8A 2J5PA 3DPUA 4M3BA 3W2VA 4ASNA 1LDJA 4KYWA 3FUHA 3MX3A 3Q4AB 2HWVA 2MH9A 3GMEA 5HS9A 2H6HA 3AAAC 2WVIA 4JW1A 4ZFHA 3OIOA 4M3DA 3WHBA 2W3OA 1BIBA 4LB5A 1RC9A 1ZQ3P 3LVRE 4EV0A 2PMZA 3ZQGA 3HIZA 4RBOA 3OSGA 5JHFA 2AXZA 3LY7A 2JPEA 3DEPA 3SBTB 4A3TA 5D5WB 2OVFA 5DTDA 1S7AA 3K0LA 1N0QA 1SFKA 1PP7U 3ZHEB 5FKLA 2VE8A 3SZPA 4F93B 4BE2A 3IHYA 3RJPA 3PZ3A 3J80K 1ON1A 2F4MB 3V8LA 4D5CA 1TWAJ 3H5RA 1S6LA 3D5SC 3BQYA 2VQCA 2X6KA 2PN6A 2M45A 5KNGA 2P5VA 3QPHA 2HM8A 3GZNB 2OU2A 4KA4A 3CD6I 1I1SA 4DBRA 1RPWA 4NUBA 2EJRA 3HXCA 4RB1A 1E3OC 2LXMA 1J4LA 2DO7A 4HG2A 3DSXA 3L00A 4L9NA 4HNVA 1QVTA 5EILA 1WCMJ 3HOYJ 1EJ9A 2NVYJ 2XV4S 2CH0A 4U95D 3CMEI 1G6GA 2G1LA 1ZGJA 1LFBA 1TP4A 1VZ0A 3CMAI 2ZGGA 3HB9A 1DDNA 2M63A 5BXUA 3K4MA 4GTSA 4IOAF 3BUAA 2YINA 1N0RA 5EX0A 2HYFA 3UUXA 5FKKA 2X85A 4I09A 4BE0A 1TBXA 4JD2G 4LEUA 3FUJA 5CBOA 3L7WA 4RSYA 4U7DA 1MNMC 4XOPA 1U2WA 2EIME 4GTVA 5HLHA 4PS8A 1WSUA 1D0YA 2K40A 2LYCA 2ZBKA 1W4MA 2W85A 2R0QC 3GZSA 1Z77A 3F9KA 1HSJA 2X51A 1ZARA 4RS8A 5F0CA 4XONA 2IJLA 1Y1WJ 4BETA 1Y56A 3QYBA 3B7RL 5ILVA 4HI9A 2UWMA 3PO3J 4FLHA 1HS6A 3DPLC 4HRMB 1QPMA 4EZLA 2V9VA 3MKZA 5E8IA 1JKPC 1H9GA 2GOXB 3DU6A 2B6CA 5JEKA 2R03A 4MS6A 3V2OA 4YEJA 4J8DA 3AG3H 2E5NA 2V4HC 1IRXA 4AUXA 3DKXA 2OZ6A 1QQIA 1SD4A 3M8EA 3ZCOA 2J5OA 1U8RA 4OAZA 2H6IA 4TXPA 3ASNE 3O8GA 2CQQA 1R58A 1X1AA 4D9JA 4CCJA 2F37A 1EPUA 1LFUP 2L4MA 1YRNA 4CDRA 4ZYEA 1HG2A 2UY1A 3CJQB 5ARGA 5FQ4A 4AXHA 4BXXJ 5JLWA 1HKTA 1LD8A 4G2VA 4AVPA 1FT2A 3J5QB 3BP8A 5EZHA 3WTWC 4H0EA 3HDXA 1WJDA 2KM4A 3AG2H 3ABKH 3RCOA 5K1YA 4ESJA 4XI0A 2DLLA 5FD6A 4H7XA 4GAAA 3V7YA 2PLYA 2GRQB 3KYLA 1BC7C 4RQIA 3TP0A 4XRMA 4HF0A 1PUEE 3S3NA 5LHIA 3DKWA 2E2HJ 3A77A 5GTHC 2J08A 2XSDC 2IGKA 5BNGA 3OSFA 2VUMJ 4D5FA 1IRGA 5D66A 2Y9ZA 4IX7A 1RR8C 1AWCA 2HYJA 1MYOA 3L9TA 4HV5A 2NS7A 1VDYA 4YELA 3CVYA 5CVUA 2FOWA 1JJ6C 4OYSA 5CRUA 3CVQA 3EIQC 1MMAA 1WJEA 2I1KA 2HYGD 4GGGA 4JP0A 4B3AA 4IKFA 4I1OB 5LOZA 2CUJA 2GXGA 1JWGA 1FX7A 4KIGA 3JYSA 4EJWA 3NQPA 3KETA 3KEOA 3KSLA 3D1NI 2X0LA 2H6FA 3HHGA 1LGQA 1N4SA 2Y1LE 4A0YA 2QCOA 2ETHA 3LA3A 