2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Probable regulatory protein embR
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
1FBSA 2QFCA 5FD6A 5HVQC 2XAJA 4S04A 1BIAA 4LD5A 2O0YA 1ON2A 2P6SA 3F22A 1SFXA 2Z33A 1ZG3A 4H7YA 3HOTA 4OIQF 4WX9A 4H0EA 2M30A 3T5XA 3EYYA 4A0XA 3POAA 2EFOA 1QO0D 2EA2A 4H7XA 4RGRA 1T6SA 5DJOA 1IN4A 1UJXA 3KE2A 2JRTA 2DI3A 2FQ3A 1I5ZA 2F5DA 3BJ6A 1SD6A 3TO9A 3PQJA 5F6FA 3O6BB 3C3WA 1F5TA 4RB0A 3HSRA 4IPAA 2BV6A 2HQRA 5HS7A 5BPDA 5K5OA 1OKRA 3DEUA 1MZKA 3PO8A 1K6OA 3GVAA 2DLLA 5LCWC 4EM1A 5TRDA 2XAQA 3D0SA 1IHGA 3HHHA 4U07A 3BZ6A 3VTXA 2IRFG 5ICGA 3K9IA 1YJ5C 2CFXA 4HF0A 2JQIA 3H3ZA 4UUVA 3FHZA 1UHTA 1LEAA 5G04C 1R22A 3LWFA 2KIUA 1HW1A 1FT9A 1DMZA 4J8DA 1QQEA 1K3JA 2X0LA 3UQ3A 2IVMA 4OIPF 1FOKA 3G3ZA 2GAUA 5FGMA 1PP8F 2FEZA 2DW4A 3MEXA 2KCLA 1XSVA 2PL2A 3WGIA 4EJQA 4I9EA 5E8GA 5H6QA 3GW2A 2WQHA 2DAOA 2VXZA 1BI3A 2FF4A 4EGZA 2VQ2A 4UI9C 4JONA 2VN2A 4N2SA 5DEQA 3V7RA 1ZREA 4HORA 3L7WA 4M73A 4EGXA 1P92A 2XPIA 2XT9B 2W25A 2KC7A 2AXLA 4ASNA 3U1DA 4LGWA 2M8EA 1FX7A 1E96B 5FLXK 1HW2A 2YSRA 3PE3A 2KIFA 3ZGQA 1S29A 2ZO4A 2P7VB 4BYYA 3HX1A 4A2UA 1GXCA 1ZYRF 5EEGA 1O3QA 3GZ6A 2C6YA 3WE2A 4JHRA 2ETHA 1Z6RA 1T2KA 1YA0A 4ENJA 3CUQB 2HDCA 2R5SA 1CGPA 2ADUA 4Y17A 3GO5A 2J9QA 1G3YA 3RPUA 3ASHA 3ASGA 4NQWA 3CVQA 1JGSA 4ENNA 5HS8A 4L0ZB 1GHCA 2JPBA 1YQAA 1J4QA 5E20A 1FZPB 5DD4A 2F5FA 4HX7A 3CLOA 3UPVA 5JI6A 3E3VA 2XUBA 4AY5A 2XKPA 3LA3A 3WODF 1BI0A 2G7UA 5C1DA 4QLCU 3LQQA 2ZCWA 4KN7X 4Q47A 4UVBA 3F6VA 3MWMA 4D0PA 3DPLC 4EJVA 4KN4X 5IT9K 1AOYA 4R8HA 2HKXA 3CUOA 3RDIA 4G2VA 2A3SA 2KJCA 1U5TC 4OU0A 3PQKA 1KLXA 3FWVA 1KGSA 5BQTA 4JL0A 1R1UA 2XGSA 1G4DA 5D5WB 1T38A 4EM0B 1D5VA 2PQ8A 2DFIA 2HOEA 1JHHA 3ELSA 3TG5A 1YJMA 3FWEA 2RV8A 4HX4A 4KYWA 4HDVA 5CVRA 1L3LA 3QAHA 2HYFA 4UQYA 3KP7A 1SMYF 5BOXA 3QRFF 4NQ0A 1H9GA 2OQRA 2K4BA 5ICEA 4LFUA 1CF7A 1ZN2A 1B59A 4A0EA 1IN7A 4M74A 2XAGA 4J0UA 1FNNA 4RB2C 1W5TA 5HLHA 2NNYA 2YHCA 5EKQD 2E7WA 4L5JA 1TJCA 2VC0A 4JA7A 2WC2A 3TG4A 4O5VA 1LGPA 1SD4A 4ESJA 4OINF 3T8RA 4G6QA 3CVLA 3LAJA 4U04A 4IRGA 3LAPA 1RZ4A 2YX4A 3ZP5A 2NAZA 4HOUA 4RB3C 3MA5A 4LK1F 2VT2A 3CTAA 3HRSA 5FZQA 1ZBPA 3UV0A 1R1VA 5F1RA 1B9NA 1BJAA 2XGMA 3EDPA 2BEOA 4B94A 4J8FA 2JTVA 2KKOA 5CVJA 5HI7A 3CV0A 2HR3A 3NEUA 3OXGA 4ENKA 2VE8A 3EUHA 3P9KA 2MH2A 2V79A 4YG2F 1Z7UA 3WU0A 4BH9A 4ZYHA 4FT8A 3ECOA 2YX7A 4UNOA 3H3UA 5D4RA 1WRJA 3WTVC 5ILUA 4AWXB 5AONA 3QU6A 2STTA 3EETA 2XCCA 3QPTA 2OD5A 3ASFA 3EQLF 3QOUA 3GX4X 3QPHA 4BT8A 2LSUA 4MEXF 2CG4A 4D9VA 1NHAA 4RG6A 5KJNA 2ACJA 4CGVA 4B09A 4N2QA 5K5RA 1IRFA 1R5HA 2HYZA 3OUNA 1J2XA 4G7ZF 2HEOA 2O03A 4RAZA 4LJZF 2IJLA 3K0LA 3BY6A 4UVAA 5FFXA 4GCNA 1QQIA 1ONVA 2A6HF 2HYGD 2FMYA 3WTZA 