2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
1ZBPA 3QRFF 4WWCA 4BAYA 3M1EA 5DIZA 2GAUA 4EJTA 5DCFA 2A69F 3ZPJA 4AIFA 3B02A 5CHEE 3DV8A 5M72A 1FHQA 3CEQA 3OOPA 1E17A 4JHRA 2GXGA 5CVVA 2DQRA 2XAQA 4ZZLA 1HKQA 4Q4ZF 1Q1HA 3RKXA 4CZZA 1SAXA 4IRHA 1FHRA 3R60A 1B9NA 3M8FA 3U9GA 3CKBA 3RPUA 2W24A 1CF7B 1NHAA 3V7RA 3GW4A 2CG4A 1XDUA 2Q2EA 2VXZA 4A5NA 4WK8F 2D1VA 3E3VA 3L9FA 1PC2A 3T8RA 4L9NA 2YPRA 4WUYA 3WODF 4OIRF 5FD5A 2J9QA 2K4BA 4WNDA 5JHUA 4G7HF 3T0YA 1KA8A 4GXOA 3KLNA 2JRTA 2IVMA 3EYIA 1JGSA 2A68F 2DAOA 2QBYB 1OYIA 5LBQA 4O6JA 2JT1A 3MAJA 5CCLA 4YG2F 3TGOA 4KIGA 2ZNYA 2LDUA 2V79A 3MV3B 2PQNA 3PFIA 1XCVA 4HOBA 3GXOA 4KICA 1ZREA 1LDDA 2UZKA 2P58C 4PGHA 2HFHA 1Y8MA 3MQ0A 4YFNF 4ON0A 3CLOA 2XCCA 1E96B 4XI9A 2HR2A 3P9KA 2XPIA 3MFKA 2V9VA 4HYEA 5BPDA 1WLNA 1R5HA 4GCOA 4MQVA 3NEUA 2BRFA 1R23A 2EFNA 4U0SA 1W5SA 5JI6A 4I0AA 1SMTA 2HS5A 2O8XA 3GZ2A 1BI1A 3DXJF 4HZFA 5G04C 3O2PE 1ZHFA 1Z05A 1FBSA 1STZA 4IVNA 3IL2A 3I54A 3BWGA 4ENJA 5KVRA 5ICFA 3F72A 5J8FA 2IPQX 2RNJA 5FB2A 3GZ1A 1TTYA 2J5PA 2O61A 4ME2A 1OYWA 3WTYC 3AS5A 5D4SA 3F8BA 3MZHA 2CQKA 4ZYEA 1Z6RA 1BJAA 2XAFA 4KYWA 3UOTA 1P4XA 4JQFA 5L3EA 1XNFA 1ZLJA 4IPAA 4M72A 3MV2B 4Y17A 4AY6A 2XKPA 4G9YA 2KCKA 1KT0A 4G7OF 2L54A 2ZJ2A 4PGGA 4L5JA 4GZ3A 2P8TA 2BEOA 2DK5A 1UB9A 4HW0A 1YG2A 4J8EA 1V3FA 5G05J 4Y6CA 5DD4A 5J8CA 3Q9SA 3HTUA 2X4HA 3PE4A 3PO8A 5FT9A 1XDSA 4ABNA 3QDNA 3GYZA 3C3WA 1MJAA 3GUDA 3RU0A 1YS7A 4RGUA 5EX3A 3VA4A 3QP6A 2ZNZA 1FOKA 2VGXA 2PL2A 2MH9A 2EK5A 3BDDA 2K4JA 1CGPA 5FLXZ 1DP7P 4AVPA 3TO6A 3OV8A 2VYIA 4G25A 1LGQA 3GYHX 2ZMEA 4OMYA 4N9HA 3QWWA 4JL0A 1S7OA 4ESJA 2V6CA 2DBBA 2R5SA 4HAMA 4OOIA 1FBUA 3KP2A 4EJUA 5AIPA 3ZMUA 3E6MA 3BP8A 4W9RA 2FE3A 4L0ZB 1PDNC 4UI9J 1WM5A 4AD9A 3LAPA 3ASGA 2DPDA 2P6SA 1LVAA 4KBQA 4HBLA 3VFZA 2XROA 2VBXA 2GXBA 4J0UA 3Q4AB 3TG5A 1ZRDA 4KFCA 4M71A 1GXQA 4OIQF 2LC1A 1O7FA 1ZGAA 1IXRC 1G3WA 1WRJA 2VODA 2XAHA 3RIRA 5ILVA 5HVQC 3CJNA 3ELVA 3Q47B 4YIFA 2Y48A 1I5ZA 2ZBKA 4YFXF 4HX4A 4GZ5A 1KYWA 3LAJA 4QLCU 1I6XA 2DT5A 3I53A 5HLIA 4UVCA 4CDGA 2K02A 3EDTB 4JK1X 3GX4X 3J80Z 2UWJG 2QM3A 4EGXA 3LA3A 1DDNA 4NB5A 4EMSA 4TV7A 2IP2A 1KU3A 3UQ3A 4RS8A 1U8RA 1ZLKA 2A6HF 5EX0A 2GW1A 4H87A 4L18B 4N2QA 3DPTA 2HYGD 1YIOA 2VC0A 2ISYA 1TW3A 2FF4A 2P6TA 1QPMA 3S2WA 1YW8A 1TW2A 3PDNA 5FTPA 2CO5A 3ABUA 1U3EM 2R3SA 2BBYA 2M5WA 5LHIA 3M8EA 5CVUA 4Z2YA 4U0YA 3IWZA 2VGXB 1P5QA 3B73A 4WF2A 1KU9A 4HOTA 4AY5A 5A6CA 2FQ3A 3M7GA 1O3QA 1GXCA 1FP1D 2XAGA 5FZQA 3PE3A 1B1BA 1K7AA 3LY9A 2ZMEB 2PQ8A 2MD5A 4M6YA 5FFZA 3CO7C 3VTYA 2Y0MA 3L7WA 1BC8C 3JW4A 1ZG3A 5FJYA 3BJAA 1XSVA 1OUVA 4GYYA 5FGMA 3FM8A 1YW7A 1XSDA 4LLLA 2H94A 3KS2A 3ISPA 5DYMA 1SD4A 1NA0A 3RO3A 5KJMA 3FFLA 3WU1B 4PCQA 1OR7A 5LHHA 5LEKA 2QYOA 4BT9A 1QO0D 5G04J 3IRQA 1ZYRF 4EGYA 3TGNA 3LY7A 1LDJA 3CKCA 5DUIA 2BUGA 5K5QA 1HSJA 1FNNA 2JPCA 5D8LB 3GEZA 4H7YA 4AWXB 2EV6A 5IT3A 1XGSA 2A07F 1EV7A 4M9XA 3KP6A 1FCHA 3CDHA 3FXRA 3LQQA 4A6DA 2Z99A 2EV0A 5EEHA 2VC1A 3L09A 1UHMA 2DLLA 3KD7A 2Y4TA 4HX8A 1J4OA 3LA2A 1O3RA 2JTVA 2XKOA 2QBYA 3QOUA 2WWYA 4I0BA 4XI0A 1TQIA 3WE3A 1SD5A 1FY7A 3MDBA 2BGCA 4UQYA 1YO5C 3MKRA 1SFEA 3GWZA 3DPLC 4U0ZA 1SD7A 2YX4A 4CGWA 5D5WB 2HTJA 3LWFA 4DQ2A 3U1DA 4RB2C 1R7JA 1KQ9A 3ZMSA 4U7BA 2DI3A 3D5LA 1A04A 4HDVA 4GZ6A 4YVOA 5ARGA 1K2MA 5E8IA 5CJ9A 2YQ8A 3POAA 4WNFA 2BYVE 1LB2A 1JHFA 3ZN1A 4R79A 3E5XA 3RJPA 3CV0A 4MEYF 1WI9A 3BPXA 2UXNA 3FMRA 3WTVC 5FFXA 3QP5A 2P7VB 2IRFG 3GFLA 2MBFA 5CCMA 1ULYA 4WXHA 2IA2A 4ASNA 2W57A 5HDKA 3J81K 2P5VA 2QQ9A 1YJ5C 3BJ6A 2O6GE 3K1NA 2GIVA 2E1CA 4MEXF 3O6BB 3LPZA 4KXKB 1ZARA 2JZYA 2ONDA 1K3NA 4Y13A 5CVIA 3L2CA 2EFOA 5AYWD 1HXDA 5JJ6A 2L4AA 2EA4A 4OIPF 4EJQA 5K5OA 1U6GA 3S7FA 2HZTA 2K86A 2KJCA 5FZSA 1JE8A 2AXLA 1C0WA 3RJVA 3QOPA 1G3TA 2HKOA 2KKOA 1BN5A 2ESHA 4MTEA 1FWZA 4A5MA 5KK1A 3WE2A 4UV8A 3H3ZA 2OQRA 1HBXG 2UY1A 5LGNA 3CUQA 2YX7A 5ICCA 1EH8A 4KN7X 1BI0A 1MJ9A 3ZMVA 4N0BA 3RDIA 5HOOA 3MA5A 3R9AB 4ZZDA 3C1DA 4MGRA 5LRRA 3GZ5A 2HQNA 5TRDA 2D1HA 3LA7A 2PIEA 1SD6A 3WTUC 2LSOA 2KIUA 4BHPA 4R8HA 2VT2A 2VSYA 4ENMA 3HSRA 1QU5A 1KGSA 5LGUA 1LEBA 1S6LA 5C1DA 1Z9CA 1D8JA 3S7DA 4A2UA 2RKHA 3FMQA 5L3FA 1IN7A 5IT9K 2H6BA 3Q49B 1B6AA 2F5CA 4YFKF 4F7ZA 3I59A 2CFXA 3KETA 2FRHA 2C2LA 3MEKA 5EKQD 4O6FA 2KIFA 3VOEA 2W84A 4G2VA 3ESKA 5D4RA 3S7BA 3ULQA 3Q5MA 3F22A 3WTZA 1W7PA 3QU6A 1UJXA 2EH0A 4GYIA 1LEAA 2FEZA 5BPIA 1F4KA 5H6QA 5BOXA 1G4DA 2PMUA 1XGMA 1QZYA 1RI7A 2OZUA 1FLIA 1P6RA 3QKYA 3JSPA 3GVAA 4ZYDA 4N3AA 1P2FA 2HYZA 2HGCA 3I0TA 5AIQA 2F5EA 5ED4A 2JQLA 3V8KA 2C0LA 3CUOA 4I2WA 5LRSA 1XD7A 2IJLA 2RQPA 3KCCA 1XGNA 4I1AA 2AFFA 3F8NA 3F6VA 3ZFWA 3K1PA 1IUYA 4RGSA 4BNCA 1TLHB 4RAZA 5ERIA 3RKVA 5BQTA 1YLFA 2DQLA 4LB5A 3LYAA 1D3YA 2UXXA 5BMZA 2A0TA 1LGPA 4EGZA 5BW8C 3E5QA 2EA2A 2G9WA 5BT1A 4GPKA 2PLYA 1FYLA 3HIFA 3M9AA 2R7FA 2NAZA 1FPQA 2CGPA 2PN6A 4B94A 1W5TA 3WGHA 1SMYF 2JPBA 4G8XA 3FF5A 2EFWA 3UUXA 1R58A 4H7XA 1ZGJA 2Q7FA 2UY1B 4BTAA 3CUQB 1DPUA 3FXUA 4R1HA 1R1TA 5FO5A 2PZIA 5LHGA 3C7JA 2QENA 1XCBA 4N2SA 1IRFA 5DDGA 2PEXA 