3OYNA 4GCNA 2Q2EB 1FLIA 2L9NA 4EJOA 2OVBA 1VI0A 4BU2A 2XAFA 5ILSA 3RKXA 3HTSB 3HX1A 1MR1A 3UNNA 1G3TA 2ZMEB 3NRVA 4DQ2A 1UAAA 4LG0A 1OPCA 5C44J 2HVSA 3MZHA 2CG2A 4B8CB 2PEXA 2JVGA 5HODA 2HS5A 1IO2A 5JEOA 1LFPA 3B7TA 4ZZLA 2MLGA 2O7OA 3TDUC 1WGXA 1QNFA 4HB5A 4AM3A 4NB5A 2XZDG 4BTAA 4JHJA 4CCOA 4L18B 3JRAA 1ZRFA 2WM9A 2HE0A 1S5LC 2M0MA 2XRNA 3JAMK 2XGDA 3CR3A 2L54A 4DBQA 4UWGA 1T56A 4NQWA 4ESFA 3D5RC 1W0TA 1HLVA 4WAFA 2XEVA 2L2OA 1TWHJ 1QBJA 4CXFA 1FOYA 4DUIA 3UKRG 2ZJRF 3HJEA 1MNDA 2AVPA 4F91B 2NC9A 3N71A 1D0XA 2VASA 3CSTA 4D10C 4HLEA 4HPQA 5EGOA 4WNEA 1V3FA 5F0FA 1BA5A 3DEUA 4KT5C 3OXLA 4IHTA 3RK6A 3I6UA 3DWLG 3DEWA 2PJRA 3HRTA 2MHKA 1MZKA 4OMYA 2P9LG 5H20A 3FMSA 1QO0D 1ZLJA 2M8GX 1HDPA 2YX4A 1WG0A 2V8SE 4LGWA 3F6QA 5EZGA 4HOQA 3V7SA 5ANRA 3POAA 3IH3A 4F55A 1KA8A 5BQTA 2XS1A 2B0LA 2K3FA 2FE3A 4GPMA 5ENPD 2FU4A 1T2KA 3I6WA 3PFNA 5EG0B 1VNDA 5CQEA 1K79A 2P9UG 3GZ1A 4H87A 1XSVA 4GFBA 3L2RA 3CQGB 5A2QZ 3BG9A 1R21A 4I2WA 3ZYMA 2FSWA 2E2EA 3F3XA 2IRFG 1UZCA 1TLHB 2BXZA 3T9KA 3TG5A 4U0VA 1OR7C 1E0EA 3RIRA 3LCAA 2RKHA 4L1BA 1WI3A 1V5GA 4LIUA 4HOTA 5JELA 1HSTA 3NEUA 4BKXA 2NVXJ 1KU7A 2DMQA 4LB6B 2VBYA 1NL4A 2CSOA 2IPQX 4KN4X 3LFUA 3CUQB 2YNQA 1W7PD 4WF2A 3ML6A 5ICGA 2GM4A 2DI3A 4XSXF 3MWMA 3SNXA 1DVPA 5E76A 3TAXA 3RQIA 3HSEA 4DX7D 1U5TC 2AXLA 2IS6A 4F1SA 3DLLF 1S64A 3LOCA 4OIQF 3ZEFA 1LB2A 4G1TA 4C2UA 5FLXK 1Z7LA 2X1EA 4GTTA 1R6RA 1ULYA 1JXSA 4F92B 1WJBA 3B7UX 1Y6IA 4HSTA 4A3GJ 3GUDA 2V4JC 3CDLA 3LSMA 2NYJA 3FM3A 2VT3A 1K6YA 4CHUA 3MCZA 4C2TA 1K3NA 1YT5A 4HEA2 1PY1A 2DN0A 3DV8A 3S8PA 4XQFA 3PRZA 1USTA 2J8SD 4NIKA 3BTLA 3PUFA 2MW8A 1FEXA 2V6EA 3LYAA 3K1PA 3ULQA 1QNTA 3ZQ7A 2KKOA 1HDDC 3AS4A 3W9GA 3B02A 3M3YJ 5JMND 3OWTA 5E79C 3AKZA 1KYWA 3SO8A 3V2XA 1YHQI 2FBNA 4CT4A 4MHGA 1BI1A 4PFPA 3NZUA 1XGMA 3X2QH 3RPQA 2WXGA 4ZDPA 4Q69A 2BY2A 1A17A 1S9HA 3L2CA 3FY4A 4PJNA 3CLQA 3TEDA 1LQ1A 3W6VA 2QZAA 2PMZN 3HC7A 2NVUB 2FQ4A 2O03A 2OUMA 4G7ZF 4B44A 4BEHB 1SMYF 2DDAA 2BE5F 2VQLA 2L9SA 3A02A 3GBGA 3PFIA 4PFOA 3JRCA 1S63A 2ETCA 1MBJA 2K9QA 1BW6A 4G25A 1S3JA 3ZXPA 3VLDA 2VTBA 