4ZYEA 2HO1A 3GW4A 2OAZA 3TDZC 1TW2A 2EJRA 3J7AO 3W6KB 1QZYA 3QOPA 3UN0A 3BDDA 4MNUA 3WE3A 1FYKA 4RGSA 5HLGA 2XRNA 1E17A 5TJJA 4ZZDA 3E6MA 1IXCA 5HOOA 4HA8A 2IA1A 4ENMA 1FHQA 3V7CA 3UNMA 4I2OA 4BTAA 3OXFA 1H9TA 2L6JA 3GEZA 3RIRA 2JZYA 1R5GA 5F64A 1TW3A 2M45A 3CO6C 1I1GA 3U4TA 3RYPA 1WQ2A 3JW4A 3ULQA 2EFWA 4EJWA 4MTDA 1ZU2A 1TTYA 2MLGA 4UVCA 1ZHFA 3DQVC 4P5OA 2QWWA 1OYYA 2PQRA 5DUIA 3JTGA 3J80Z 2ZMEB 4JK1X 4OOIA 4CICA 5FB2A 4AIHA 3AAFA 2PFBA 2VBZA 2Z99A 5E1ZB 1FP2A 3GLXA 4HOBA 1IXSB 1UHWA 3L00A 3I0MA 3ESKA 1WM5A 4EV0A 3KCCA 1ZARA 4HV5A 4LLLA 5D5VB 2L4AA 3DXJF 4U7DA 4PGGA 4CHUA 3GZ5A 1P4WA 2NNNA 2ONDA 1KU2A 1J59A 3O3KA 2EV6A 4AY6A 3J81Z 2GQQA 2JSCA 5CHEE 2GXBA 3QWPA 2STWA 2J5PA 5FZSA 2MC3A 2O6GE 5AYWD 4UHTA 3UUXA 4UQXA 1G3GA 3MAJA 2EV0A 3KP4A 4PCQA 4M9ZA 4MQVA 2V1XA 1IN8A 4A0YA 1QPMA 5KJMA 2FBIA 4L9JA 4DNCA 5E17F 3IEGA 1U8RA 4BXUA 4ESFA 2UY1A 3OV8A 1FP1D 4A12A 3COAC 2Z5UA 4U88A 2P4WA 3I6WA 5L3FA 2VE9A 3IHUA 3TKYA 2OZUA 3I4PA 2FA5A 3HUGA 2ZKZA 1KU7A 2PMUA 4KFCA 3GFMA 3HTSB 1L0OC 1D8KA 5LHHA 2XGXA 4RAYA 4A6DA 4YFNF 2G7HA 2FI7A 3LA7A 3Q9VA 5ICFA 4N3CA 5G05C 1K3QA 2GA2A 4F3VA 4AVPA 4WXHA 3JAMZ 3BWGA 4EJTA 1P6RA 3KEQA 1NA3A 3TDUC 2IP2A 3E97A 5LHGA 3MKRA 1ZLKA 2MHKA 3RKWA 3F6OA 3HSFA 2H6BA 3ELKA 1BC8C 4I2WA 2LSVA 4HX8A 1NZNA 2NRAC 1ZG5A 4BT9A 5LRRA 2G9WA 3O2PE 3ULQB 3RJPA 1SFEA 1EH8A 4I98B 1X3UA 3V4GA 2BGCA 2Y75A 1ZH5A 2PJPA 2PMHA 2L02A 1I6XA 2BBYA 2PLYA 5H6RA 3AS4A 5E1XA 4U7BA 4P9UA 3R4KA 3NF1A 1XMKA 3V8KA 2O61A 5HQ8A 3HTUA 4A5NA 3ASDA 2UZKA 4ESBA 2VONA 1W7PD 2EB7A 3MV2B 4A5MA 1ON1A 4GXOA 5FT9A 1P2FA 3ZMUA 3LCAA 1YO5C 4GA0A 3SHFA 5CCLA 4KMFA 4GO1A 3R9AB 2XVCA 1MD0A 2AVPA 2VSYA 4QWQA 2R7FA 1JXSA 2VOOA 2QBYB 3F8MA 3FP3A 4CGZA 3GYHX 1DPRA 5BPIA 4RGXA 1G3WA 3ABTA 3WU1B 2QZ8A 5LGNA 3F8BA 1A04A 4Q4ZF 3LY8A 4YNDA 1SD7A 1MZBA 1KYZA 1Z6TA 4L9TA 1LNWA 1S7OA 3E5QA 4HLYA 2FO7A 2PI0A 4KYOB 1FPQA 4LLGF 2MA3A 1J0RA 4EJUA 3CVPA 2P6TA 1O3SA 1K78B 3N71A 2NC9A 2A07F 1CF7B 1J4LA 2KIMA 3GWZA 1H0MA 1FHRA 1BN5A 3CK7A 5J8CA 5CJ9A 1USSA 3REOA 1OYIA 2KB4A 2Y48A 3WG9A 4IHTA 2V9VA 1XMAA 2C0LA 1U2WA 2HR2A 1LJ9A 1FBUA 1ODDA 3OOPA 1G3TA 2ZNZA 4XLNF 3UOTA 5FJYA 3MCZA 3LY7A 2BRFA 4O6FA 3T0YA 2VC1A 1IZ1A 1Z05A 2EFNA 1FYLA 4KIFA 1O3RA 2D1VA 3MQ0A 2FBNA 3T8TA 4WNFA 1WV3A 3BJOA 3ZHEA 1W7PA 3TGOA 2P5LC 4BNCA 1WI9A 1J4KA 2OA4A 2P8TA 5L3BA 1WWXA 5CVUA 2FE3A 1IW7F 1K2MA 1ZRCA 3TOBA 4IHSA 4WCGA 3UMZA 3E6DA 3F72A 2ISYA 3KEOA 3L2CA 4BQAA 1MDMA 3MDBA 1REPC 5A2QK 3WXXA 5CCMA 1OYWA 4EQFA 3IC7A 5H20A 3VPYA 2NYXA 4A1SA 1TLHB 1HBXG 4TV7A 5KJKA 2VGXA 4L18B 2XCBA 4LEUA 4N9IA 2FXAA 2LKPA 4GYYA 1FBQA 4I01A 1HXIA 3KP5A 4E70A 2L4MA 3VA4A 4N9HA 4B8XA 1QBJA 4UI9K 5EEHA 3AS8A 2Y4UA 3ABUA 4AD9A 