3RI4A 1T0FA 4HOQA 1ZG5A 5D0QD 1F5TA 2L01A 2FMLA 5K1YA 3FWVA 1EH7A 4JONA 1Z91A 4GO1A 3URZA 1EH6A 1I1SA 2VT3A 4HLXA 5JFRA 2W3OA 4B8XA 4XBFA 3JSOA 4G6DA 3K2ZA 5E20A 4KA4A 2FNAA 2P5LC 5DUKA 2NRAC 3ZMZA 1KYZA 4BHCA 4I9EA 2Q8KA 4AIKA 3K9IA 3I59B 3KZZA 5DCMA 2LNIA 4HORA 4CYDA 1KLXA 4CDRA 2CW0F 2A3SA 5HDGA 3KP5A 3ULQB 2QVOA 4H0EA 5HS9A 1PUEE 2QQBA 4LMYA 4XLPF 5FZRA 5BS6A 5D5XB 3CUQC 1W7PB 3TQNA 1J7KA 1S8NA 3ASDA 2XCBA 4M6XA 3MWMA 4N9IA 4N5CA 2BE5F 4GA2A 3ZMTA 2KATA 3COAC 3ZGQA 1BC7C 2FOKA 4UHTA 4QCJA 3WTXC 3HUFA 2QUFA 3SHFA 3ZN3A 1FX7A 3CVNA 5LCWC 6PAXA 4G2SA 4GCNA 1KU7A 3ROUA 3F6OA 1MD0A 4KNYA 3ECOA 4G26A 2RGVA 1KQ0A 4L5IA 4D9VA 4U07A 2X0LA 2MA3A 2STWA 1FP2A 1R00A 4G1TA 4EV0A 4Y6WA 4LGWA 4BHBA 2Z3YA 3CK9A 3E4BA 4LK1F 2HR3A 4YVQC 3ZQ7A 1TQPA 4KUMA 4CHUA 3E5UA 4K2EA 1LJ9A 1ZG1A 5ICGA 1QZ2A 1QZZA 5D5UB 1VTNC 2EWNA 4L9JA 1AWCA 3R61A 4IRGA 3MEXA 3SZPA 4EVIA 4B09A 1S7AA 3O3KA 1H9TA 1B9MA 1I1GA 2O3FA 2XRNA 5AONA 4RB3C 4O3MA 5F64A 4LB6B 3NRVA 4M9SA 2DW4A 2GQQA 2FO7A 2IF4A 4BQAA 2HKXA 1K3JA 5ICEA 2RVCA 3T5XA 4XSXF 1REPC 3KP4A 1F1ZA 1UFMA 4I17A 3F8CA 3FMSA 3HHGA 2OD5A 4EM1A 5A2QK 3DKWA 2EFPA 3BROA 3GO5A 3N97A 5DCMB 2HQRA 2FU4A 1IRGA 1ODDA 4NQ0A 4AIHA 1YJMA 3WGGA 2KCLA 2UWMA 2PJPA 4CGVA 3G3ZA 1ZAOA 4I09A 4RB1A 1S29A 3DP7A 2BV6A 1YS6A 3CTAA 4MTDA 1ELWA 4G23A 3OUNA 2PG4A 1NZNA 4CXFA 4IHTA 2KRFA 2KB4A 1SFXA 2FA5A 1USTA 2L4MA 3WG9A 1FYMA 1QQIA 5F1RA 1BBYA 2LKPA 3KFWX 1WQ2A 3I0NA 2NNNA 4UVBA 1HXIA 3VB2A 3REOA 2EFQA 4Q47A 1G3YA 4FT8A 3ZMDA 2R7DA 3FXQA 3RO2A 4ESBA 5A7DB 3CVLA 1ZN2A 3ASFA 2VOOA 2STTA 3GLXA 3TAXA 1DMZA 1RNLA 1J59A 3UMZA 5KJNA 3U3WA 4OINF 2EB7A 3VTXA 1HW2A 5G05C 2YU3A 2HTSA 1G6GA 2HYFA 3V8JA 2FBKA 2OOEA 3CVQA 5DV5A 1Z1DA 3WTTC 2FSWA 5KJKA 1O57A 2XIGA 2HO1A 1WAO1 1V4RA 4G24A 4APOA 1J4QA 2M30A 3GQSA 3JAMK 2G7HA 5L3DA 1RUNA 4JA7A 4U0UA 5HDNA 1G6NA 1BOAA 4AIJA 2WV0A 2OAZA 2AVPA 1X3UA 3I71A 3RTRA 2RN7A 3IHUA 2PI0A 2O03A 1FYKA 3I6WA 1MJBA 1YTYA 3JTGA 1I27A 5KJLA 4EQFA 1TNSA 3LFKA 4GYOA 4IF4A 5HS8A 4ENKA 3Q15A 4OU0A 1QGPA 2IA0A 4ENNA 2VE9A 1K79A 2ZO4A 4GCVA 5DBKA 4KMUX 1J4PA 2QQAA 3LSTA 2D45A 3DQVC 5E50A 2K27A 3R0AA 3HRUA 1MZBA 2D2WA 4FX4A 1J0RA 3F23A 1KT1A 2XV4S 4EJVA 3D0SA 4UQZA 4I2OA 3GW2A 2I6HA 1GHCA 1XMAA 1XGOA 1ZRCA 5D6EA 1R36A 2GA1A 2CYYA 3V4GA 4M74A 1IYGA 1FC3A 2P4WA 3VPYA 1UCRA 4WXCA 4OMZA 3IEGA 3RYPA 5DD8A 4I02A 5ILSA 5CVRA 1U78A 2EJRA 3VODA 3ABTA 4U7DA 5DJOA 4P55A 2E1NA 2C6YA 2VBZA 2NYXA 3FM5A 4MQ9F 3LQRA 4N39A 3Q9VA 2H27A 1ZRFA 3ELKA 3U2RA 2KKLA 1FSHA 5ARFA 4HLYA 3I0MA 3R0JA 5IT9Z 3HTSB 3T8TA 4ZYGA 2CWEA 3KE2A 1ONVA 4Q5SF 4EJOA 4U04A 1RIOH 1T2KA 5LCWJ 5EEGA 4LK0F 4MNUA 1PP8F 3GFJA 4A1SA 4I2ZA 4UV9A 3EQLF 3AS4A 4HOUA 4HF2A 4LFUA 1ON1A 5FD6A 1D8KA 3H92A 5H6RA 2GWRA 2ZKZA 2OZ6A 3ZHEB 1Z7UA 2A5YB 4N3BA 3P9IA 4OIOF 1NA3A 2MHKA 2C0MA 2OU2A 1T98A 1XSXA 3NQOA 2NNYA 4MHGA 4A12A 1HSTA 2XGSA 3ECHA 2XASA 2VE8A 2FBIA 4GYGA 1TBXA 3IC7A 3Q5FA 3CK7A 2FMYA 4BWRA 2XEVA 1U5TA 3PQKA 2ZFWA 3V7SA 1WSUA 3IKVA 4EM0B 2V5FA 2OBPA 2NC9A 4LG0A 4BYYA 2JPEA 1QNTA 2F2EA 3BPVA 3HUEA 2FXAA 3SZ7A 1FT9A 2Y4UA 1K78A 1ZH5A 1T38A 4O5VA 2H6CA 1W3BA 3CVPA 4RG6A 2WPVA 3DEUA 4ETSA 3UNMA 2XGMA 1IXSB 5HI7A 4I7HA 1KU2A 3K69A 2PFBA 1E2XA 2PMHA 2CSOA 3QPHA 3I4PA 3K0LA 1TJCA 4QWQA 4XRFA 4L9VA 4IN3B 4A0ZA 2XHKA 2QFCA 1K6OA 3F8FA 2K7LA 4KN4X 1B59A 4Y15A 2QLZA 3BJOA 3IKTA 5E1WA 1R1VA 2G7UA 3EETA 2EV5A 3SF4A 1GXPA 2J5OA 1F9NA 3HX1A 5D6FA 2LF8A 3RKYA 3UPVA 3GFMA 4LLNA 4KMFA 4M73A 3GZ6A 2G1LA 1IN6A 2LNBA 3N71A 3MCZA 4J8DA 2VN2A 2NS0A 1XMKA 3FM3A 2ACJA 3R4KA 3KAEA 4RAYA 5E18F 3HOSA 4BT8A 4I9CA 4UNOA 4BXUA 1ZU2A 2Q0OA 1Y0UA 3QWVA 1K3QA 5E17F 2DTRA 3ZP5A 4GA0A 3W6JB 2L02A 2GA2A 4FHTA 2GZWA 1O3TA 3HRTA 3EUHA 2WTEA 1G3SA 1U2WA 2A61A 2DBAA 3AAFA 1IN5A 2VBYA 3SFZA 5F6FA 5LGTA 1OKRA 3TDZC 1L0OC 1G3GA 2L6JA 1TQMA 1LNWA 1J5YA 4S05A 4CICA 1HKSA 2YHCA 2F5DA 2E2EA 5JR3A 1A17A 1R1UA 4WNEA 3L00A 5L3CA 2XVCA 3P7NA 1IN4A 4UXNA 1HZ4A 2TDXA 4NHJA 1RZ4A 3FX3A 2OA4A 4GA1A 4KDPA 1AOYA 1L3LA 4IHSA 3E6CC 3P9CA 4S04A 4U0WA 1BIAA 2RV8A 3EYYA 3KEQA 2MLGA 3SXYA 3E6BA 2XAJA 1U5TB 4FX0A 3HHHA 3HOTA 2Z9OA 1OMIA 2IT0A 4LG0B 1HKTA 3TG4A 3HRSA 2ISZA 2HDCA 4UUVA 1K78B 3QU3A 3CO6C 3UN0A 1D5VA 2Z33A 4PZJA 2LSVA 4RGRA 4L0YB 3DF8A 3MZYA 4BTBA 2WC2A 3KP3A 2H09A 3J7AO 4XIFA 1O7LA 4L9TA 4ESFA 2E7XA 2DU9A 2HOEA 1HH8A 1HW1A 3T1BA 1PP7U 1OPCA 1MZKA 2XT9B 2M8EA 2M45A 3GFIA 2O0YA 3OXFA 5K5RA 1BI3A 3CK8A 4I98B 1IW7F 3IRRA 3I58A 3QPTA 3TO9A 2V1DA 2YSRA 2VOPA 1YA0A 2DPUA 3LY8A 1IHGA 1IN8A 1QQEA 1IF1A 4YNDA 2JSCA 2VBWA 5FLXK 4U0VA 3VEPA 5D8KB 3LKUA 1KQ8A 2MLKA 4P5OA 3R6SA 1U5TC 5HS7A 2PBIA 1HQCA 4LJZF 4HDUA 1JXSA 2COMA 4I01A 1YFHA 1B4AA 3KP7A 4PDKA 2Z5UA 3KZYA 3BY6A 4HA8A 4DNCA 5BNWA 2KCVA 5JJ7A 3SQNA 2FI7A 1W4MA 1RUOA 3H3UA 1T39A 2IFUA 4LEUA 1UHWA 2KB3A 2IW5A 4G94A 5A2QZ 3I5UA 4HF0A 3ASHA 3BEEA 2OQGA 2ESNA 4XSZF 1JHHA 4Q48A 1O3SA 4CGZA 3TDUC 2VSNA 4U88A 1ON2A 3DFGA 1OYYA 1BIBA 4GYWA 4A0EA 4YIIA 2HEOA 1J4KA 5E1ZB 1WV3A 3I6UA 4G7ZF 2MC3A 3E6DA 3PQJA 3NF1A 4WXDA 3S7JA 