1JUSA 5D0OD 4HW0A 1AKHB 5IY5H 3Q0WA 3LA2A 3FXKA 3SXYA 3TOBA 2A07F 4HRIA 1A04A 1WVRA 5EJCA 3H1CA 1ELRA 1B9NA 1I3QJ 3CV0A 2HXIA 2AXUA 1TTYA 4PK4A 1J0RA 5IT9K 3SFIA 3V7WA 4GPKA 4HX7A 2M7AA 2XHEA 1R22A 2CHWA 1RETA 3LAJA 1TQMA 2F8YA 5M3MJ 1ZGWA 1ITYA 4HLLA 2CS3A 3F22A 3TWVA 3V8PA 4IJAA 2ZU6B 2BVMA 4LG6A 1ZG3A 1D8DA 2LD5A 3ZQHA 3CHPA 5DS9A 2VJ5A 4B93B 4JBAA 1MDMA 1UJXA 4BNCA 2IA2A 4EHMA 3AG4E 2IP2A 2HOTA 4OIPF 1QRYA 4PJ0C 3FUDA 4P9UA 1VQ6I 2DBBA 1AU7A 2E0IA 4EJTA 1N77A 2R5SA 1I3AA 4CYMD 4UI9C 3IV0A 2DPDA 1T39A 1K4TA 3JRGA 3MVPA 1ZLKA 1DPUA 4L7TA 2K7LA 1S70B 2RKKA 2GQQA 2LRDA 1R71A 2ZMEA 5A6CA 3OYDA 1XGNA 2X6XA 3G2VA 3IUOA 4E4HA 1WKMA 2P9PG 4WERA 4W97A 1TN6A 5HQ8A 1JT6A 1QA6A 4J8YA 4DOZA 3I58A 3DSHA 3ONLA 4XR6A 2ZIRA 1MMSA 4HVBA 2H6GA 3S16J 5DHUA 1BJZA 3V31A 3ASDA 4GTRA 4XI9A 3UV0A 1BBYA 2WA0A 2IF4A 2COBA 3CCSI 3LDZA 3C2BA 3BR1A 2YSRA 1XC5A 4BJ6C 2JMWA 5KVRA 2KJBA 1YIOA 1K61A 1OY3D 2PX9A 4RA2A 4IOCF 1N25A 4F6RD 1HF0A 1G3NB 4M72A 3KPHA 4A3JJ 2P58C 1HOMA 5FQ6A 3FZVA 3OV8A 3A1YA 4V2FA 4H7YA 3QWWA 2A6HF 5FTPA 3ELKA 4YFXF 1G3WA 2IO2C 1N54A 3FM5A 2R7SA 1WDYA 3EHMA 5LCWJ 2P6SA 2CHXA 3D0SA 3GX4X 2F2EA 1X4OA 2RDPA 3BJ6A 5FGMA 4N4OB 1Q1HA 4LLLA 2CV1A 2XRYA 1PVEA 2OF7A 5CKTA 1IHGA 4GMJA 5EYLA 3KP7A 5M5YJ 2UZKA 3UXGA 2NXPA 3JUIA 1K4SA 1TNOA 4UI9K 3SZGA 3DRAA 3WGGA 2CG3A 3WTXC 1IGNA 2EK5A 4BHBA 1YS6A 1OYIA 3V80A 1R9TJ 3PQJA 1JTXA 2CFUA 2XGOA 3R7QA 3UMZA 4C9BB 1G4DA 4OAYA 4BEPA 1SA5A 1XSXA 3LSIA 1YG2A 2R7XA 3HUGB 4XZ4A 3QRFF 1QU5A 4YRVA 2IEJA 2LAHA 3LXUX 2XENA 1SD7A 5FZRA 3N4MA 1O7LA 4W9RA 2E34A 3TW7A 2OQGA 1I6XA 2JA2A 3C98A 3CGHA 2QZ8A 1VQMI 2Y31A 5EIDA 2ZXHA 2E1OA 4X1EA 4PGGA 4BL0B 2XF7A 3ABTA 4JEUA 3ZVVA 3C18A 3M9AA 4ZYAA 3PJRA 3JR9A 1U9OA 3E32A 1U5TA 2MFZA 4A3MJ 4A3VA 1T08B 5EJFA 2ZXWE 3B7BA 4KMOA 2RQQA 3EIJA 4TV3A 2A05A 3BTIA 5AJDA 1TT5B 4DW6A 4M6YA 3JRBA 3ZMZA 4XRFA 4ETSA 2IOLA 1D3YA 2HQRA 4QIWN 3DLAA 3G1MA 2QQBA 4O1PA 2M87A 3RAUA 4A55A 1IW7F 3WGIA 3JSPA 1APLC 1J7KA 4DJAA 1R49A 2A5YB 2LTPA 3ZOBA 2C6YA 3VSLA 2MOWA 4RLYA 4CDMA 5IY5E 2VOOA 1FPPA 1FY7A 3KP3A 3JXJA 