4JQFA 4L9NA 4EJOA 3JSPA 3LKUA 4IRHA 4QCJA 2ZJ2A 1XNFA 1LEBA 4LG0A 4OIOF 1BI1A 3BP8A 3ZPLA 5FO5A 4L5IA 2PEXA 4ZH4F 3ISPA 5DUKA 3KP3A 3S2WA 2VGXB 3E5UA 1G3SA 2FOKA 2OOEA 3SF4A 3I58A 3HIFA 1YFHA 2MH9A 4GYGA 2UXXA 3HRUA 3Q15A 2EV5A 1K3NA 1Z91A 4IVNA 5ICCA 5ILVA 4KNYA 1ZGAA 2OZ6A 5LGUA 4U0YA 5DD8A 3ZN1A 2L3DA 1A17A 2PZIA 3M8FA 1P4AA 4U0VA 1P5QA 1YG2A 3RYRA 1W7PB 4WXCA 4M72A 5CVVA 3R0JA 2E1CA 2A6EF 3KAEA 4P9FA 3RJVA 3NQOA 5A8IA 5L3DA 5A2QZ 4LB6B 1K7AA 6PAXA 4XI9A 5D4SA 1GVJA 2ZXJA 3FMSA 1FYMA 3WTWC 1TQIA 2DO7A 5AIPA 2A69F 1WLNA 1BBYA 3R61A 1USTA 5CVIA 3I53A 4YVOA 2ZFWA 2XIGA 2YU3A 1QNTA 4RGUA 4EQQA 1Z1DA 4GZ5A 2DBAA 4W9RA 3E6BA 1F9NA 1UHMA 4ABNA 3TQNA 1J75A 3ZMDA 1P4XA 4PZJA 2Y0MA 3BOQA 2M5WA 4KIGA 5LLQA 1U5TB 2EFPA 1FWZA 4GYOA 3I54A 2AS5F 4UQZA 1QU5A 1LQ1A 2XHKA 4XSZF 1LDDA 1KT1A 3I6UA 2XEVA 3RTRA 4WNEA 5HDNA 3I0TA 1S8NA 4N0BA 1J7KA 1IRGA 2IT0A 3LYAA 2WWYA 4G26A 1KQ9A 5LGTA 4G1TA 4I9CA 3WTSC 3DKWA 2C0MA 2F2EA 1QZ2A 1LDKB 2A61A 4I0BA 2P7CB 1B89A 3KFWX 3K2ZA 1YTYA 3F23A 3QWWA 1RUNA 4GA2A 4GZ6A 3M8EA 3BPXA 3RKVA 4KA4A 2QQBA 2H94A 5FZRA 4GPKA 2WTEA 1O7FA 1V4RA 3IWFA 1XDUA 5LHIA 1FSHA 4CGWA 3IL2A 3MEKA 1BOAA 4EM2A 2RNJA 4AIFA 3FXQA 3HYMB 3CKBA 3H92A 1OUVA 1KU9A 2FSWA 3WTXC 3FMQA 3GF2A 4HW0A 4ZYDA 1KU3A 3DFGA 2H6CA 4Q5SF 4XBFA 2CO5A 2QUFA 3ECHA 2PIEA 1HKQA 3VODA 2R3SA 2YR2A 1XGMA 1DDNA 5D6EA 3DPTA 1XDSA 1G6GA 3G73A 4N5CA 3VB2A 2EA4A 1U3EM 1LDJA 4HBLA 3V8JA 3R60A 5JJTA 4L9VA 3TO6A 5BNWA 5DCMA 3Q49B 5BT1A 2JPCA 4KDPA 2RVCA 2MLKA 3SZTA 5FTPA 2GZWA 5DIZA 3ELVA 3JAMK 5EX0A 3ZQ7A 4UI9J 4G7OF 3ZMTA 4L0YB 1BC7C 4GZ3A 3NRVA 4FX0A 1YW8A 5D0OD 3KP2A 4IRIA 1LVAA 4G94A 3DF8A 3ZN3A 5D6FA 4EGYA 1E2XA 2DQRA 1YLFA 3ZMSA 1ZGJA 5LEKA 1I1SA 1WAO1 3KS2A 5E8IA 1ZG1A 4CXFA 4EVIA 5M72A 4Q48A 2ISZA 2L54A 1W3BA 1TBXA 2IW5A 3I0NA 5KJLA 2VBXA 1K2NA 4FHTA 4F7ZA 2W85A 4PGHA 2F5EA 1T0FA 5D5UB 4I7HA 1Y8MA 1ZRFA 1R21A 3AS5A 3Q4AB 4U0UA 3FM3A 2E7XA 2B0LA 2IPQX 4RB1A 1STZA 2K7LA 2XAFA 2Y4TA 2HKOA 3MZYA 3S7BA 1SMTA 1HQCA 5JHUA 3KT9A 4O3MA 2UY1B 1OR7A 2FRHA 5CLSA 1XGOA 5IT3A 2Q7FA 3B02A 4N39A 2LNBA 4XRFA 4KICA 4CZZA 1S6LA 4CYDA 1XSDA 3WTUC 3FFLA 2O8XA 1RUOA 1AWCA 1O57A 3LY9A 1D3YA 3IWZA 2UWMA 2TDXA 2ZMEA 2P58C 1FY7A 2CGPA 1YS6A 1HKSA 1D8JA 5JJ7A 4Z2YA 5L3CA 1LB2A 4G2SA 3LSTA 4RG9A 5HS9A 2ELHA 2HFHA 3CDHA 3FM5A 2AFFA 5DCFA 5DDGA 1QGPA 4M6XA 3C18A 5DCMB 2PN6A 2EWNA 1EH6A 3P7NA 1DP7P 4I02A 4U0WA 4OMYA 2VYIA 2DQLA 3QP5A 2KJBA 1VTNC 2PG4A 4EMSA 2YPRA 5BW8C 1OPCA 3GUDA 4NRHB 4M9XA 2VT3A 2CWEA 1T98A 4CDGA 4YVQC 4ETSA 1FSEA 2H27A 3M7GA 3LQRA 4MTEA 3D5LA 2GA1A 3RI4A 2QENA 5A7DB 2JQLA 2DT5A 2IA2A 2HZTA 2W24A 1WSUA 2PBIA 2R7DA 3C1DA 4OIRF 1GXQA 2M87A 1HSTA 4Y13A 1EV7A 2D45A 3L09A 1U6GA 