2CSWA 1WKMA 2Y75A 1XN7A 1IAWA 3N4MA 1ELRA 4WNGA 1R22A 3HYMB 2IA1A 3RYRA 2FBHA 3V7CA 4UQXA 4HV5A 3GF2A 3HYIA 4HV6A 3FHZA 2RDPA 4HF1A 4F3VA 3J80K 2VONA 3ZN0A 1DPRA 3U4TA 1H9GA 3C18A 2ELHA 1J4LA 4G6QA 3FZVA 2W25A 1QBJA 1J9IA 4CO8A 3TOAA 5HLGA 5LEJA 4E70A 2XGXA 5HQ8A 3I64A 4WCGA 1SFUA 3AS8A 3TO7A 3E97A 1BM9A 2JQIA 5L3BA 4KYOB 3HRMA 3F3XA 3WTWC 3WU0A 1FZPB 2YR2A 2QZ8A 3BOQA 4A0XA 3JYSA 2KC7A 1MDMA 3HSFA 3RIBA 2M1BA 4IJAA 2FBNA 3QWPA 5A8IA 4KIFA 2P7CB 4JA9A 3KEOA 2XUBA 2A6EF 1P4AA 1Z6TA 2L3DA 3JAMZ 1J2XA 5J6XA 5CLSA 1IXCA 3ELSA 4EJWA 3HUGA 1DUXC 4NQWA 5JVTA 4M9ZA 1LQ1A 2JQJA 1W7PD 2P5KA 3QAHA 2MH2A 4HX7A 3G73A 1J75A 3VA1A 2M87A 1USSA 2B0LA 3WXXA 3KT9A 2ETHA 5D5VB 3BZ6A 3ZHEA 5JJTA 3UNNA 4P9UA 3KLOA 4N3CA 4NRHB 5E1XA 4UVAA 3V8LA 1CF7A 1FBQA 1T6SA 1MKMA 4UI9K 1P4WA 3WTSC 1XB4A 4LD5A 3J81Z 3RKWA 2JKDA 2ZXJA 4LLGF 3RPQA 2VQ2A 3O48A 2JLBA 3OXGA 2PQRA 2E7WA 4IXAA 4J8FA 1YYVA 3TOBA 2AS5F 5D0OD 1R5GA 2LF7A 3LCAA 4A6EA 2XGOA 5LLQA 4EM2A 5HLHA 3K9TA 1LDKB 3UV0A 2RC4A 4JBAA 2VGYA 3K1MA 3TKYA 1TNTA 3ERED 1B89A 5CYVA 4RB0A 4P96A 2KJBA 4AM9A 4IRIA 2LSUA 4KIBA 2KFUA 1P92A 3F21A 5TJJA 1WWXA 2ADUA 4UI9C 2V1XA 2ZCWA 4KT5C 3EDPA 3OXLA 1K2NA 1UHTA 1IZ1A 4HQEA 4BH9A 2WQHA 4GGGA 2W85A 4RG9A 4EQQA 5CVJA 5H20A 2DO7A 1YW9A 4D0PA 2KIMA 1GVJA 3W6KB 4HOSA 3HSEA 2FNPA 4ZYHA 4A0YA 5E8GA 4XLNF 5DEQA 5L3GA 2DFIA 3FWEA 1MGTA 1H0MA 3ML6A 1FSEA 1R21A 2F5FA 3ZPLA 3F8MA 4HQMA 2HWVA 5ILUA 3WGIA 2DK8A 3SZTA 2QWWA 4P9FA 2V1UA 1MDMB 4RGXA 1YQAA 1BI2A 1S3JA 3FP3A 1HW5A 4WX9A 3IWFA 3JTHA 4ZH4F
chains in the Genus database with same CATH superfamily
4B4CA 2JUCA 1ZBPA 4OVUA 3OYJA 3DPYA 4UWHA 3QRFF 3CCYA 2F4MB 1TNBA 4WWCA 1D0XA 4BAYA 2R5ZB 2ZJRF 3M1EA 4JC8A 1OLTA 3LL7A 5DIZA 2GAUA 1N78A 4OVVA 4EJTA 3HUGB 5DCFA 3DU6A 2A69F 3L54A 2AN1A 3ZPJA 4AIFA 2VKHA 3B02A 4HS2A 3MMYB 1E90A 1Y3HA 2CHZA 1VQ9I 5CHEE 4DY6A 4YDWA 1IJWC 1UZCA 2QV7A 2NXPA 3DV8A 3OYMA 5M72A 1ZELA 5C4VA 1FHQA 1IHBA 4IZZA 2Y0SA 3CEQA 1QYMA 3OOPA 1E17A 1OWOA 2KLOA 4JHRA 1TZLA 2ZJPF 2GXGA 1VZ0A 5G2NA 4IRUA 2F37A 5CVVA 2DQRA 2XAQA 4ZZLA 4U96D 1HKQA 4Q4ZF 1YJ9I 1JCRA 1P7JA 1Q1HA 3SYTA 2L7KA 1OWMA 3RKXA 2A5WA 4CZZA 1SAXA 3AJIA 2ELKA 3BQZA 4IRHA 4BGDA 1MHQA 2EQXA 3J5PA 1FHRA 3R60A 1B9NA 3M8FA 1N52A 3B6AA 3U9GA 3CKBA 3X2QE 3RPUA 3PH0C 2W24A 1CF7B 3I3LA 4TV3A 1NHAA 1H2UA 3HEFA 3V7RA 3GW4A 2CG4A 1XDUA 2Q2EA 2VXZA 3CP2A 5JLXA 4KITB 1DU0A 2LXMA 3HG0D 2CHWA 2WXLA 1FJLA 4A5NA 4PH4B 4WK8F 2D1VA 3ML9A 4RMNA 3E3VA 3L9FA 5HNFA 1PC2A 4AJWA 3PM1A 3I9V2 3T8RA 4L9NA 2YPRA 1RETA 3TW7A 4OIRF 3WODF 4WUYA 3SO8A 5FD5A 2DFEA 2CQXA 3V42A 4XRMA 5K7FA 4KISA 2K4BA 1EF4A 2J9QA 1U8BA 5JHUA 1SZAA 4WNDA 3ESWB 3FXMA 3HPHA 3T0YA 1KA8A 1X58A 1GUUA 4G7HF 4A3IJ 1JKOC 1DEVA 4GXOA 3KLNA 2JRTA 2IVMA 1OCTC 3EYIA 2RNGA 1L5JA 1JGSA 2A68F 2DAOA 2VQHA 2QBYB 3ML8A 1OYIA 5LBQA 1HE8A 4O6JA 3OL3A 2Y0BG 3FTZA 2JT1A 3MAJA 5CCLA 1WH5A 4YG2F 3TGOA 1WY6A 2DWZA 4HRNA 4KIGA 4A3KJ 2OCCH 2ZNYA 2LDUA 2CS3A 2V79A 5GP9A 1LFUP 3MV3B 2PQNA 3PFIA 3SBSA 5FQ6A 3WG7H 1XCVA 4HOBA 2IS1A 3GXOA 4KICA 3APCA 1SEUA 1UG2A 1ZREA 3PZ2A 4MIMA 1LDDA 5ENOD 2UZKA 2P58C 4PGHA 2Y9ZA 2HFHA 1Y8MA 3MQ0A 2EIJE 4YFNF 2FULA 4ON0A 1IQUA 3CLOA 4IHYA 2XCCA 3QOEA 1E96B 1ZQ3P 3GTPJ 4XI9A 3NB2A 3HXCA 1TWFJ 2HR2A 4I43A 5ANRA 3P9KA 4PDXA 4RLYA 3LSRA 4F53A 2XPIA 4B1RA 2QZAA 3D9PA 3MFKA 4KU0D 4NBQA 2V9VA 1WCMJ 2RQQA 3NARA 4HYEA 1R5HA 4UB8C 5K7ZA 4MQVA 5BPDA 3NEUA 3HOZJ 4JYKA 4GCOA 2BRFA 1R23A 4BQQA 2NVUB 2EFNA 4BE2A 1W5SA 2L9NA 4U0SA 3QARA 4GU5A 5JI6A 3K4JA 2Y69E 3NZSA 1UELB 3SJMA 3DKYA 4I0AA 3FUKA 1SMTA 2LREA 2HS5A 4A3JJ 3PEUB 2O8XA 4IQJA 3GZ2A 4BY7J 1NL4A 1BI1A 2DYRH 3DXJF 4HZFA 3PZ3A 5G04C 4O1PA 4XICA 3O2PE 1ZHFA 2BF0X 1Z05A 4AC0A 3V2XA 1FBSA 3J7AY 4TXPA 1STZA 4IVNA 5J08A 3DEWA 5KNHD 4JIVD 1LVKA 3I54A 2Y2ZA 3IL2A 2MFZA 3BWGA 1AHDP 4JPSA 4ENJA 4DX6D 2Y0SN 4E6HA 4HVBA 3LFUA 2QYUA 5KVRA 5ICFA 3F72A 1FIAA 5J8FA 1NK2P 2IPQX 1SVLA 3IUOA 1JKQC 3RRNB 2RNJA 5FB2A 1MQSA 1CQTA 3JRGA 3FH7A 2DA5A 3TXMA 3V8QA 3GZ1A 2XGEA 1TTYA 3ZVVA 1AKHA 3S1NJ 3M3YJ 3FH8A 3VZBA 2J5PA 3TBIA 2O61A 3E30A 1OYWA 2DIWA 4KVOA 4ME2A 3WTYC 2HVRA 2MG4A 4MFEA 4Y4RA 1XGWA 3AS5A 1WI3A 1LD8A 5D4SA 3F8BA 4CYMD 3MZHA 2CQKA 2VKDA 4ZYEA 1Z6RA 1BJAA 2R17C 1JCQA 2XAFA 4KYWA 3B7TA 2K3PA 1PJRA 3LSIA 3UOTA 1P4XA 4ATGA 4XOPA 4JQFA 5L3EA 1O4XA 1XNFA 3H5NA 1MX4A 3D9NA 1ZLJA 2EIMH 2B9SA 1ETYA 4IPAA 4M72A 3PEVB 3LSJA 1U0TA 2FJ1A 2K85A 3MV2B 3B6CA 1EA3A 4ZJZA 4LG6A 4FLHA 4JB8P 4Y17A 3IV5A 1Y39A 3ASOE 3DRAA 1VQ6I 4AY6A 2XKPA 2XB0X 3OYFA 4TRQA 4WRRA 1MX2A 4G9YA 2KCKA 1WJCA 1ACIA 1KT0A 1IDYA 4G7OF 2D5VA 2XPYA 4E6KG 2L54A 3TWWA 1QRYA 3FTVA 2ZJ2A 3TWRA 4LCTA 4PGGA 3CCQI 4L5JA 4ZYAA 4GTOA 4NNJA 2P8TA 4GZ3A 3VYRB 1YJNI 1FMWA 3MX3A 2BEOA 3UXGA 2DK5A 1UB9A 4HW0A 5F0CA 2LR8A 2HVQA 1YG2A 4GMRA 4J8EA 3OYIA 1OCOE 1V3FA 5G05J 4Y6CA 1MBHA 3HOVJ 1VQ8I 2DA2A 5DD4A 1WPKA 3KYDB 2X1CA 5J8CA 4XN3A 2KZTB 2X6KA 2ZISA 3FU0A 1Y3IA 2XF7A 3Q9SA 1T33A 2EINE 3HTUA 3FUHA 3UINC 2F4OB 3Q73A 2X4HA 2DDAA 1YIJI 2ZXHA 1ELKA 4J7WA 3PE4A 3PO8A 