3GLXA 1HC8A 2J09A 3OS1A 1ZREA 4L2LA 3GW2A 4I0BA 4K2EA 4AD9A 4JK1X 1ZGAA 3FWEA 3JSOA 3QU6A 3DBRB 4BEHA 1T6SA 3HPGA 4KISA 4QPQA 3VWBA 3CDIA 3HOXJ 1B8IA 5DD4A 2MH2A 4MEYF 1HFAA 2KZVA 3PVLA 4C0MA 4BJTA 4PJLA 3U66A 3FX3A 4NBQA 2QFCA 2ZSIB 3H35A 4ZTFA 4A6EA 1MBHA 1X1DA 2XEHA 1WH5A 3ABKE 3C3OA 3H0GJ 4Q47A 2XF6A 2DA2A 1JI8A 4EEFG 1B72B 3ZNGA 1TWFJ 3LSPA 2VGXA 3MKRA 3KYCB 5LRSA 5FJYA 3BJAA 1OCRE 2DZNA 4B94A 2BYVE 2FF4A 1J09A 1TNZA 3H92A 2K86A 1I27A 4A3LJ 4XEIG 3MKQB 2X6YA 4EM1A 3WXXA 3JUEA 2JSCA 3U64A 2WV0A 4PJMA 4E85A 2ISYA 4HOBA 2YS9A 5ICCA 1EV7A 4Z68A 3UM1A 1KPSB 3RKWA 2RNGA 2X9DA 4HQEA 3VODA 1RUOA 1XGOA 4CYCA 3S3OA 3F6VA 2M5WA 4LSZE 4KMUX 2Q7FA 3AS5A 4GTQA 2L01A 2PMUA 2BHZA 1MMGA 3F0CA 4L5IA 3JRIA 1GVJA 3MKWB 1DU6A 1U3CA 2QSFX 1UJKA 2XAJA 1SC7A 2Q0OA 3QKYA 2EZLA 3VA1A 1H6KA 4IRUA 1G3SA 4IYPA 4KBQA 1R36A 4U0YA 1FYLA 1N95A 4PZJA 1SA4A 4AEZC 5FQ7A 4CSWA 4HS2A 5A7DB 1KHXA 1Y0UA 4PS7A 3TQNA 3MKLA 3QAHA 2OV7A 3OOUA 5B5EC 1BI3A 3OIQA 4X0GA 2ZJPF 1H9TA 2F0YA 2J4BA 4EMSA 4E70A 2FEZA 5ENTD 1SUWA 1OYWA 4N0BA 3ZQCA 1IQUA 2W00A 3JTHA 4FE7A 1VQKI 3J7AY 5KAIC 1IN8A 3S15J 4F1PA 4RGSA 3LL7A 3BG5A 5K7HA 4YDEA 1OKRA 4BERA 1R00A 1JHFA 2OA4A 3CCQI 5BUZA 2Q1ZB 4UVCA 3H5NA 4AVZA 2H27A 2EFWA 2O5RA 3LMMA 2L0IA 2WQ6A 3S93A 4DZJA 4XLPF 2L7ZA 3IC7A 2RREA 4JQFA 3QPSA 5F08A 4ZC3A 3BJOA 1Z5SC 4U7EB 3G2TA 1O5MA 3LFKA 4DRXE 2HO1A 1W5CC 5BOXA 2M2EA 2EWNA 5DD8A 2VPRA 4YIRX 1G6NA 5JA4D 3GO5A 2VXDA 3BEEA 5E75A 2E35A 3D9NA 4U8HA 4FHKA 1J4PA 4KXKB 4UV8A 3GFIA 4AIFA 3LSHA 3SZTA 1UG2A 1FTTA 3ECOA 5BS6A 1WHUA 1JTYA 2VQGA 1F1ZA 3V8KA 4HI8A 1RUNA 2H1KA 3LA7A 3CF2A 3IEGA 1M1EB 5HS0A 4LG3A 5GPAA 3UOTA 3ENEA 2HPIA 2QQ8A 4IHSA 2LOOA 4G2SA 3OYHA 1GT0C 4WUYA 1MBEA 3IAS2 3PZ4A 3TMOA 1DQUA 3K4CA 4ZYHA 3OYFA 2A6TA 4A0ZA 1D5VA 1H0AA 2FMYA 3DSVA 2GBYA 3R0JA 3SDGA 4FJZA 1AKHA 2L9RA 5CJ9A 5EEGA 2JSPA 1QVUA 5TISC 4HDUA 1OXJA 4P55A 2EV6A 2KDZA 4RG9A 2YR2A 3KFWX 2UXNA 2OJED 4ZDOA 3FTZA 3E6BA 1HXIA 4HRLA 2R59A 5LLQA 4U0WA 1OMIA 2P2CP 4MLPA 5FINA 3SFYA 4BBRJ 3HYMB 2Q5FA 2V9KA 5A23A 4H4KC 2A5WA 4UVAA 3QPLA 4CYCB 3PIOF 