1IN5A 4APOA 3FX3A 4WWCA 2I6HA 1YIOA 4UV9A 4KIBA 3LA2A 1Z9CA 1HW5A 1BIBA 3PDNA 1MGTA 3CUQA 2HTJA 3ERED 1YW7A 4DQ2A 4HQEA 3K9TA 2RDPA 3R6SA 1T39A 3VOEA 1JE8A 2KCVA 4MEYF 2JKDA 2CQKA 2MBFA 4J8EA 3JTHA 4A0ZA 4WK8F 3HHGA 3J81K 5EX3A 4G6DA 4YFKF 5ARFA 2DPDA 2WV0A 3M9AA 5BS6A 2H09A 5HDKA 4YIIA 3QDNA 1XSXA 4K2EA 2QBYA 1MKMA 1IF1A 1U5TA 3SZ7A 3U3WA 2LSOA 1HH8A 3KP6A 3HOSA 2A0TA 2KFUA 2VOPA 2QQ9A 3Q9SA 3B73A 1ELRA 1XGNA 2KATA 3HYIA 1O7LA 3GZ2A 1HSJA 4HYEA 1FLIA 2DPUA 1R00A 3CK8A 2K02A 1UB9A 3GFLA 3Q5FA 4XLPF 3FZVA 2MD5A 5DBKA 4BHBA 1TNTA 3CK9A 3WGGA 3S7JA 1B4AA 3SXYA 4HAMA 2K4JA 4BWRA 1TNSA 1UFMA 3HSEA 2FBKA 2QYOA 1XCVA 4HV6A 4U0ZA 2DU9A 1J4OA 2WPVA 2F5CA 2OBPA 2BUGA 3LPZA 4XI0A 1DPUA 2XV4S 1J5YA 3BJAA 2V5FA 4AM9A 2PQNA 3E4BA 1J9IA 4BTBA 3IRRA 5ARGA 3CUQC 4YIFA 1B1BA 1V3FA 1R7JA 3GFIA 1IYGA 4GA1A 1WKMA 4I1AA 3VA1A 1GXPA 5LBQA 2ZNYA 4R1HA 3QKYA 3TOAA 1ZLJA 5ED4A 4IN3B 5ILSA 1C0WA 4Y15A 4JA9A 3TGNA 1MJ9A 2ZBKA 4MQ9F 1HZ4A 1R58A 3ZPJA 4HDUA 4BHPA 3UNNA 4KT5C 4G25A 2DBBA 4HLXA 1R1TA 2O3FA 2L01A 3EYIA 2KKLA 5AIQA 2QLZA 4MGRA 4ON0A 4HF1A 5BMZA 3R0AA 3GXOA 2K86A 3E6CC 1KQ8A 3FXRA 3KETA 3FMRA 4U0SA 2FU4A 2J5OA 3V7SA 2IA0A 5D5XB 3RKXA 3F8NA 4XSXF 1HXDA 3DP7A 5FFZA 2X4HA 3TAXA 2Q2EA 1Q1HA 1DUXC 4HOTA 3RU0A 4M71A 1MDMB 5D8LB 1KA8A 3GFJA 1SFUA 2HTSA 1UCRA 4N3AA 3QU3A 1KQ0A 2VODA 3JYSA 4HQMA 1XN7A 3L9FA 1YW9A 3BROA 3FF5A 4IF4A 2P5VA 4BAYA 3EDTB 4KMUX 1XGSA 3MFKA 4HOQA 2DK8A 2XAHA 3N97A 2DK5A 4I17A 4HOSA 5D0QD 5LEJA 2HGCA 1MJAA 3F21A 2BYVE 2Z9OA 3DV8A 4XIFA 3FXUA 2FBHA 3N4MA 1K79A 1S7AA 3RIBA 3ZHEB 2FNAA 5CYVA 1IXRC 4I09A 2CSOA 1FCHA 5HLIA 2A68F 2RGVA 5DYMA 1EH7A 3RPQA 4AIKA 2HWVA 3CJNA 4YFXF 2V1UA 3P9CA 1PC2A 2CYYA 2M1BA 4GCOA 3KLNA 1ZAOA 2E1NA 5G05J 5KK1A 1IUYA 5E1WA 4HZFA 4CO8A 3ZFWA 1RIOH 3M1EA 4GCVA 2GWRA 2VGYA 3HUFA 4ME2A 2LF7A 2UWJG 4WNDA 2UXNA 3VTYA 5JR3A 1KT0A 1F4KA 2QVOA 3SZPA 3BEEA 1B9MA 3I59A 2Z3YA 3VEPA 3ROUA 1BI2A 4G24A 1F1ZA 4MHGA 4P55A 2QM3A 2K27A 3KZZA 1QZZA 1LGQA 2RC4A 3V8LA 2XASA 4GGGA 1W4MA 3BPVA 3U9GA 5K1YA 3Q5MA 3WTYC 4N3BA 3KZYA 3PE4A 3URZA 2CW0F 4P96A 2IFUA 2GXGA 1FC3A 5IT9Z 2W84A 1J4PA 1KYWA 5D8KB 3F8FA 5LCWJ 3T1BA 3F8CA 2VBWA 2Q8KA 3S7FA 3K1PA 3QWVA 3JSOA 4NB5A 4G23A 1R36A 3GYZA 4WNGA 3TO7A 2RQPA 4IXAA 1K78A 2V1DA 1PP7U 3HRMA 3K69A 1YYVA 2GIVA 2EK5A 1TQMA 1O3TA 5FLXZ 4I2ZA 3ML6A 2XKOA 2HQNA 3WTTC 2XROA 1HKTA 4Y6WA 4WUYA 3K1NA 4M6YA 1I27A 1ZRDA 1XCBA 5L3GA 1ULYA 1S3JA 5FD5A 1TQPA 3HUEA 3E5XA 3WGHA 1PDNC 4GYWA 2G1LA 2COMA 3S7DA 1MJBA 4G9YA 5J6XA 1OMIA 1G6NA 4WXDA 4NHJA 4LB5A 2JT1A 4H87A 4KXKB 5KVRA 3ZN0A 3OXLA 2FNPA 3VFZA 1NA0A 1IAWA 2KB3A 2D2WA 2CSWA 3MV3B 2ESHA 3SQNA 1RNLA 3RKYA 4LMYA 1R23A 2V6CA 2IF4A 2RKHA 3QP6A 4UV8A 4LK0F 2LNIA 