2IBDA 1UN8A 3FISA 3HC7A 5FT9A 2Q2EB 5EEAA 1XDSA 4ABNA 1H2TC 3QDNA 3GYZA 3C3WA 4EZKA 4P1WA 3HIZA 1MJAA 3GUDA 1WJEA 3RU0A 1YS7A 3A1YA 4RGUA 5EX3A 3VA4A 3QP6A 2ZNZA 1FOKA 2WXQA 2VGXA 1D1AA 3L08A 3DEEA 4YIRX 4ILGA 3M07A 4EBAA 2DA3A 2XZDG 2PL2A 2AHQA 3S3MA 2GM4A 1FT2A 3I5PA 3CHOA 4IKFA 1FTZA 4UWFA 4MLOA 5BUZA 1DGRM 2MH9A 2BHYA 4CH7A 2EK5A 1JUSA 1IO2A 4M7CA 3BDDA 2K4JA 3D9LA 1CGPA 3SQVA 5FLXZ 2AXVA 1DP7P 3DBSA 3BZCA 4XKWA 3RRMB 5IYDJ 4AVPA 3TO6A 3OV8A 5GAEJ 2VYIA 4G25A 4C0MA 1LGQA 3GYHX 5GTIC 1W0TA 2ZMEA 2HPMA 1F43A 3APFA 4OMYA 3DXKG 4N9HA 3QWWA 3MYVA 4JL0A 1S7OA 3FBNB 3ZQQA 1S70B 4LNBA 1WLNA 2V6CA 4ESJA 2DBBA 2R5SA 4HAMA 3UM1A 4OOIA 2KT0A 1FBUA 4PSWA 3KP2A 3A0HC 2WB2A 2XB5A 4PJJA 4EJUA 5AIPA 3ZMUA 1YT5A 3E6MA 2LK2A 4E4HA 3GTGJ 3D9JA 5DHQA 3BP8A 4CSWA 4D7NA 3D9KA 2FE3A 4W9RA 4OAYA 4L0ZB 3HXEA 2MW8A 2LRDA 4C3JJ 4MKTA 2EQRA 1PDNC 4V3IA 3G2SA 4UI9J 1WM5A 1DGWY 2NYJA 4AD9A 3LAPA 3ASGA 2DPDA 1K83J 2E1MB 2HQ5A 2DT7B 2P6SA 1LVAA 3L13A 4F91B 5LFAA 4I1OB 4KBQA 3A4CA 4HBLA 3VFZA 2EZLA 2X1DA 3EUAA 2XROA 2LD5A 2VBXA 2GXBA 1NH3A 1FT1A 3PUKA 4J0UA 3Q4AB 3TG5A 2OF7A 1ZRDA 4KFCA 2EIME 5J4VA 4M71A 4I6ZA 1A5JA 3KSQA 2XAUA 3FULA 1GXQA 4OIQF 3MZ8A 5AQAA 2LC1A 2BKKB 1O7FA 1ZGAA 4WAFA 2X6XA 1IXRC 2E2HJ 1G3WA 1KZOA 1WRJA 1RKWA 2XAHA 3RIRA 2VODA 3FEXA 1JCSA 2CMPA 1MNEA 5ILVA 3O8HA 1QHGA 2J09A 4CCLA 5HVQC 3CJNA 2W7NA 2L6BA 2BONA 2P1RA 5EIDA 2WMOA 3PIOF 3TWQA 3ELVA 3Q47B 4TUUA 5EGOB 4YIFA 4AIDA 2Y48A 3LSPA 2X85A 1I5ZA 2ZBKA 4YFXF 1KHUA 5CERB 4HX4A 4DX1A 2JA8J 3GTOJ 1AKHB 1KYWA 3LAJA 4GZ5A 4QLCU 2OPTA 1LFBA 1I6XA 3SEQA 2LTPA 2PJRB 2DT5A 3I53A 5E75A 3KYLA 2EIKH 3OIPA 1FVFA 5HLIA 2B0OE 4UVCA 3I4RB 4PS3A 4CDGA 3OIQA 5CQGA 2DCEA 4XEIG 2K02A 4IYPA 2OCEA 2ID3A 4E7IA 1A35A 4FJZA 3EDTB 4G11A 2J4DA 4JK1X 3GX4X 1YCSB 4L9PA 3J80Z 2LG4A 4XNFA 2UWJG 4G8LA 3CESA 2QM3A 4EGXA 3LA3A 3ONLA 2KRCA 4GFBA 1DDNA 2NS7A 4NB5A 3PNYA 3UKGA 3A03A 4EMSA 4TXRA 4KT6A 4TV7A 4XZ4A 2JA5J 4B8AA 1VQOI 3KEAA 3O4ZA 2IP2A 2R7UA 3K4CA 1JUQA 1KU3A 3UQ3A 4RS8A 3H9JA 1U8RA 1ZLKA 1ZB1A 2A6HF 5IOYA 4XKBA 5HS0A 5EX0A 2E1MC 1HU3A 1MK2A 2GW1A 4H87A 3OYKA 4L18B 4N2QA 3DPTA 5J1UA 3P2BA 2HYGD 3OS1A 2WXFA 1AU7A 1YIOA 2VC0A 3TL4X 2ISYA 4D7MA 2CFUA 1X2NA 1TW3A 2FF4A 2BTDA 4L7TA 2HYJA 2P6TA 3S2HJ 2DTZA 1QPMA 3S2WA 2A5UA 4Z68A 2XRZA 1YW8A 1TW2A 3PDNA 5FTPA 2O9LA 3DCFA 5CQEA 2CO5A 3ABUA 1U3EM 1TNUA 4FADA 2R3SA 3Q3SA 1H6OA 4BQNA 1Z3XA 4YDEA 2M8GX 2RFAA 2BBYA 4NUBA 2M5WA 5LHIA 1I3QJ 4A3LJ 1K3ZD 1Y6IA 1EF1C 3M8EA 1NI1A 2V5QC 1MBFA 1VQKI 3DWLE 3G2TA 1SC7A 4A3CJ 2VL8A 5CVUA 2WM9A 4BESA 4Z2YA 4U0YA 3CVXA 4DX5D 4BXXJ 3BG1B 3IWZA 2VGXB 1P5QA 3JCUC 3B73A 4WF2A 4K0RA 1KU9A 5EG0A 3JUIA 4HOTA 1WG0A 2YINA 1JTXA 3G2VA 4AY5A 5A6CA 3ABME 1MW7A 2FQ3A 3M7GA 3R7QA 4G8KA 4BETA 4BQOA 1YRNA 2PM7A 1WJDA 1O3QA 1GXCA 1FP1D 3S15J 3HHMA 2XAGA 5FZQA 1BJZA 5E76A 2X48A 4RDUA 3HL2A 3PE3A 3FUEA 1B1BA 1K7AA 3LY9A 2ZMEB 2PQ8A 4GPMA 5JELA 3J7YJ 2MD5A 4M6YA 3RPUD 5FFZA 5DHSA 2Q5FA 1N4SA 1MNMC 3CO7C 5T4YA 3VTYA 3ZUVB 3ZQCA 1VDYA 3D5SC 1MSEC 4HQDA 2CV2A 2O7OA 1ZKGA 2L9BA 2Y0MA 2R7RA 3L7WA 1BC8C 3JW4A 1ZG3A 4EECA 5FJYA 4DLQA 3BJAA 1XSVA 2R0QC 3A01A 3OYBA 5FGMA 1OUVA 4GYYA 3FM8A 2BKGA 3PZ4A 4Y52J 5B1AE 4QPQA 2AW6A 2WXHA 1YW7A 3EHNA 1XSDA 1N75A 4LLLA 2FO1E 2ETCA 2H94A 3KS2A 4TXQA 2L0KA 3ISPA 5DYMA 1SD4A 1NA0A 4A63B 3KPHA 3RO3A 2WA0A 3ZYKA 5KJMA 3FFLA 3HG9A 2CU7A 3ZQGA 4CA0A 3WU1B 4JHJA 4PCQA 4RA2A 1OR7A 1T0FC 1WJAA 1HW5A 4DIQA 2XS1A 4ACLA 2DXIA 4R9PA 2KDOA 4IEJA 5LHHA 5KWDA 3SEZA 5LEKA 2ID6A 2QYOA 3H1CA 1QO0D 3K4BA 1TWGJ 3IRQA 3EHQA 5G04J 4BT9A 1ZYRF 4EGYA 1FTTA 3V8NA 4RSYA 2MYSA 1O1TA 3CJQB 3TGNA 3LY7A 1LDJA 4XRSG 3CKCA 4V2FA 5DUIA 2CV0A 2H6HA 4DJAA 5EJFA 3MKZA 3FU5A 2X6FA 2BUGA 1BLXB 5K5QA 2H6IA 2AJAA 1HSJA 1WZ2A 1FNNA 2DFHA 3OYEA 2BEDA 2GOMA 2JPCA 5D8LB 3GEZA 1VQNI 3RAUA 5HODA 4H7YA 4I99C 4AWXB 3GTLJ 4V24A 1QA6A 2EV6A 2GBYA 4UWLA 5IT3A 2R7VA 1QPIA 1EKEA 1XGSA 2A07F 1EV7A 3NOCD 5AIJA 4JZYA 4M9XA 2Z2SB 2ZMEC 3KP6A 5E79C 1FCHA 1YOVB 2WXMA 3W9FA 3CDHA 4CRWA 4JX6A 3FXRA 1HF0A 4DI3A 3LQQA 4A6DA 2LY2A 1WDYA 2Z99A 3KEYA 4ATZD 2EV0A 3PUBA 1U3DA 5EEHA 3VPRA 2H8WA 2VC1A 3L09A 4F1PA 5CRVA 1UHMA 3CMMA 2DLLA 2CJJA 1SQMA 3KD7A 2HI3A 2Y4TA 4HX8A 2HNHA 5BV0A 1J4OA 1XTAA 3LA2A 4N5QA 1O3RA 2JTVA 2XKOA 5HNHA 2QBYA 4GTMA 3QOUA 2WWYA 4I0BA 1YX3A 2E2IJ 1TQIA 3WE3A 5M5WJ 4XI0A 1SD5A 3QPSA 4PFPA 1FY7A 4KT6B 4BUPA 3MDBA 3ABKH 2BGCA 2NOGA 4UQYA 1YO5C 3MKRA 4H4KC 2JA7J 1VQ5I 4ZHBA 3VSKA 1U7FA 1SFEA 3GWZA 5IYBJ 2ZGDA 1EPUA 1Z77A 3V8PA 3DPLC 4U0ZA 5JEJA 4LG3A 2IQCA 1SD7A 1Y1VJ 2I2FA 2YX4A 1LF8A 1UG3A 2WXOA 4CGWA 4AUXA 1G88A 3EU9A 5D5WB 3UR3C 1W5CC 2HTJA 3TJPA 4XLCA 3Q9NC 3SY2A 3LWFA 4DQ2A 3U1DA 4RB2C 1R7JA 2N8GA 1KQ9A 1UJ8A 3ZMSA 4NURA 1K1AA 2KZVA 3Q7FA 3FXJA 2J4BA 4U7BA 3G2UA 1YE9A 2DI3A 5EJGA 3D5LA 1A04A 3KX2A 4HDVA 4GZ6A 5F1JA 4K03A 4YVOA 5ARGA 1K2MA 2P9PG 5E8IA 5CJ9A 3E34A 3KYCB 4BFRA 1HX8A 2X6WA 4NC7A 2AXZA 2IS6A 2YQ8A 2BYVE 4WNFA 5FKOA 3POAA 1LB2A 1JHFA 3OWTA 3EUKL 3ZN1A 4R79A 3E5XA 3RJPA 4U87A 3CV0A 4MEYF 