4LFUA 1G59A 2JQ7A 2D45A 1J4QA 3JRFA 1DEVA 3QYFA 1BLXB 3O8HA 2TDXA 4HF1A 4I17A 2WMNA 2GZWA 3S7DA 3COAC 4B3XA 3UT8A 2VN2A 3GFJA 2O8XA 5M5WJ 1OISA 4X6AJ 3FK7A 3IKTA 2PQNA 2AO9A 1N11A 3CQCB 2XGXA 1ERDA 1WZ2A 1MNEA 2YUSA 3EUHC 2EPFA 4GYYA 1POGA 4DGWB 2XROA 2WXKA 2KLOA 3VYUB 3UT4A 5JERA 5IOZA 3BQOA 2ZB9A 2LVSA 2DFFA 2L4AA 2MBFA 2Z3YA 1MH4A 3S1RJ 4LLGF 1R5ID 2V1DA 1RZ4A 3I5PA 1Y8MA 1GXQA 5H6QA 3PO8A 3HGYA 3HKZN 2EFOA 2LREA 2Y3AA 1Z91A 3ROUA 2BEOA 4HBLA 2TCTA 1IN4A 2ECCA 4A12A 1T33A 2P81A 1YO5C 1BN5A 1TQIA 3WE3A 2VLAA 2XPYA 3TWXA 4G6QA 4HQMA 2WXLA 1LEBA 1PAQA 4ENJA 3FXRA 3CO7C 2LSOA 2LUHA 3S14J 3HOUJ 2EQRA 4AM9A 3RIBA 2DT7B 2N8GA 3LJNA 4CH7A 3CLOA 4LJZF 4JXTA 2VKVA 2I2AA 2LKXA 3FUEA 4A2UA 4XKWA 2QYUA 1KT0A 5CEDB 3FXUA 1XNFA 4G24A 4TUMA 3KZZA 4UWLA 5G2NA 3GF2A 3D9IA 1G3YA 3Q9UC 1U0RA 4E7KA 2M4GA 3O48A 1MJAA 4G7HF 1NG6A 2E1MC 3HOSA 3G2SA 2YU9J 2QF7A 5BXOA 2I2BA 3FXMA 1X5BA 2CFZA 3KZYA 2WXIA 2X1DA 3K69A 3WTTC 4RGUA 2R5ZA 2IBDA 2V1NA 2ZCWA 3APFA 4XNFA 4N3CA 3CSFA 3WU0A 2VJ4A 2X6WA 2EIMH 1WAO1 4L0ZB 3JXIA 2F6CA 2XCCA 3GFLA 4XLHA 2LDUA 1OUVA 3SFXA 1LE8B 2KDOA 3KX2A 5HVQC 2QVOA 2R02A 4PH4B 2EZHA 5G55A 2VYIA 4L02A 4U7BA 2ZJ2A 3G2WA 1D0ZA 1Z67A 1FCHA 1O57A 1O7FA 2KRCA 2PG4A 1S72I 3L2QA 5JHAA 2QC9A 3V8NA 5C1DA 1YTYA 4FETA 2DFEA 3H9GA 3LSGA 2VBZA 2H6CA 1MHQA 2KIFA 3VFZA 5ANLA 4YDWA 2L7MP 1EF4A 1RNLA 4G8XA 2LBFA 4RLFA 2WV1A 3FHNA 1QYMA 2R7TA 4XN3A 3CVWA 1DUXC 3FMQA 1SZ9A 2WXJA 3MV2B 2IS1A 3Q9NC 1O3QA 2M4KA 4YVOA 5LHHA 1K83J 2MSYA 4URKA 5CVJA 5FROA 1BI7B 1TJFA 4AOFA 4BQOA 1O1RA 2BEDA 3HG9A 1ETYA 1OJLA 4WRRA 1KZPA 5L3BA 5FB2A 4ON0A 3SQNA 2XT9B 1LEAA 2Y69E 2P7VB 1QZ2A 4LCTA 4Y6CA 3QC1A 4FP7A 2RG8A 2FQ3A 4EZKA 4UUSB 2JGRA 3E97A 2NXNB 4Q48A 2FO7A 2DOEA 4LUNU 1NA0A 3PL8A 3K10A 3DPYA 2X1CA 3HOTA 1B9MA 4I6JA 5DUIA 3PEVB 3RJVA 5J8CA 4APOA 3TO6A 1YYVA 4ANVA 3C3QA 2R93J 1YJ9I 3ONKA 3DTKA 1JKRC 1W5SA 4BYYA 2P5LC 4DYRA 1Z0UA 2DQRA 5CCLA 5K5QA 2AJAA 1LGPA 1YQAA 3PSIA 2XC7A 2NYXA 2D1HA 3PNTA 3ESKA 9ANTA 1J9IA 5KJKA 1SAXA 4J8EA 2LC2A 2C0MA 3N97A 3MEXA 3FIWA 5J1RA 4ZTJA 1K7AA 3GVAA 