3Q47B 2QQAA 3U2RA 4KBQA 3MZHA 3HRTA 1JHFA 2KCKA 2JPEA 4GYIA 1BM9A 2C2LA 4FX4A 3GQSA 2LF8A 2DTRA 4RS8A 5A6CA 2JLBA 4A6EA 1W5SA 1SAXA 4IJAA 4CDRA 2NS0A 1ELWA 1YS7A 3ZMZA 4OMZA 5LRSA 2D1HA 3CEQA 2Q0OA 1XD7A 4BHCA 1Y0UA 2VSNA 2EH0A 2LC1A 3FM8A 3I71A 4G7HF 2GW1A 2OU2A 4PDKA 4JBAA 4KUMA 2LDUA 4R79A 3LFKA 4O6JA 5JVTA 3KD7A 2A5YB 2RN7A 3F3XA 2HS5A 2P5KA 1PUEE 3W6JB 3SFZA 3RO2A 2ESNA 5HDGA 1RI7A 1XB4A 4LG0B 4M9SA 5ERIA 5E50A 2KRFA 5E18F 1IN6A 5DV5A 3IKVA 5K5QA 3CVNA 3K1MA 4G8XA 1U78A 4I0AA 3C7JA 4UXNA 2OQGA 3I5UA 2E2EA 4WF2A 2YQ8A 4LLNA 3PFIA 2BE5F 2EFQA 4S05A 3ZMVA 4ZYGA 3CO7C 3I64A 3RO3A 1SD5A 3IKTA 5JJ6A 3GZ1A 3KLOA 5G04J 3IRQA 3CKCA 3I59B 2JQJA 4ZZLA 3P9IA 4AIJA 4Y6CA 2XGOA 2W57A 3J80K 3O48A 5JFRA 2FMLA 5J8FA 4HF2A 5L3EA 1B6AA 2W3OA 2VBYA
chains in the Genus database with same CATH superfamily
4HNTA 3HZJA 1FBSA 2JVGA 2E1MC 3I4GA 3L54A 3E34A 2QFCA 3Q9NC 4UB8C 3G2TA 5FD6A 3P1UA 3MKZA 1G8XA 5HVQC 4XLAA 4JIVD 2XAJA 4S04A 1BIAA 3A77A 1IXVA 2I5UA 1S5LC 3DKYA 3I56I 1D8DA 4LD5A 2O0YA 5B1BH 4C0EA 1ON2A 1SFOJ 2P6SA 3F22A 1SFXA 2Z33A 3SJMA 4URKA 4XN0A 1ZG3A 3A02A 1IC8A 1N0QA 4H7YA 3HOTA 4OIQF 3FUFA 4WX9A 2CW8A 2I8DA 3BLYA 1WDYA 4H0EA 2M30A 3T5XA 1KZOA 2CG2A 2JABA 4F52A 3EU5A 2X38A 3VLEA 3X2QE 3BUAA 4ITVA 2M7BA 4BDYA 2EIKE 2Z2SB 3EYYA 4A0XA 1ZB1A 1JWGA 1OCOH 2EFOA 1HO8A 1QO0D 2EA2A 2CHZA 4H7XA 4BXXJ 3POAA 1WGXA 4RGRA 4J7WA 4E4HA 1T6SA 3HKZN 2LBFB 1IN4A 5DJOA 2DMPA 2EBIA 3E1SA 3KE2A 1EA3A 2R7SA 4L9PA 2K9NA 1UJXA 2JRTA 3JRGA 5FKNA 3QARA 3TWWA 1MJSA 4HSTA 1O1SA 2DI3A 2FQ3A 2N8GA 1I5ZA 2F5DA 3BJ6A 1SD6A 3TO9A 4XX5A 2V1NA 3PQJA 3DBSA 5AIJA 5F6FA 3O6BB 3C3WA 1Y3HA 1F5TA 5ENTD 4RB0A 4EHMA 3HSRA 3V8NA 4F55A 2LYCA 4IPAA 2BV6A 2HQRA 5HS7A 5BPDA 2IO2C 5K5OA 2QA4I 1OKRA 3DEUA 2M3AA 1MZKA 3PO8A 1K6OA 3GVAA 2DLLA 2HVSA 3W2AA 5LCWC 5JEKA 2VQLA 4EM1A 2GRNB 4DUIA 4F3QA 2XAQA 5TRDA 3D0SA 1X1CA 4NNJA 4BQOA 1A5JA 3PRZA 3T9KA 3BT9A 3SBTB 3UM0A 3V30A 1IHGA 1ETQA 3HHHA 2GRLA 4U07A 3BZ6A 3VTXA 2BTDA 2IRFG 1BU9A 4XIDA 1OWLA 5ICGA 3FUMA 3K9IA 1YJ5C 2CFXA 5DHQA 4HF0A 2JQIA 3H3ZA 4UUVA 4XKVA 5B3SH 3VWBA 2HOAA 2XPZA 3FHZA 1UHTA 4AVZA 3KEAA 1LEAA 2AQEA 4I1MA 1A31A 3OS0A 1R22A 5FRMA 3LWFA 3ABLE 2KIUA 3HEFA 3SZGA 4AU7A 4ILIA 1HW1A 2R2LA 2WB2A 1TN6A 1X5BA 2LC2A 1FT9A 4BSXA 1DMZA 3IH3A 1Z67A 1WG0A 3FULA 1QQEA 4J8DA 1K3JA 2ELJA 2CU7A 2X0LA 2ME6A 3UQ3A 2DJIA 3OOUA 1MBFA 1YX3A 4DBRA 2IVMA 4OIPF 3UI2A 1IKND 1FOKA 3G3ZA 2GAUA 5FGMA 1PP8F 2V4HC 2FEZA 3KYDB 3L17A 4GB9A 2DW4A 3MEXA 3NB2A 3K70C 3FTVA 2KCLA 1XSVA 3OYAA 2PL2A 2JUGA 3WGIA 2DZNA 2VKVA 1OQYA 3RK6A 5IP7J 4EJQA 5DHRA 1BI7B 1T08B 4I9EA 5C44J 5E8GA 3MYVA 1P7JA 5H6QA 3FTXA 3W6VA 3GW2A 1OR7C 1ETWA 2DAOA 2WQHA 2VXZA 1BI3A 2FF4A 1OCRH 