1WI9A 2KISA 3BPXA 2K9SA 2UXNA 4PUSA 3FMRA 4LNGA 3AG3E 3WTVC 5FFXA 4XLAA 3BG3A 2P7VB 3QP5A 3GFLA 5E3NA 2MBFA 5EG0B 2IRFG 5CCMA 2L5QA 1ULYA 4WXHA 4FISA 2IA2A 3ZRGA 4U8VD 4ASNA 2W57A 2H1KA 5HDKA 2R2LA 3J81K 2VQCA 1YRNB 2XPUA 2OTLI 4FHKA 3UM0A 2P5VA 2QQ9A 2DYSH 2GLOA 1HC8A 5KBAA 1YJ5C 1EJ9A 4FA6A 3BJ6A 3K4LA 4XX5A 3ZEFA 2RG8A 2O6GE 4CT4A 3QJZA 3K1NA 2GIVA 3CJRB 1BA5A 3BR0A 2PM6A 1JPLA 1FMVA 2ZXWH 2I1WA 1XC5A 4L5EA 5KNLA 3JRIA 2E1CA 3OYNA 4MEXF 4IHXA 1YX5A 5J90A 3O6BB 2M7AA 3LPZA 1G59A 2HOSA 4KXKB 1U7VB 4CZ2D 1ZARA 2JZYA 1SANA 2ONDA 2LO6A 5B66C 1K3NA 2W82A 1E8ZA 4Y13A 3BG5A 5CVIA 3L2CA 2R93J 4LIVA 3FEYA 2EFOA 2L0TB 5LOZA 2EZIA 1O1SA 3FIWA 4YDOA 5AYWD 1HXDA 2DOEA 5JJ6A 2L4AA 2EA4A 4OIPF 4ANVA 4EJQA 5K5OA 4E7SA 1U6GA 3S7FA 2Z16A 2HZTA 2K86A 2R7QA 1N0QA 2VJIA 2E36A 4OAZA 3IXEA 2E2JJ 3SDGA 1NG6A 2KJCA 2MSYA 3G6EI 2XRLA 1HF8A 5FZSA 1JE8A 4GDFA 1Z3YA 3CDLA 3W2AA 2AXLA 1C0WA 3A77A 2NVXJ 3RJVA 3RSEG 4ZTJA 4ZTFA 3QOPA 1Z21A 1G3TA 3M4OJ 1UHSA 2HKOA 2KKOA 2JN6A 1BN5A 2ESHA 3UKUG 4U95D 4MTEA 2BY1A 2Q1ZB 1FWZA 1O1RA 1WFXA 4A5MA 3RKQA 2IY0C 5KK1A 2A05A 4UV8A 3H3ZA 3WE2A 2OQRA 4KJZA 2M4KA 4JEUA 5ITZF 2HXOA 3BC8A 3F9KA 2J8SD 3PUFA 3CCSI 4WWPA 2E0IA 5F08A 1HBXG 2UY1A 3JRDA 5LGNA 3BQOA 1WHUA 1X4OA 4NC6A 5LP0A 3CUQA 1OWLA 3FKIJ 2YX7A 2WADA 2I8DA 3CHMA 5ICCA 3MZLB 3OS0A 2WAFA 2IO3C 3JUEA 1X1BA 4HFGA 1EH8A 4KN7X 2KZTA 1X5BA 1BI0A 1MJ9A 2L7FP 3GZNB 2IOLA 3ZMVA 4PFOA 3DSTA 4N0BA 3RDIA 5HOOA 3MA5A 4GAAA 1R6RA 4JX5A 4ZZDA 3R9AB 5CMWA 3C1DA 3BUAA 2KDZA 1XX5A 3HDXA 2LP0A 4BE1A 3ZKJA 5J3LA 1ETKA 2MGQA 2XDVA 4MGRA 5LRRA 3RK6A 3V7YA 2IGOA 3GZ5A 5HKPA 2HQNA 2P81A 2D1HA 5TRDA 3LA7A 1TNYA 2PIEA 1SD6A 5FKLA 1N11A 3B7RL 3PRZA 4JIWD 3FXKA 3WTUC 2DMPA 2I2CA 2LSOA 3BR3A 2M34A 2V26A 2KIUA 1QWTA 4BHPA 5CMYA 3LSHA 4R8HA 4EZJA 1DQUA 2VT2A 2VSXE 2VSYA 4ENMA 4HRLA 5JERA 3HSRA 3DPDA 1QU5A 1KGSA 2EZKA 3AG4H 5IPAA 5LGUA 1LEBA 1S6LA 2I10A 1SFOJ 2RFMA 5FROA 1TR4A 5C1DA 1Z9CA 3APDA 2I9CA 1RKTA 2EPFA 1D8JA 5HRYA 4B93B 3S7DA 4A2UA 2QCOA 5LX8A 3FTXA 2V4LA 2RKHA 4XMYA 1SA4A 1HOMA 4XORA 3FMQA 2W4SA 1IN7A 5L3FA 5IT9K 2L7MP 4GTTA 2CRGA 2H6BA 3Q49B 3OYAA 3CCVI 1B6AA 2JWTA 1DCQA 4HNTA 1U7FB 2XZTG 2F5CA 4YFKF 4F7ZA 3S3NA 1BR1A 2R5YB 2X3MA 1LTXA 2L0IA 3ZGKA 1N4PA 2ETAA 4HLLA 4U8YD 2JJ7A 1TWAJ 4C9YA 1OR7C 3I59A 3GTKJ 2CFXA 1K6YA 1YYHA 3UT8A 1MNDA 4FETA 3KETA 3L2WA 3CQZJ 2FRHA 2BY0A 2C2LA 3MEKA 4GTRA 5EKQD 4O6FA 2KIFA 4B47A 3VOEA 2W84A 1OCRE 4G2VA 5FQ8A 2GIZA 4B43A 5D4RA 3ESKA 5KNGA 4ANXA 4M3DA 3S7BA 3ULQA 4C2UA 2HQAA 1NK3P 2ZXWE 3JREA 1D8EA 3C2GA 2B7EA 3K6GA 1OCZE 2XPZA 3Q5MA 3F22A 3WTZA 5EN5D 2QA4I 1W7PA 3QU6A 1OQYA 2K9QA 2ME6A 3GBGA 1UJXA 4PJLA 4GYIA 1LEAA 2FEZA 5BPIA 1F4KA 2JA6J 2EH0A 2ECCA 2F8YA 5H6QA 5BOXA 1G4DA 2PMUA 2DCPA 1XGMA 3FU3A 5B1BH 4X0GA 1QZYA 2GRRB 2H6FA 1RI7A 2OZUA 1S7EA 1FLIA 4L02A 1P6RA 2VPRA 4D9JA 3QKYA 3RSNA 4BJ6C 3JSPA 3GVAA 4ZYDA 4N3AA 1P2FA 1E7UA 3JRAA 2HYZA 2HGCA 3I0TA 1IRZA 5AIQA 2F5EA 4DX2A 4BXFA 2AXTC 5ED4A 2JQLA 3NQPA 2EILH 3V8KA 3MKQB 2XC7A 2I1JA 1I39A 3QAQA 5IP7J 4HSRA 3LVQE 4C9BB 1MH3A 2C0LA 2CG2A 5AQBA 3CUOA 3U21A 3E32A 4I2WA 5EGOA 2M0MA 5J47A 5LRSA 3FKJA 2RD0A 1XD7A 2HZDA 2IJLA 2RQPA 3KCCA 1XGNA 2V9KA 3AG1H 5BXOA 3OS2A 4I1AA 3VLEA 2AFFA 4L2YA 3F8NA 1FVHA 1RPWA 2PJRA 3F6VA 2IJGX 3ZFWA 1IKND 3K1PA 1IUYA 3ZNGA 4RGSA 4BNCA 1LE8B 1TLHB 4RAZA 5ERIA 3CHQA 3BR5A 5BQTA 5E3MA 3I55I 3RKVA 1MBGA 1YLFA 2DQLA 2R92J 3S17J 4LB5A 3ESLA 3LYAA 4FJYA 2P9KG 3SFYA 1D3YA 4I1MA 3ZW3A 4WWOA 3FHEA 2UXXA 3NAUA 1R71A 5BMZA 2WXIA 2HM8A 2KRHA 3W2WA 1LGPA 3TW6A 1LKXA 2A0TA 4AVXA 4EGZA 3CCUI 5BW8C 3E5QA 2EA2A 3OYLA 5CEDB 1PVEA 3U1KA 5AJLA 1OWNA 2G9WA 4A55A 1OCPA 2LYCA 1VQPI 2R7OA 2JEKA 5BT1A 4BJ5C 4GPKA 4WWNA 4ANJA 4B89A 3AG2H 3Q78A 2PLYA 1FYLA 2BY3A 3HIFA 2NVTJ 3CR3A 5EF6A 3M9AA 3SFXA 2R7FA 5F27A 2NAZA 2NVYJ 1FPQA 2CGPA 5AARA 2PN6A 4B94A 1W5TA 3JXJA 4CCJA 3WGHA 1SMYF 2JPBA 1TNZA 4G8XA 2KXPC 3FF5A 2EFWA 2X6HA 3UUXA 1R58A 4H7XA 1Z0SA 1ZGJA 1WJFA 2Q7FA 2UY1B 4BTAA 4EPZA 3L6AA 4GZCA 3CUQB 4GRIA 1DPUA 1DCEA 2BXZA 3FXUA 2ELJA 4R1HA 1FPPA 1R1TA 1MR1A 5FO5A 4XM3A 2E60A 4M6VA 3CD6I 2PZIA 5LHGA 3UI2A 4CCAA 2OCCE 1DD1A 3C7JA 4GTVA 2QEXI 2QENA 1XCBA 4N2SA 3D5RC 1IRFA 2LXLA 5DDGA 4FCYA 2PEXA 3RI4A 3WG7E 3QQAA 1T0FA 4A3FJ 2W48A 3LXUX 4HOQA 2KM4A 1ZG5A 2KQRA 2QQ8A 5D0QD 2XGDA 5ENNA 3BG9A 2VI6A 3LVRE 1U3CA 4IULA 2FQ4A 1F5TA 3IP4B 3OOUA 3BG7A 1UN9A 2H6GA 4GB9A 2X38A 4PJNA 3D3MA 2L01A 5DS9A 2FMLA 5K1YA 4FTHA 2BHZA 3FWVA 5IOZA 1EH7A 5DM7F 2A4ZA 5B3SH 2FX0A 4A3GJ 1TEZA 2F0YA 3QYFA 3AFHA 4DGWB 3A02A 1Z91A 1JWGA 4JONA 5FJ8J 4GO1A 3VLDA 1A31A 3URZA 3DU5A 1EH6A 1I1SA 2VT3A 1B72A 4HLXA 5JFRA 2W3OA 2XF6A 4B8XA 4XBFA 2LAIA 4G6DA 3JSOA 3K2ZA 3AL0B 4PSXA 5E20A 2FNAA 3RQ4A 4C3IJ 4KA4A 2P5LC 2WXGA 1HDPA 4UY8I 1WGXA 2DYRE 5DUKA 1B8IB 1YJWI 3PNLB 1Y8RB 4GMLA 4A3MJ 2VPLA 2NRAC 3ZMZA 4HNVA 2GROB 1Y0NA 2BY2A 1KYZA 4BHCA 3CCJI 4I9EA 4LERA 4DYQA 3UM2A 2Q8KA 4AIKA 3K9IA 3I59B 4DRXE 3KZZA 5DCMA 2LNIA 4HORA 3KT9A 2AQEA 4CYDA 1KLXA 1D1BA 1Z7LA 2KP6A 4E7JA 4CDRA 