5KAFC 1D1CA 4LITA 4XKVA 2IT0A 3CHMA 2PM7A 4K5CA 4XLEA 2DZOA 2MD5A 3EYYA 1Z0XA 3H3VK 3QWVA 4RVBA 4YIFA 4NHJA 1FBUA 3QOPA 1ZK8A 3TW6A 1D5YA 3EHNA 4MQ9F 4PS3A 3PIPF 4RG6A 2AFFA 5GPCA 3OL4A 4CGZA 3I3LA 2JQLA 5J3LA 4KICA 4A4YA 3BQZA 3BLYA 2HGCA 3FUFA 2WXNA 1INZA 2OCEA 2CMPA 2HOEA 5AAOA 4UQZA 1V5EA 3KEQA 1E3HA 3BZKA 3ZMDA 1LE8A 4R9PA 3AFHA 4EJVA 5JEMA 3RSNA 4J19A 2M7BA 4EBAA 5J8FA 2L9VA 4G26A 3MKQA 3E7LA 4E7SA 1K3JA 3TDZC 3QP5A 1XG1A 2CWEA 5HDGA 4BQAA 1SFEA 2UY1B 3ABME 2UXXA 4CCMA 4DPRA 2V6CA 1FHQA 3BCAA 3BPVA 4ATGA 4KZ0A 5FJ8J 2IXSA 3ZR8X 2AW6A 3FH8A 3NAWA 1BW5A 1RESA 4L5EA 4MIMA 5ICFA 4DK5A 3B13A 1WRJA 2MC4A 3RTRA 1Y3HA 2LBFB 3HRMA 4EJUA 5ENOD 1B6AA 2GGFA 2KCKA 1NA3A 3V7UA 1HBXG 2QSHX 4LNGA 4U8YD 4Y33A 3AG1H 3GQSA 4J8FA 4WNGA 3E5UA 1JJ8C 1E8ZA 1R1UA 4BGDA 3L1PA 5EJGA 5KHDA 1XMAA 2KZTB 1P4WA 1ZAOA 2LY2A 4A69C 1R23A 5EG0A 2DMTA 4G11A 3E4BA 4ZHBA 2HPMA 5DHTA 2WY8Q 3OAWA 4BQNA 2HQNA 4IL6C 1OCOH 3UN0A 3IWZA 1JKQC 5ICEA 6PAXA 4HOUA 4HLYA 3DTIA 3CCMI 2GRMA 2WB1N 2W7NA 4NQ0A 5HDNA 4IRIA 1DD1A 1MX6A 3E1SA 2DA5A 4CZ2D 2X6HA 5M5XJ 2PBIA 5B1BH 4R79A 4UWHA 1YJ5C 3D5LA 4ACKA 4CCNA 4S05A 4MLOA 3LKUA 2RV8A 4LK0F 4A3KJ 5IYDJ 4EBAG 1Z0ZA 1MBKA 1BC8C 4B43A 3E37A 3FH5A 3RPUA 3QWPA 4D0PA 2VC1A 5GAGJ 2Y0SA 4DIQA 2LG4A 1E7UA 1ZTRA 2V79A 4JHKA 1FMWA 3L2WA 2QKMB 4AYBA 1SANA 3S1MJ 2WXRA 4P1WA 2VSOE 3VZCA 3HHHA 1VQ4I 2WXHA 2XVCA 1SFUA 1VQ9I 2RQPA 3IL2A 2PNNA 4ENNA 5LBQA 5EEAA 2XKPA 3C72A 2XF5A 1BR1A 1DPRA 3T5PA 4I43A 1X1PA 2GXBA 4ZJZA 3TWRA 2GRRB 1MMDA 2JPBA 1WM5A 4BSXA 1BJAA 1TR4A 3PEUB 2LH9A 3BT9A 1AHDP 1A36A 1MKMA 4G12A 2XB5A 1EKEA 5TGTA 5F0HA 3C7JA 4DLOA 2JWTA 4QPOA 2CHZA 1R4MB 2BXYA 4PGHA 3Q7FA 3HPHA 3DQVC 3APDA 5FKMA 1IXSB 3I64A 5TRDA 5J90A 4N2QA 2I2CA 1WJCA 3CP8A 4OINF 4BY7J 3W2WA 3DXMG 3J7ZI 2HZTA 5KJNA 2XHKA 2LP0A 2KB4A 3ZQLA 4IQ4A 4E7LA 3ASOH 2I2DA 2W82A 3U9GA 4XLFA 3BR3A 2P7CB 4FA6A 1DCEA 3K4NA 5M72A 3SQVA 5DYMA 2V7FA 2KRFA 3BTCA 1YIJI 3S1NJ 3WGHA 1O3SA 1WV3A 2P8TA 4OMZA 3MV3B 4ANJA 2EIJH 3EUHA 5FO5A 4OVUA 5HNFA 2A68F 3ZP5A 2M1BA 3IRQA 2HYZA 5CCMA 3QPTA 1R7JA 4BBSJ 2L6JA 