3PNVA 2R0QC 4EGZA 2VN2A 2GLOA 2VQ2A 3CMAI 3MVPA 3CC2I 2WM9A 4FJZA 5DEQA 3V7RA 4DI4A 4F7AA 1ZREA 4HVBA 4HORA 2CW7A 3L7WA 4M73A 4EGXA 1P92A 1UZCA 2XPIA 1IHBA 2IGOA 3TP0A 3ZRHA 2XT9B 2DDBA 2W25A 3DPUA 1BW6A 3H0GJ 2KC7A 2AXLA 3JQ0A 2V8SE 1P7IA 3BR1A 3U1DA 4ASNA 4IOAF 4LGWA 3PUFA 3Q73A 4PJ0C 1BL0A 2M8EA 1FX7A 3TL4X 1E96B 2K5CA 5FLXK 1HW2A 5FWQA 4BERA 5CEDB 4JEHA 1NG7A 2YSRA 3PE3A 5FJ8J 2KIFA 3ZGQA 3JCKC 1S29A 2ZO4A 2L9RA 1I50J 1JCSA 2P7VB 3K7AJ 4BYYA 3HX1A 4A2UA 2WXPA 2KP6A 2QV7A 1GXCA 1ZYRF 5EEGA 3CCUI 3GZ6A 2L7KA 1O3QA 1TNUA 2H6HA 3FUNA 3GTPJ 5F0CA 3T5VA 2C6YA 3WE2A 4JHRA 2OCCH 2ETHA 1Z6RA 1T2KA 4OAUC 5IP6A 5J90A 1YA0A 5AQ7A 5CMWA 5GPAA 4ENJA 3CUQB 2HDCA 1E8WA 2R5SA 1CGPA 2ADUA 4Y17A 2H1LA 3GO5A 3PS6A 5EGOB 5DHTA 2J9QA 1G3YA 3VYSB 3CIAA 2XQ0A 3GBGA 4JX4A 3RPUA 2KQRA 5DM7F 3ASHA 5IYCJ 2IS4A 2IGMA 4BU2A 2ZJPF 2Y30A 3B13A 1K4SA 1O5MA 1XS9A 2P9SG 3ASGA 3V8RA 4YDWA 2ZISA 4I1OB 1H6KA 2OEVA 2JA2A 4NQWA 3CVQA 1G59A 2WMOA 1JGSA 4ENNA 5HS8A 1HG2A 2OVFA 4L0ZB 2I1KA 1GHCA 1SVLA 2JPBA 1YQAA 3FHNA 1J4QA 2RQQA 5E20A 2EINH 4CCLA 2X48A 1TEZA 3QYBA 1FZPB 5DD4A 1IDYA 2F5FA 4HX7A 3CLOA 3SEQA 2R7UA 4DX2A 1D0YA 4RLFA 4BBSJ 1GT0C 3UPVA 5JI6A 1QYMA 4PSWA 5EJIA 3E3VA 2XUBA 4AY5A 3MKLA 2XKPA 2M0MA 2R5ZA 1YJWI 1TZLA 3LA3A 3HGYA 4D5FA 3WODF 4C30A 1LF8A 1BI0A 2G7UA 2LR8A 5C1DA 3ZQCA 4FE4A 4FISA 1WCMJ 4QLCU 5T8IA 3LQQA 3QQAA 3S93A 3CCEI 2ZCWA 4KN7X 4Q47A 4UVBA 3F6VA 1JI8A 3MWMA 4UUSB 4MBGA 4D0PA 3DPLC 4EJVA 4XRMA 1IDZA 4KN4X 5EN5D 3C72A 5IT9K 1AOYA 4AYBN 3CQCB 4R8HA 1JT6A 2HKXA 3SDBA 2DVWA 3GTLJ 2EZIA 3CUOA 3RDIA 1BW5A 2A3SA 4G2VA 3TWUA 2DMUA 2KJCA 3CJQB 3H35A 1U5TC 4OU0A 3PQKA 1HF0A 3UKUG 1KLXA 3FWVA 3UTMA 1KGSA 5BQTA 2A6TA 2VQGA 2X6IA 2WQ6A 2NSZA 4IL6C 1X81A 4JL0A 3MGBA 2IXSA 3PUBA 2CUEA 5B1AE 1R1UA 1JKPC 4ATZD 3KSLA 5AAOA 2VTBB 1QWTA 2XGSA 1G4DA 3FTYA 1S72I 5D5WB 1T38A 2V4JC 3C2GA 1K4TA 1Y8QB 3ZYLA 2XAUA 1N52A 1SQMA 4EM0B 1D5VA 1BJZA 3CHPA 2PQ8A 2X1EA 2DFIA 2HOEA 1JHHA 3ELSA 2LG4A 4KISA 3TG5A 3S17J 3IBEA 1YJMA 3FWEA 1DQUA 3CC4I 2RV8A 4UB6C 4HX4A 3K2AA 1E8ZA 4KYWA 3V79K 4HDVA 5CVRA 1L3LA 4KMOA 4I99C 4GAAA 3QAHA 2NOGA 2FX0A 4A3GJ 3MX3A 2HYFA 4UQYA 3KP7A 4BKXA 3ZIMA 4C2MJ 3S1MJ 1SMYF 3G2BA 4HLLA 5BOXA 3QRFF 3Q7FA 2M7AA 1YJ9I 4NQ0A 3G4SI 3E0JB 3L13A 4PUSA 2R7VA 1H9GA 2IEKA 2OQRA 2QZAA 2K4BA 5ICEA 3OYIA 1BLXB 4YDEA 3M4OJ 4LFUA 3CHSA 3FU5A 3ONKA 4DI3A 2DYSH 3L2VA 5ITZF 3ZKJA 3MD2A 1CF7A 4U63A 1VNDA 1ZN2A 1B59A 2R03A 4A0EA 2RKKA 1IN7A 4M74A 2XAGA 4J0UA 1AWCB 1FNNA 3I5PA 3OAWA 4RB2C 4CCKA 1W5TA 2HQ5A 1W1WE 4GRIA 5EGOA 4Q96A 5HLHA 1S7EA 5EG0A 2NNYA 2DMQA 2YHCA 5EKQD 3C3RA 2E7WA 1A36A 4L5JA 1Y0NA 2M0CA 1TJCA 3I4NJ 3HGGA 2VC0A 4JA7A 2WB1A 2VSXE 4AVXA 3HOXJ 3K4MA 2IS1A 