2CW0F 1WH7A 2A3SA 2VKVA 5HDGA 3KP5A 3ULQB 2DZNA 2QVOA 4H0EA 4UWGA 4BX8A 5HS9A 1PUEE 3C5RA 2QQBA 4LMYA 4HRIA 3UMVA 4L23A 1MBKA 4XLPF 5FZRA 1TC3C 3S1MJ 5BS6A 5D5XB 3CUQC 4F3QA 1LD7A 2LH9A 4XIDA 1W7PB 1ETOA 4V19K 4DK5A 3TQNA 3MVPA 3MJWA 1J7KA 1S8NA 1VI0A 3ABLH 3Q7AA 3ASDA 4JD2G 2XCBA 3TP3A 4M6XA 3MWMA 3PREA 4N9IA 4MRUA 1FOWA 4N5CA 2BE5F 4GA2A 3ZMTA 2G0EA 5FKMA 3RQIA 1JJ8C 2KATA 3COAC 4ILIA 1BC7C 3ZGQA 1HO8A 1U9OA 3DSVA 2DJIA 2FOKA 3HB9A 5M5XJ 3FBIB 2WAQA 4UHTA 5C44J 4QCJA 2HVSA 3WTXC 3B7UX 3HUFA 3F6QA 1T08B 2VJ5A 2R7SA 1BOBA 1APLC 2M2EA 2QUFA 3KZIC 2O8KA 3SHFA 5KAFC 3C2HA 5DM6F 3ZN3A 1TT0A 3DEPA 1FX7A 3CVNA 1IC8A 4NIKA 3TP0A 5LCWC 6PAXA 4G2SA 4GCNA 1RW2A 1FOYA 3S16J 1KU7A 4M3BA 1ERDA 2CW7A 2E1OA 4C30A 3ROUA 4QQIA 2RREA 2IGKA 3F6OA 3LNQA 3CVVA 3LOCA 3Q0UA 1MD0A 4DPRA 4B44A 4IL6C 4BEHB 1Z5SC 2P9SG 2JSPA 4KNYA 3IH2A 3DSXA 3AL0C 3ECOA 4G26A 2RGVA 4RAFA 4ACKA 1KQ0A 3HOWJ 4L5IA 4D9VA 2HE0A 1BPOA 4U07A 4E85A 1UW4B 2M0CA 4A3VA 4A69C 4D5FA 2X0LA 1HG5A 2AXUA 4DZJA 1X1DA 2MA3A 4BU2A 5M3MJ 3U64A 3FXOA 2V7FA 1E3HA 3NBNB 3C2BA 2STWA 1FP2A 1R00A 4FE7A 4G1TA 4EV0A 5TGTA 3HOUJ 4Y6WA 4LGWA 3ZCOA 4BHBA 5CRUA 2F48A 2Z3YA 2P2CP 3CK9A 4LK1F 1V54H 2WBMA 2CHXA 3E4BA 2HR3A 4YVQC 3ZQ7A 1TQPA 2CV1A 2JMWA 1T8IA 4KUMA 5IY5H 5A23A 3DBLB 3E5UA 4AU7A 4CHUA 3EIJA 1MMNA 5FIOA 4K2EA 3J5QB 5T8IA 1LJ9A 5BV1A 1ZG1A 2F6CA 2IU1A 4PJMA 3H9GA 4LSZE 3PSFA 4E7ZA 3GTJJ 5ICGA 3HJEA 1QZ2A 1OFCX 2PX9A 5B3SE 1QZZA 3MKLA 2RAEA 5D5UB 3V7WA 4Y7NJ 4W97A 2EWNA 1VTNC 4XKVA 4L9JA 1AWCA 3CDIA 2IS2A 3R61A 4EZLA 3FDYA 3AU4A 4IRGA 4BE0A 2COBA 1M1EB 2WV1A 4CZCA 4OAUC 2P9NG 5JEOA 3MEXA 4BERA 2VASA 2XF5A 3SZPA 3VWBA 2LAHA 3H36A 4EVIA 2A5EA 5KAIC 4BDYA 4B09A 1S7AA 2XQ0A 3SD5A 1SFKA 4LITA 2KBXA 1V55H 3UKRG 1K61A 3JTHA 2DA1A 2UV1A 3H5RA 3O3KA 1H9TA 1U0RA 3W3CA 4MBGA 3RZOJ 3QYEA 1K4SA 3HPGA 1B9MA 3SBTB 1I1GA 2O3FA 4FULA 2DDBA 4GTSA 2XRNA 2DA6A 2F5VA 4J01A 3G1OA 5AONA 4RB3C 4O3MA 5F64A 4LB6B 5FRMA 3AKZA 3CQCB 4NACA 3NRVA 2ETBA 5F0FA 4AYBA 4M9SA 2DW4A 1GV5A 2GQQA 2KHMA 2LLKA 3ENEA 3CHSA 2LBFA 2ZJQF 2J08A 2V4HC 4F52A 3LSKA 4Y33A 2FO7A 1S9HA 2I2AA 2W1OA 3G1LA 2IF4A 4I6EA 3ZXPA 3CP8A 5FWQA 1K1BA 4DYRA 1N9AA 4O1OA 4BQAA 2CQQA 5FLVA 2HKXA 3GMEA 2FUG2 1X3ZB 2WAQN 2RVCA 5ICEA 1K3JA 1INZA 1JT0A 3T5XA 4XSXF 1REPC 1B72B 1YITI 3GCMA 3D9IA 2I1KA 3KP4A 1F1ZA 3PZDA 1UFMA 4BJTA 2R02A 4I17A 2PMZA 3F8CA 3FMSA 3HHGA 3CCRI 2OD5A 1UG0A 3HOXJ 5BPPA 1BL0A 4EM1A 4LOCA 1ETXA 3ERMA 3R7RA 5A2QK 5EJHA 1X1PA 3DKWA 2DFFA 2EFPA 3BROA 3GO5A 4ZC3A 3N97A 1VQ7I 1RESA 2DT6A 5DCMB 2E34A 2HQRA 1I3AA 1U7VA 5GPAA 2FU4A 1IRGA 1ODDA 4NQ0A 4AIHA 2CG3A 1W1WE 5AJDA 2AO9A 4V2GA 3LEWA 1YJMA 3Q0VA 3WGGA 3V8RA 4HSTA 2KCLA 2UWMA 1KPSB 2PJPA 4CGVA 3FTSA 4F6RD 3G3ZA 3HXLA 1OJLA 2LOOA 3MCXA 4C2TA 2ZC2A 3D9MA 1ZAOA 1IXVA 4J19A 4I09A 3PS6A 1IRXA 1KZHA 1S29A 3DP7A 2L9RA 4RB1A 1BU9A 2BV6A 1YS6A 3CTAA 3K2AA 4MTDA 3K7AJ 3ZOBA 1ELWA 4G23A 4Z6YA 3CSFA 3OUNA 2PG4A 2EIKE 1NZNA 3FUDA 5D2MC 5DTDA 5E3LA 4CXFA 2E5ZA 4IHTA 2KRFA 1UJKA 2KB4A 1SFXA 2E35A 4KMOA 1EYHA 2DODA 3DSUA 2FA5A 2L2OA 1USTA 2L4MA 3WG9A 1FYMA 3PO2J 1E8XA 3C3RA 3CSTA 1QQIA 5F1RA 1E3OC 1BBYA 2LKPA 3KFWX 1WQ2A 3I0NA 3FUFA 2NNNA 5IP9J 1R5ID 4UVBA 1HXIA 3E37A 4P29A 1QZEA 3VB2A 2AVPA 3IHYA 4NC8A 1GT0C 4BY1J 3REOA 3S14J 2EFQA 3ZU7B 4Q47A 1G3YA 4ZDPA 4FT8A 3CHPA 3ZMDA 1TT5B 2R7DA 2DVWA 3FXQA 3RO2A 1PAQA 3FY4A 3ASNH 3UNGC 4ESBA 5A7DB 3CVLA 1ZN2A 2K40A 2MC4A 4Q96A 2VXDA 3ASFA 4BSZB 4OAVB 1N4QA 2VOOA 2BOLA 2STTA 3GLXA 5H7PA 3TAXA 5KHDA 1DMZA 1RNLA 1J59A 4MLPA 3UMZA 5TISC 5KJNA 1VFCA 3U3WA 4F92B 4OINF 1I6HJ 2XSDC 2ZGGA 1Y56A 2EB7A 3CMEI 2K9LA 1HW2A 2BZTA 5G05C 4ABZA 3VTXA 2YU3A 2HTSA 2IGNA 1H6PA 4AYBN 1G6GA 2HYFA 3V8JA 4URKA 1Z0ZA 4DOZA 4M3FA 1XPXA 2WXKA 5JA4D 2YS9A 2W00A 2FBKA 3I4MJ 3QWLA 1ZTRA 4ZDLA 2KL4A 1SA5A 2OOEA 3CVQA 5DV5A 1Z1DA 3L17A 5JEKA 3BT9A 4JEHA 3WTTC 2FSWA 5KJKA 3A2KA 1O57A 2QKLB 2QSGX 2XIGA 3TWVA 4I6JA 2HO1A 4UUCA 2CQ7A 2BXYA 3CC7I 3MKYB 1WAO1 3CGHA 1V4RA 4K5BA 3S3OA 4G24A 1MIJA 1OCCH 2ZSHB 5C2YA 4APOA 2I5UA 2QYJA 2PMZN 1J4QA 3ISMC 5LD2C 2M30A 3GQSA 1POGA 1AWCB 4RBOA 3JAMK 4XL9A 2R5YA 4ILHB 3K4MA 4XLEA 2F8XK 1YI2I 2G7HA 3FUNA 3MGBA 5L3DA 1RUNA 4PS8A 3B7BA 4JA7A 3FUJA 4U0UA 2UUZA 5HDNA 3W2VA 4Q94A 5H2FC 1G6NA 2OV7A 1BOAA 4AIJA 2WV0A 2OAZA 4AM3A 1MX6A 2QF7A 3N05A 1TNOA 1X3UA 3I71A 3RTRA 3PJRA 1DNPA 2RN7A 1H19A 3S1RJ 3IHUA 1VQMI 2PI0A 2O03A 3TWSA 4A4YA 1FYKA 3I6WA 1MJBA 1YTYA 3BTIA 1I27A 3HKZA 3JTGA 2CFZA 5KJLA 2B63J 3W9GA 4EQFA 5EYPF 1TNSA 2DOFA 3LFKA 3LSGA 4AOFA 3X2QH 3L2RA 4GYOA 3CVUA 4IF4A 2VJ8A 1WJ5A 5HS8A 3HXBA 4ENKA 3Q15A 4IOAF 4W1UA 4OU0A 1QGPA 2BW3A 2IA0A 4ENNA 2VE9A 2LBFB 2L9SA 4QIWN 2E71A 1K79A 2ZO4A 1IV8A 4GCVA 5DBKA 4RM3A 1E8WA 2VQLA 4KMUX 5FQ4A 1J4PA 2QQAA 4C3HJ 4B8CB 2H8RA 3LSTA 3L2VA 3C72A 5M5YJ 3DQVC 2D45A 5E50A 2GXAA 2K27A 3R0AA 3HRUA 3DBHB 2YUSA 4UUTA 1MZBA 3ZYMA 3MKQA 2D2WA 2P9LG 3LDZA 4FX4A 1J0RA 3F23A 4DW6A 1KT1A 2V0PA 3BCAA 2XV4S 1PUFB 3DSSA 4A3TA 5KCMA 2V6EA 4EJVA 3D0SA 5J40A 1NP7A 2X1EA 2WXPA 3OTNA 