3CKBA 2MD0A 4WWPA 2VXZA 1MX2A 4ABZA 4BT9A 2IOSA 3R61A 3ULEG 3OR2C 1IRZA 3JW4A 3AG2E 3TWWA 2B63J 2JA6J 2DA3A 5JR3A 1YFHA 1T38A 4NURA 3GXOA 2NOGA 1MD0A 4WNDA 5ENQD 2I1WA 5E50A 3LWFA 4C9YA 1YI2I 2F8XK 1T8IA 3R60A 4J0UA 3UKUG 2W24A 4CICA 3OR1C 5GTIC 1L3LA 5IP7J 4E7ZA 4GMRA 4M9ZA 5F1RA 2L6BA 2NVTJ 3DXJF 5J47A 2IA0A 5H2FC 1IZ1A 5G04C 5CEAA 1I39A 3GTLJ 2XAGA 4ZYDA 4I1AA 3ZPLA 3S17J 2IAIA 1DU0A 4FLBA 5FLMJ 2WPVA 1H19A 1ZR4A 2WB1A 2VI6A 5A8IA 2PFBA 2ICWG 3APCA 1PJRA 4A6DA 3CCLI 1ZBPA 2XPZA 2AQFA 4JB8P 3IXEA 1QWTA 4U8VD 1IXRC 2HEOA 4LMYA 3ZYKA 5HOOA 2KKLA 4AYBN 4AP2A 2EA4A 3WTVC 2BW3A 4AIDA 4J6IA 3BG3A 1ZRDA 1OWPA 2EA2A 5CECB 1ZN2A 2JN6A 4IRGA 1UJJA 1O3TA 4FU3A 3ASHA 4KT6A 1V4RA 3FU6A 5GADJ 1FIAA 4CZZA 3ZN1A 1UHMA 3OYMA 4I6ZA 2P1RA 5H6RA 3HZJA 2ZJQF 1ELKA 4Y4RA 3HSFA 4NC7A 2M30A 1AA7A 1R5GA 5EJIA 3VZDA 3SYTA 1IN7A 1Z0SA 3E33A 1I1GA 2DPUA 2OCCE 2MYSA 2JZYA 1YCSB 3FFLA 5B3SE 1CF7A 1OCOE 1TNUA 1IUYA 4CEMA 3BPXA 2DAOA 5C4XJ 2DBAA 4GZ5A 2ELHA 4V3IA 5BT1A 4G8KA 3Q75A 2EQXA 3RYRA 1Z3YA 3I4RB 5D5UB 3LY8A 1PC2A 1X19A 1X2NA 3I53A 1W36D 3ZQIA 2ETAA 5C2YA 4UQXA 3B7SA 1LVAA 3CLJA 4M3OA 1TW3A 2HKXA 3OXFA 5FT9A 1OCZH 3OYEA 2GA1A 4B8XA 1WY6A 3ISMC 5BVIA 1Q1VA 3CCUI 1E8YA 1EDUA 3FULA 1TEZA 4RB3C 2VKDA 2XRZA 3UIOC 4NQWB 2EIKE 3CKCA 1XB4A 3NQOA 3MMYB 1HU3A 4GZ3A 3EYIA 1ZB1A 2MYOA 3DXKG 3TWUA 5AQBA 1TJCA 4A5MA 1S0PA 3EDTB 2IONA 3VYRB 4MEXF 3OIPA 3TP3A 3TOAA 4IEJA 2I29A 1ZYRF 3S2WA 5DDGA 3I56I 4EVIA 4J00A 3W2AA 4YFNF 3RO2A 2I8DA 2VIXA 3D9MA 1YJMA 3QU3A 2QEXI 3PFYA 2WXOA 3MA5A 3VEPA 2H1LA 1X1BA 2GA2A 5E3MA 4B8AA 4QQIA 4L9VA 4YNDA 2K9MA 3NF1A 5G05J 1IG7A 4I01A 2K9LA 5AJLA 3PZ1A 4PCQA 4I99C 3WG9A 3Q3SA 3W9FA 4C0EA 4PUSA 5L3EA 4NRHB 4LNBA 2GOMA 5AQ7A 3ZMSA 2NNNA 4Q5SF 4MGRA 5K5OA 3J81Z 4I2ZA 1J4OA 4GDFA 3CVXA 2IEKA 1J2XA 1K8KG 1KT1A 3UM2A 2XAHA 5BPDA 4BFRA 4DYQA 4XOTA 1BR4A 1VQ5I 1IN6A 3L82A 1ZG1A 2DDBA 2W25A 4JVSA 2KL4A 4BE1A 2ESHA 4ATZD 2EIJE 3RRUA 4GMLA 2VB6A 3VDXA 3QJZA 1JKOC 3ERED 2LSUA 3SBSA 3E3VA 3QNKA 3TL5A 2M0CA 5IT3A 3Q5FA 2PQRA 2QY7A 3CK9A 3LAPA 2XRLA 1U78A 1HE8A 3SHFA 