3HOYJ 1SVXA 1WVRA 3OS2A 1LPQA 3RRUA 3KZIC 2WC2A 4LNUD 3TG4A 4O5VA 1PYVA 2Y9YA 1LGPA 1SD4A 3AG4E 4ESJA 3HG9A 3V8QA 2R7RA 4J8YA 4OINF 2BKGA 3T8RA 4G6QA 3DU6A 3PNYA 3CVLA 4D7NA 5C4JJ 3KIOA 1IV8A 3EPZA 2LP0A 3LAJA 4U04A 3FDYA 3BZCA 4IRGA 1RZ4A 2YX4A 3LAPA 4XZ4A 3ZP5A 2NAZA 1JKQC 1Q2ZA 3BU8A 4RB3C 2XPVA 3DTIA 4HOUA 3UM2A 5C4VA 2XRYA 1QA6A 4LK1F 3MA5A 5AARA 1X3WB 2VT2A 1E7VA 3CTAA 1VFCA 3HRSA 1EDUA 3CCYA 3IV5A 2VJ5A 4A3JJ 2WXHA 3HXFA 5FZQA 1ZBPA 3UV0A 4E7ZA 1R1VA 4Y4RA 3TWXA 5F1RA 5BXUA 4N4OB 1QBQA 1B9NA 1BJAA 5F27A 2GRRB 2RD0A 2XGMA 5ENOD 3EDPA 3ZCOA 2BEOA 4B94A 3CVXA 3OYBA 2OJED 4J8FA 1R49A 3PM1A 2JTVA 2K85A 2KKOA 1AA7A 4A3DJ 1EF1C 4RSYA 5CVJA 2BW3A 5HI7A 3I9V2 3CV0A 4FE7A 2HR3A 4A3EJ 2WAEA 2W00A 3NEUA 3OXGA 1E0EA 1NI1A 4ENKA 5DHSA 2VE8A 3BR5A 3EUHA 3P9KA 3CCMI 1HLVA 3GTQJ 5CECB 2MH2A 4RDUA 2V79A 4YG2F 5CMYA 4DK5A 4CCNA 1Z7UA 3WU0A 4BH9A 3CHMA 4ZYHA 4L23A 3HM5A 3JQ1A 4FT8A 3ECOA 2YX7A 2ICWG 4UNOA 2KPMA 3H3UA 4ZTFA 2H6FA 5JMND 4XLFA 5D4RA 1WRJA 1VF9A 4MFDA 3WTVC 3RZDJ 1HF8A 5ILUA 4AWXB 1HFAA 3RQ4A 5IOYA 2KZTA 1XMXA 5AONA 3QU6A 2STTA 3EETA 2XCCA 3PO3J 1D0ZA 3EHNA 2LK2A 3LVQE 4R7LA 4CRWA 3QPTA 4FLHA 3LNQA 1BA5A 2OD5A 4I6ZA 3ASFA 3EQLF 3VZCA 3FEYA 1Y56A 4RM2A 1U0TA 1Z0XA 4UWGA 2KM4A 1MSFC 4PJNA 3GX4X 1U2VG 3QOUA 2HE0A 5F08A 4J19A 2JVHA 3QPHA 4BT8A 3KYLA 4MEXF 2E34A 2LSUA 4HI9A 4W1UA 2CG4A 2CJJA 4F91B 3C2BA 1YIJI 2E60A 2IQCA 4D9VA 2F8YA 1NHAA 2F4OB 4RG6A 5IYBJ 3PSIA 4XICA 5KJNA 2ACJA 2MYOA 4CGVA 1QHHD 4B09A 2CFZA 4X8QA 1EPUA 2JPEA 3HDDA 1T56A 4N2QA 5G55A 4ZDOA 5EDNA 1MH4A 4HSRA 4HRMB 5K5RA 1IRFA 1R5HA 2HYZA 1VQ7I 3OUNA 1UG0A 1J2XA 3ASOE 4G7ZF 2BW3B 4E7SA 3WHCA 1IQUA 2HEOA 1B8IA 2O03A 3B7TA 4RAZA 4GTSA 1RW2A 4LJZF 1ZTRA 2IJLA 3SD5A 2OV8A 3K0LA 2R93J 2MGQA 3BY6A 3Q3SA 4UVAA 5CQGA 3ASNE 3OIOA 5FFXA 4GCNA 1GUUA 1QQIA 2LXLA 1ONVA 2A6HF 2HYGD 2X51A 4E6HA 3AFOA 4LERA 2FMYA 3DEWA 3WTZA 5F04A 3HKZA 4ZYEA 1D5YA 4IHVA 2JA8J 2OAZA 3GW4A 4K03A 3TDZC 1TW2A 3H5NA 3BR6A 2EJRA 3J7AO 3W6KB 1LD7A 1QZYA 1TJFA 3QOPA 4HI8A 2GRQB 3V2OA 3UN0A 3A01B 3BDDA 4MNUA 3WE3A 1UOHA 5KAIC 1X19A 5CBOA 1FYKA 4RGSA 5HLGA 4BESA 4FU3A 1DP3A 2XRNA 2R5YA 4C2TA 1E17A 3T8MA 3DPDA 3KYCB 5TJJA 3V42A 4ZZDA 3E6MA 3G2VA 5H2FC 1IXCA 4M3GA 4HA8A 2IA1A 5HOOA 4ENMA 2AWIA 2ZSHB 1GV5A 4XOTA 4L1BA 4XEIG 1FHQA 2BXZA 3V7CA 3UNMA 4I2OA 4BTAA 4JB8P 3OXFA 5K7HA 1H9TA 2L6JA 3EU9A 3SBSA 3CCRI 3GEZA 3RIRA 1GVDA 2JZYA 1R5GA 3IH2A 3UKRG 4IZZA 1IRXA 3J7ZI 5F64A 1BR2A 2NVTJ 1GV2A 1TW3A 2M45A 3SQVA 3CO6C 2HOSA 3FUHA 1BOBA 1VQNI 3ZQIA 3RSNA 1I1GA 2L7MP 3U4TA 3RYPA 3L16A 4M3DA 5ENRD 1WQ2A 3JW4A 2E71A 3ULQA 1QVTA 2EFWA 4EJWA 1JWFA 3VYUB 2CFUA 4MTDA 1ZU2A 2X6FA 1TTYA 2MLGA 4UVCA 2QVLA 3QC1A 4MO7A 2M2EA 1ZHFA 