3QK0A 3DLLF 4UQZA 4I2OA 2MYOA 3GW2A 2I6HA 1XMXA 5F04A 1XMAA 1XGOA 2NXNB 1ZRCA 1GHCA 2HXIA 5D6EA 2YNQA 4KVMA 4B0ZA 1R36A 2GA1A 2CYYA 3V4GA 3G4SI 4M74A 4E7LA 1FC3A 3HOYJ 1H0AA 1IYGA 1J2FA 3E33A 1TP4A 3SGHA 1Z0UA 3EHRA 2P4WA 3CMAI 4CT0A 3VPYA 1UCRA 4BL0B 3OYCA 2R7WA 4WXCA 1Q1VA 1LE8A 4OMZA 3L2QA 3IEGA 5AQ7A 3RYPA 5DD8A 4AVZA 1X81A 2EIJH 4I02A 5ILSA 3QB2A 4KZCA 1BI7B 3D1NI 1K8KG 3G1MA 1A6QA 2J07A 2HDWA 5CVRA 1U78A 4IHWA 5EZHA 5CKTA 1H88C 2EJRA 4MO7A 3VODA 4XRSA 3IV0A 3V2OA 3ABTA 2IEKA 3WU2C 4U7DA 3BCBA 1XS9A 5DJOA 4P55A 1D0ZA 3HGGA 1YMPA 1Z67A 9ANTA 2E1NA 2C6YA 2VBZA 2NYXA 2WVIA 3FM5A 4QSHA 4MQ9F 2X6IA 4K5AB 4CEMA 4PUCA 2Y69H 3LQRA 4N39A 1ENHA 1JUMA 3Q9VA 2H27A 3DITA 1H89C 1QNFA 2XHEA 3E7LA 1ZRFA 3ELKA 3U2RA 2KKLA 3G2BA 2WQ7A 2Y3AA 1FSHA 4AXHA 4HAOA 5ARFA 2ECBA 4HLYA 3I0MA 4FASD 2Z1DA 3R0JA 4UUSA 3HTSB 5FRNA 2E19A 3T8TA 5IT9Z 1BI8B 4ZYGA 2CWEA 4M3EA 3KE2A 1ONVA 4Q5SF 2HOAA 4EJOA 4U04A 1A6IA 1RIOH 1P9QC 1T2KA 4HNAD 3ABKE 5J4YA 5AAOA 5LCWJ 5EEGA 1VF9A 4LK0F 1OCCE 3VZCA 3W6VA 3GTMJ 4MNUA 1PP8F 4NQWB 3S2AA 3GFJA 3CCLI 3CLJA 4I2ZA 4A1SA 4UV9A 3EQLF 3FHNA 3AS4A 4HOUA 5ENTD 4HF2A 2HOTA 3HKZN 1UJJA 4LFUA 1ON1A 1FEXA 3D9OA 5FD6A 3VYSB 3UM3A 2ZB9A 4RM2A 4CDMA 2DMUA 4BY6A 3CMYA 1ORKA 1D8KA 3H92A 5H6RA 3FH5A 1U0JA 2GWRA 3RCOA 3JRCA 2K3FA 3PUJA 2ZKZA 1OISA 2OZ6A 3ZHEB 1J09A 1Z7UA 1GDTA 2A5YB 1SUWA 4N3BA 1VQLI 3P9IA 4OIOF 1NA3A 2MHKA 2C0MA 3H9QA 1NG7A 1MMGA 2OU2A 1T98A 1XSXA 3E0JB 3NQOA 2X6JA 2NNYA 1IDZA 1HCRA 1MJ0A 1H2VC 4MHGA 4U63A 4A12A 3OAWA 1HSTA 2XGSA 3ASOH 4N4NB 3ECHA 2XASA 2VE8A 4JP0A 3OSGA 2FBIA 4GYGA 3CC2I 2M63A 2L7ZA 1TBXA 3IC7A 3TWXA 3S32A 3Q5FA 3CK7A 2FMYA 3NWTA 5IP6A 4BWRA 1B8IA 1UAAA 2XEVA 3H3VK 2AWIA 3FU6A 1U5TA 3PQKA 3PSIA 2CFOA 3LSMA 2X51A 2ZFWA 5CEAA 4UWKA 5BVIA 3V7SA 1WSUA 3IKVA 4EM0B 2V5FA 1N25A 2OBPA 2K9NA 1SAUA 2DYSE 2NC9A 3TL5A 4LG0A 4BYYA 2JPEA 1QNTA 2F2EA 3BPVA 4XONA 3JQ0A 3P1UA 5CBOA 3HUEA 2FXAA 3C98A 5JMND 3SZ7A 3UIOC 5DHUA 1FT9A 2Y4UA 1K78A 1OCOH 1T38A 1ZH5A 1QVUA 2MD0A 2R03A 4O5VA 1DU6A 2H6CA 4A3DJ 1ETWA 1OY3D 1W3BA 3CVPA 4RG6A 1U2VG 3DEUA 2WPVA 2Y9YA 4ETSA 4BSXA 2DOAA 3J7ZI 4F7AA 3UNMA 2XGMA 1IXSB 2LKSA 5HI7A 4I7HA 1ZGWA 1KU2A 3K69A 2IEJA 2EINH 3OYDA 4C48B 2IOSA 2PFBA 4HLEA 2QVLA 2FOWA 1N94A 3KIOA 4EBAG 1E2XA 2PMHA 1Y8QB 2CSOA 3QPHA 5AENA 3I4PA 3FK7A 2BW3B 3K0LA 3K4NA 1TJCA 4QWQA 4XRFA 1E3PA 4L9VA 4IN3B 3QNKA 1ETQA 2OVBA 1S0PA 2DA4A 4A0ZA 1DC2A 4XE0A 2XHKA 3DTIA 3HZJA 3VSLA 2QFCA 1K6OA 3F8FA 2K7LA 3BG0B 4KN4X 1GLNA 1B59A 2LMDA 4B3AA 2XGCA 3VYTB 3MKWB 1EDUA 4A3EJ 2CW8A 1RC9A 2QLZA 3BJOA 4Y15A 3IKTA 4JVSA 5E1WA 1R1VA 3OSFA 2G7UA 1WJBA 3RRUA 3IAS2 3EETA 2EV5A 3SF4A 1GXPA 4G6TB 4II2A 2J5OA 5FKNA 2R4GA 4BEPA 5EZGA 1F9NA 3SZGA 2Y1LE 3HX1A 5D6FA 2LF8A 3RKYA 1D8DA 2GRPB 4J8YA 3UPVA 3AU5A 3QC1A 3GFMA 2OV8A 3JCKC 3M8JA 4LLNA 4B3XA 4KMFA 4M73A 4BEHA 4MS6A 3OIOA 2VJJA 3GZ6A 3EIQC 2G1LA 1IN6A 2LNBA 3N71A 2OTJI 3MCZA 1P7IA 2OJED 4PJ0C 3ZQHA 2VN2A 4J8DA 4WERA 2NS0A 1XMKA 3FM3A 3GMJA 5DHTA 2ACJA 3R4KA 3KAEA 3L82A 3P5JA 4RAYA 5E18F 1ZR4A 3HOSA 1BD8A 2OVFA 4BT8A 4I9CA 3S93A 2GRNB 4UNOA 4BXUA 4AV7A 2IONA 1ZU2A 3NAWA 2Q0OA 1Y0UA 3QWVA 3V79K 1A5EA 3BZKA 1K3QA 5BNGA 2DTRA 3OY9A 3ZP5A 5E17F 3ULYA 1GW6A 4BDZA 4GA0A 1S64A 2BVMA 4LRZA 3W6JB 2L02A 2GA2A 2EBIA 2GZWA 4FHTA 4DYCA 2DMNA 4DBRA 1O3TA 3PVLA 1HS6A 2CUZA 3HRTA 5M3FJ 1X3WB 3EUHA 3K4KA 1QU3A 2WTEA 2H1LA 1G3SA 3PFYA 5J1YA 2QSHX 2ILRA 1GVDA 1U2WA 4GMJA 3HXFA 5JHFA 3TEDA 3CZ6A 2A61A 4FE4A 4BKXA 4CYCA 2WMNA 2DBAA 4E7KA 3AG4E 2JVHA 3FXLA 3AAFA 2XS8A 1ITYA 1IN5A 2VBYA 4UUSB 1JUPA 1MMDA 4KZ0A 4NDLA 3SFZA 5F6FA 4FLBA 4PS7A 5LGTA 1OKRA 1JI8A 3TDZC 1L0OC 1G3GA 4RAGA 2LC2A 3DTKA 3U9WA 1TWCJ 3V31A 1IUFA 2L6JA 3L16A 1TQMA 2OC6A 3V8MA 1LNWA 4DX7D 1J5YA 3DWLG 4S05A 2IS4A 2WXJA 2K9MA 4CICA 1HKSA 2YHCA 2KIQA 2I2DA 1DVPA 2O5RA 3E1SA 2F5DA 2HDDA 4XK4A 2E2EA 5JR3A 3HRAA 1A17A 1R1UA 4U7EB 4WNEA 2JUGA 4C0EA 3CLQA 1RR8C 1UOHA 3BU8A 2CQNA 3BTCA 3L00A 3H0DA 5ENQD 3V80A 5L3CA 2PNNA 5JHBA 2XVCA 3P7NA 3EHMA 1IN4A 4UXNA 1TJFA 1HZ4A 2TDXA 4RQIA 4NHJA 1RZ4A 3FX3A 2WXRA 3FUIA 5G55A 2KMUA 3VYUB 2OA4A 2ZSIB 4GA1A 4KDPA 1AOYA 3L9TA 4UB6C 1L3LA 4CDNA 3ULEG 4IHSA 2XPVA 1KONA 3H35A 3OR2C 3P9CA 4S04A 3E6CC 3S2DJ 1QBQA 4U0WA 1BIAA 2NSZA 3BQYA 3LJNA 5B1BE 2RV8A 1G2HA 3EYYA 3KEQA 3MD2A 2MLGA 3ZXSA 3G71I 1HFAA 3SXYA 3FDHA 2FD5A 3E6BA 2XAJA 1LUJB 4A3BJ 1U5TB 3CF2A 1TN6A 3L22A 4FX0A 3HHHA 5EDSA 3SDBA 2LVSA 3HOTA 1VNDA 2Z9OA 3ONKA 4HPQA 1OMIA 2IT0A 4EATA 2EILE 4LG0B 1HKTA 4QPOA 3JQ1A 3BR2A 5AN8A 3TG4A 2JRMA 2V9PA 5EYRA 5CECB 1HA8A 3HRSA 2GRLA 2ISZA 3CJTB 2HDCA 5C4XJ 4UUVA 1K78B 3QU3A 3CO6C 5FKKA 4TUMA 3BR6A 3UN0A 3RZDJ 3PNTA 4JX4A 5FLMJ 1D5VA 3U66A 1HLVA 2Z33A 4PZJA 2LSVA 4LUNU 4RGRA 4L0YB 1HG2A 2J49A 4K5CA 3AG1E 3DF8A 3MZYA 2NVQJ 4HB5A 4QTRA 3VLFA 4BTBA 3C3QA 2WC2A 3OYHA 3KP3A 1Y1WJ 1GV2A 2H09A 3J7AO 3C3OA 3EU5A 1SZ9A 1IGNA 4XIFA 5D66A 1O7LA 1FOXA 4L9TA 4ESFA 2E7XA 3HVEA 2HOEA 1HH8A 3OMYA 1HW1A 1WVRA 4J6IA 1YHQI 3R9MA 3T1BA 3ZYLA 4ZDOA 1D0YA 1PP7U 1OPCA 1NFIE 4APFA 