2YHCA 3GLLA 2OTLI 3FUNA 3M1CA 2CO5A 5LGTA 1P4AA 1QHHD 2KCVA 3HHMA 3TGNA 3PM1A 1ZR2A 2L5QA 1VTNC 1G3GA 3MZLB 2G7UA 1LD7A 5AONA 3DSSA 3UM0A 4P96A 2A3SA 4IHYA 2NAZA 1X1CA 5FZSA 2GAUA 1NP7A 2IJGX 3MEKA 4GYOA 2VGEA 3TO7A 4HQDA 4F53A 2DOFA 3GCMA 2KPMA 4JYKA 5DUKA 3S1QJ 4JONA 2XKOA 3BR0A 1QBQA 3ZMTA 4I98B 3WE2A 2BHYA 1Y3IA 1Z1DA 3CEQA 2DWZA 2L0KA 3KEAA 1WH7A 3E6MA 4UUSA 4ANUA 3S7BA 4DLQA 1EH6A 3CF5F 1EA3A 1XN7A 4P29A 2IVMA 5CQGA 2WAQN 1TNYA 3BDDA 3ML9A 4EM0B 3KCCA 1H2VC 5GAHJ 1MGTA 2BY3A 3C1DA 1Z6RA 3FXJA 4PDKA 1UG3A 1U7VA 3CMYA 2JA5J 2P6TA 2QBYA 1NHAA 2KRHA 4E7HA 5D0QD 3PQKA 3AL0C 4GCOA 1QGPA 2CG4A 3P2BA 2D1VA 1IKND 3RZDJ 2W1OA 2ME0A 2OTJI 1N4PA 4Y52J 3LS8A 1DCQA 3E34A 4LERA 4BTBA 5DCMA 2BONA 3AU4A 1B4AA 5KK1A 1Y0NA 3TO9A 2B9SA 4G9YA 1TT0A 1QZYA 4JL0A 4Y15A 2DODA 3HVEA 1UELB 5C3EJ 1WJAA 3QYEA 1Z9CA 3GTKJ 4HNUA 3PUKA 2OD5A 2HFHA 3UMVA 2V9PA 1RW2A 5JEJA 1KYZA 3D3MA 2O3FA 3B6AA 2Z33A 2A5EA 2JTVA 1Q2ZA 3LSRA 4JIVD 1SVLA 2KQRA 2QM3A 4JZYA 2MA3A 3UNGC 1RIOH 3BG0B 3REOA 3DF8A 5JFRA 5C4JJ 4L2YA 4YDOA 2UWJG 2F4OB 5LEJA 4AJWA 4A3EJ 1DP3A 1JWFA 1P7IA 3DTEA 4FT8A 3FEXA 1TNTA 4M6VA 2PIEA 2XS8A 4M3GA 3IRRA 3S7FA 5B66C 2P9IG 3D9HA 1YJNI 2BY1A 3CCJI 2WAFA 1ZRCA 5CRVA 5HI7A 3EUAA 2R05A 3RSEG 2XEEA 1FYKA 4ANXA 2X6OA 1H88C 1MX4A 3FUMA 4XICA 5EN5D 4EPZA 4DY6A 3G2BA 3J7YJ 3E6CC 4B0ZA 2YQ8A 3CHSA 3CDHA 4LRZA 3PREA 3FXLA 1QHGA 5D5XB 1Y1VJ 4IHVA 3HXFA 1KZOA 1UOHA 3TXNA 3BZCA 2FOKA 3HXEA 3HXDA 1CQTA 3T5VA 3CVPA 4UQYA 3CCVI 3ABLH 2MGQA 3ONQA 2Y0MA 3TL4X 3AAFA 1XCVA 4L0YB 1W3BA 1NTCA 5LGNA 1F5TA 2AS5F 1DNPA 1UW4B 1OQYA 1MBFA 3RQ4A 2P9NG 3DKYA 2QSGX 4HSRA 3HEFA 4U88A 2HQAA 2XGSA 4GYWA 3GZ6A 4B89A 3QP6A 1WI9A 4JC8A 3ML8A 2ZXWH 3A03A 3I54A 4TV7A 5HS7A 1YJWI 1KHUA 1P6RA 4D9VA 4L9JA 1IAWA 2KT0A 2V0PA 4M3EA 1H8AC 3K70D 3I59B 3A0BC 4HFGA 4GXOA 1PP8F 2OCCH 5E1XA 1SZAA 2DIWA 2RVCA 4XRSG 1SEUA 3FUIA 1S8NA 2XGCA 4I6EA 4BHPA 3HGGA 4HORA 5BPPA 1XDUA 1U2VG 3UKGA 2ZO4A 2PM6A 3NAUA 3P5JA 3VOEA 1K3ZD 5BW8C 3NOGD 2DW4A 3SEZA 5DHQA 3ZMVA 1XSDA 3C3WA 1XGWA 2ELJA 3ZGQA 3PNVA 4IULA 5AQAA 4U87A 4U07A 4WXHA