1MZKA 3DSWA 2AQFA 2XT9B 2M8EA 2YHEA 3F0CA 2M45A 3GFIA 2O0YA 3HGYA 5K5RA 5EJCA 1BI3A 4EEFG 3CK8A 3OXFA 4I98B 1IW7F 4IO9F 3DXMG 3H5AA 5GADJ 3IRRA 1KHXA 3ABMH 3I58A 3QPTA 3TO9A 3AFOA 3Q0WA 5K7HA 2GRMA 2VQGA 3AG2E 2V1DA 3GZSA 2VTBA 1X19A 2YSRA 2VOPA 3EJNA 3IHVA 4DUIA 4XLFA 5J1RA 1YA0A 2DPUA 4FQGA 3LY8A 1IHGA 3TWTA 3QPLA 1IN8A 1QQEA 2LY9A 1IF1A 3V7UA 2EH3A 1MBJA 4YNDA 4QFVA 5EYLA 2JSCA 2VBWA 4Y3OA 5FLXK 3SI5A 4U0VA 3CQGB 3VEPA 3DTEA 5D8KB 3LKUA 2XEHA 1HDDC 1KQ8A 3M1CA 3PIPF 1SVXA 3LJ3A 2MLKA 1JJ6C 1F36A 4P5OA 3R6SA 1U5TC 5HS7A 5EDNA 1N4RA 2PBIA 5FQ7A 4C2MJ 4XKCA 2M3AA 1HQCA 3T9KA 4LJZF 4JXTA 4HDUA 1JXSA 5CBNA 3HBLA 2COMA 1T95A 4I01A 5B1AH 1W0UA 4BBSJ 1YFHA 3BG6A 1B4AA 2OEVA 3B7SA 4F93B 4CCKA 3KP7A 4PDKA 2Z5UA 3KZYA 3FTWA 2DN0A 4ZFHA 3BY6A 4IQ4A 4HA8A 2R05A 4D5CA 4DNCA 5BNWA 3MN2A 4YRVA 2KCVA 5E3OA 4G12A 5JJ7A 4RLQA 2IAIA 5BXUA 3SQNA 1X1AA 5FINA 2FI7A 3B13A 4CYCB 4Q69A 1W4MA 4M3OA 1RUOA 3FTUA 3H3UA 1T39A 2IFUA 3BR1A 4LEUA 5JHAA 1G3NB 1UHWA 3BTLA 2I2BA 2IW5A 4G94A 4ANWA 2KB3A 5A2QZ 3I5UA 1MMAA 4HF0A 3ASHA 3BEEA 2OQGA 1H6KA 2ESNA 4XSZF 2DJNA 1JHHA 4Q48A 1O3SA 4CGZA 1D9SA 3IBEA 1Z0XA 2KZGA 4MFDA 3TDUC 4E7HA 1BW6A 4U88A 1ON2A 2DA7A 2VSNA 4DLOA 3DFGA 1OYYA 1BIBA 2Y30A 4BS9A 4XQFA 2X9DA 2B6CA 4GYWA 4HI8A 4A0EA 2JGRA 4YIIA 2HEOA 1J4KA 5E1ZB 2OUMA 1WV3A 3I6UA 4G7ZF 2MC3A 1OXJA 3S40A 3E6DA 2F4IA 3PQJA 4XN0A 3QYBA 1TN8A 3NF1A 4FP7A 4WXDA 4JHKA 2VJ4A 1R49A 2ZIRA 3S7JA 3SNXA 3CC4I 2CSWA 2BVLA 1WKMA 2Y75A 1XN7A 1IAWA 5F0HA 2LFBA 1K4TA 1FIPA 2QKMB 2IGMA 3CCEI 1BR2A 3EPZA 3ABLE 3N4MA 2WB1A 1ELRA 3G2WA 4HEA2 3JRFA 1R22A 3ZQFA 3HYMB 2IA1A 4WNGA 5CPRB 2FBHA 3RYRA 3V7CA 3AAAC 4UQXA 4HV5A 1IV6A 3GF2A 3HYIA 4HV6A 2VLAA 3KSLA 3UT4A 1I50J 1PUFA 1S63A 3FHZA 2RDPA 4HF1A 3CHRA 4F3VA 1MBEA 1V5FA 3IH3A 3J80K 2VONA 3ZN0A 1DPRA 1R4NB 2GRQB 3B95A 4FHJA 3ZRHA 2X6OA 4X8QA 1H9GA 3U4TA 3C18A 4RLFA 3JRBA 2TCTA 2VB6A 1D1CA 2LKXA 2ELHA 4BACA 4R7LA 4JOMA 3T8MA 5JVGF 3EUHC 2VGEA 4G6QA 1J4LA 3FZVA 1SW6A 2W25A 1JT6A 1QBJA 2M4GA 1S5LC 4XOTA 1E0EA 1J9IA 3UX4A 4F55A 5EJIA 1YGSA 5EIBE 3K70C 3PNTB 2WY8Q 4CO8A 2YU9J 2XRYA 3TOAA 5HLGA 1KZPA 4S0HB 3ZR8X 5LEJA 3HXDA 4E70A 2XGXA 3ZIMA 3GTQJ 5HQ8A 2VUMJ 3DPUA 3I4NJ 3I64A 4WCGA 5GAGJ 1SFUA 3AS8A 3TO7A 3E97A 1BM9A 1V5EA 5L3BA 2JQIA 3Q9UC 3L2UA 4GTQA 3DLAA 3HVEB 1JTYA 2JQ7A 1ETVA 4ITVA 3CIAA 3HRMA 4KYOB 3F3XA 3WTWC 3WU0A 3JR9A 1FZPB 4IHVA 2YR2A 3FUMA 4AEZC 2QC9A 1XG1A 2QZ8A 4X1EA 3HDDA 3T8KA 5GAHJ 5DHPA 3BOQA 2R7XA 2GOXB 4FC8A 4GZDA 4A0XA 3AG3H 5IYCJ 3JYSA 3VZDA 1N77A 2KC7A 1A36A 1W36C 2IO2C 3I56I 1MDMA 1LPQA 3PO3J 2ME0A 3HSFA 4U8HA 3RIBA 2M1BA 3PL8A 1V54E 4IJAA 1PY1A 4BX9A 3EUVA 2FBNA 3WHBA 3QWPA 4KIFA 5IY5E 4AP2A 2ZFUA 5A8IA 2P7CB 2OEWA 3NZUA 4JA9A 1NTCA 1N0RA 3KEOA 2XUBA 2MOWA 2A6EF 5HLTA 2R5ZA 3TWUA 1P4AA 1Z6TA 4XR6A 2VTBB 2L3DA 2NOJB 3JAMZ 1J2XA 5J6XA 5CLSA 1IXCA 1ZOQA 3ELSA 4EJWA 3HUGA 2K5CA 5C3EJ 1DUXC 2LUHA 3FTYA 1VQ4I 4NQWA 4N4OB 5JVTA 4OYSA 3GLLA 3A0BC 4M9ZA 2CUEA 1LQ1A 2JQJA 1W7PD 5C4JJ 4JW1A 2MABA 4HXIA 1TYQG 2P5KA 3QAHA 2MH2A 4HX7A 3G73A 1J75A 4DBQA 2A6TA 4DI4A 2XXSA 3FK6A 4OWRB 2P9UG 1TN7A 2QGUA 2XENA 3VA1A 2M87A 4CCNA 2ZXIA 4IOCF 3S1QJ 1USSA 2B0LA 4YEJA 1V55E 2GGFA 3WXXA 2WQ6A 2ETHA 3OR1C 3Q79A 5D5VB 3BZ6A 1T56A 2IXSA 1JKRC 4M3GA 2HPIA 1TL8A 3ZHEA 5JJTA 1MJSA 3UNNA 2M9HA 4P9UA 3KLOA 4N3CA 4HI9A 3OL4A 4NRHB 5E1XA 1SVOA 3O8GA 4UVAA 1N95A 1R9TJ 2DMQA 3V8LA 2WAEA 2JVGA 1FBQA 1AA7A 1CF7A 1T6SA 3FP3A 3PNVA 2ICWG 1MKMA 3L1PA 1V5GA 4UI9K 4CUGA 2L9VA 1P4WA 3H0GJ 4LIUA 3DBRB 2WB1N 3WTSC 3HM5A 1UMQA 2VIXA 3IH4A 1XB4A 4LD5A 3J81Z 3RKWA 3S8PA 2WXNA 4X6AJ 1OT8A 4A1GA 3DKXA 3KEZA 2JKDA 2ZXJA 4LLGF 1N54A 2DZOA 3RPQA 2VQ2A 4L2LA 2JK3A 3O48A 2JLBA 2HU9A 1JWFA 3OXGA 2VSOE 4J00A 2R7ZJ 2PQRA 5JEMA 2MRIA 2LY1A 3TMOA 2E7WA 4IXAA 1LFPA 1DP3A 3ZQIA 4J8FA 1YYVA 1ZK8A 3TOBA 2AS5F 5D0OD 2XSJC 1R5GA 4L1BA 1OWPA 2LF7A 4GTPA 3QODA 4ANUA 3ZQLA 3LCAA 2P0WA 2CUFA 3LMMA 1U9NA 2TRTA 4A6EA 2DMTA 3CCMI 4CCMA 5LLQA 2XGOA 4EM2A 4RVBA 5HLHA 3K9TA 3ONQA 1D5YA 2M7BA 1RRJA 3K10A 2P9IG 1LDKB 3UV0A 1E7VA 3SFIA 2RC4A 2NS8A 4JBAA 1QHHD 4YELA 5EILA 2VGYA 3K1MA 1BW5A 3TKYA 3IKOB 3JXIA 3WHCA 3T5VA 4PK4A 1MZCA 1X4PA 5ANLA 3CVWA 1TNTA 3ERED 5B5EC 1B89A 3UT7A 3PFNA 4YDYA 5GTHC 5CYVA 4I6GA 1TWHJ 4EHMA 2CUJA 2XEEA 1SVMA 5ENSD 4RB0A 4P96A 1MYOA 3K70D 4HBDA 2KJBA 4D10C 4AM9A 4IRIA 2LSUA 1X2MA 2V1NA 4KIBA 4A93J 2E5NA 2KFUA 1P92A 1JKPC 3F21A 5TJJA 2CH0A 3DSHA 4I76A 1WWXA 5DHRA 4DZPA 1PYVA 2ADUA 4UI9C 2V1XA 4D1QA 5ENRD 3PZ1A 1MSFC 3NWSA 2ZCWA 2R59A 4O60A 3IAM2 3UTMA 2KPMA 2I29A 4KT5C 3EDPA 2I2OA 3OXLA 3ZYQA 1UHTA 1K2NA 1IZ1A 2VKEA 4XLHA 1BR4A 4HQEA 5GPCA 4BH9A 2XPWA 2WQHA 1AP7A 4GGGA 1IG7A 4LNUD 1MH4A 2W85A 3OYGA 1W36D 4RG9A 2QSFX 4EQQA 5CVJA 5H20A 4B48A 4HG2A 2DO7A 1YW9A 2ZU6B 1R4MB 4D0PA 1RR7A 2KIMA 1GVJA 4IX7A 3TXNA 3CVYA 3W6KB 4J8SA 4HOSA 3ASNE 3HSEA 4HRMB 2FNPA 3NOGD 4ZYHA 1OCRH 4A0YA 5E8GA 4XLNF 3JRHA 1IQRA 3D9HA 5DEQA 4BBRJ 4HNUA 5L3GA 1JGGA 3CF5F 2DFIA 2WY7Q 2JA2A 2X6YA 5T3RA 3FWEA 4II3A 1MGTA 1OCZH 1H0M