3DQVC 4P5OA 2QWWA 4IX7A 3S40A 4LRZA 4OYSA 1OYYA 2PQRA 3APFA 1ETVA 5DUIA 1FT1A 2H8WA 3W3CA 3JTGA 2MG4A 3J80Z 3J5QB 5ENSD 2ZMEB 4XK4A 2VKEA 1EKEA 1MMDA 5T3RA 2GRMA 3K4KA 4JK1X 4OOIA 3M3YJ 2R17C 3QNKA 4CICA 5FB2A 2XB5A 4AIHA 3AAFA 2PFBA 2VBZA 3EHRA 1U8BA 1HU3A 4IQJA 1N4QA 5LFAA 4KJZA 2Z99A 2LVSA 1R6RA 5E1ZB 1CQTA 5EILA 1FP2A 3GLXA 4HOBA 1IXSB 5A23A 1UHWA 3L00A 1VQMI 4IEJA 2ETBA 3I0MA 3ESKA 3MCXA 1P9QC 3CDIA 4XR6A 1WM5A 4YEJA 4KVOA 2WAQA 4D9JA 3PVLA 4EV0A 1A35A 2EIJE 1X4OA 3BR0A 1PUFA 3KCCA 4BQNA 1V5EA 1ZARA 4HV5A 4EBAG 4LLLA 5D5VB 2NXPA 3OYEA 4AV7A 1IRZA 2L4AA 2Q5FA 1VI0A 3DXJF 2CQXA 1N95A 2P9LG 4U7DA 4PS3A 4PGGA 4CHUA 4I6EA 3AG4H 3GZ5A 1U7VA 1P4WA 3WU2C 2NNNA 4DYCA 3OR1C 5FIOA 2ONDA 1KU2A 4AP2A 2AO9A 4B93B 1J59A 3O3KA 2EV6A 4AY6A 3J81Z 3EUVA 1BD8A 4B48A 5GTIC 4V24A 2GQQA 5DHPA 4ABZA 2JSCA 3IH4A 2I2AA 4UWFA 5CHEE 5K7FA 3H5AA 2Y31A 1N25A 2VL8A 2OCEA 2GXBA 3QWPA 2STWA 4II3A 3D5RC 2J5PA 5FZSA 3IV0A 1LFBA 2MC3A 2O6GE 2AXUA 3EIJA 5AYWD 4UHTA 3UUXA 1OFCX 3CC7I 4GTVA 4UQXA 3MAJA 2EV0A 3KP4A 3TBIA 4A3VA 1G3GA 4BJ5C 4PCQA 4WWNA 2DYRH 4M9ZA 2K9MA 4MQVA 4QSHA 1LUJB 2V1XA 1U3CA 1IN8A 4A0YA 2QC9A 1QPMA 3E32A 5KJMA 2FBIA 2F48A 3HC7A 4XN3A 4L9JA 4DNCA 5H7PA 5E17F 1Q1VA 3IEGA 5E75A 1U8RA 1MBGA 2V4LA 4BXUA 4ESFA 5J4YA 3OV8A 2UY1A 4N5QA 1FP1D 5JVGF 4A12A 5FQ7A 4Y7NJ 2R5YB 3COAC 1SFKA 3KEZA 2Z5UA 4U88A 1H88C 2P4WA 5JHBA 4CSWA 1Y3IA 2NVQJ 5L3FA 3I6WA 2VE9A 3A2KA 3ESLA 1ITYA 2P9PG 3IHUA 3TKYA 3IAM2 5BVIA 1TWCJ 2EZHA 2OZUA 3I4PA 4DIQA 3AJIA 1ZOQA 2FA5A 3HUGA 2ZKZA 4J01A 1KU7A 2PMUA 2GXAA 4KFCA 1E3PA 2WXQA 3GFMA 3LSHA 2VGEA 3HTSB 3CQZJ 1L0OC 1D8KA 5LHHA 1Z3YA 1FVFA 3B7BA 4B3AA 2XGXA 4RAYA 4EPZA 4A6DA 4YFNF 2G7HA 4CZCA 4JVSA 2FI7A 5J1UA 3LA7A 3SGHA 3Q9VA 5ICFA 4N3CA 5G05C 1K3QA 2GA2A 4XKWA 4RVBA 3CMYA 4F3VA 4AVPA 4U87A 2CV0A 4WXHA 3JAMZ 3BWGA 3P5JA 1P6RA 4EJTA 3KEQA 1NA3A 2IO3C 3TDUC 2LO6A 2IP2A 1YE9A 3E97A 5ENPD 5LHGA 1T95A 3F0CA 2LH9A 1TL8A 1ZLKA 3GMEA 2LUHA 2MHKA 3MKRA 1MMGA 1TP4A 3RKWA 3CSTA 4A3KJ 2OCCE 1GDTA 1WH5A 2IBDA 3F6OA 3HSFA 2XS8A 2H6BA 2DA3A 3ELKA 1BC8C 4I2WA 5FLVA 1FJLA 2LSVA 1KHXA 2DCEA 4HX8A 1NZNA 3Q9UC 1JGGA 3G1MA 4Y52J 2NRAC 1E3OC 4RMNA 1ZG5A 4BT9A 5IYDJ 1N11A 4JEUA 4JYKA 5LRRA 2G9WA 1OCOE 1MR1A 3ABKH 3O2PE 3ULQB 1AP7A 3RJPA 4P29A 3LJNA 1SFEA 4AIDA 3CVVA 1EH8A 4I98B 4FHKA 1X3UA 1SVMA 1RC9A 5HNHA 4FULA 2DDAA 3V4GA 2BGCA 2Y75A 1T8IA 1H6OA 1VQOI 1QNFA 2KZVA 2DYSE 3S8PA 1ZH5A 2PJPA 1K1BA 5EIBE 1UG2A 2PMHA 2L02A 5BXOA 4D10C 1I6XA 4IHWA 3DSWA 2BBYA 1TN7A 4JPSA 3CJRB 2WVIA 1VZ0A 3D9PA 2CQQA 5H6RA 3G71I 2PLYA 3AS4A 5E1XA 2Z16A 4U7BA 4P9UA 1WPKA 1UJKA 5JHAA 5HRYA 1DEVA 3PJRA 1MYOA 3HJEA 3FEXA 3SFXA 3R4KA 2HDDA 3NF1A 1XMKA 3FBIB 1JPLA 3R7QA 1E8XA 3ML8A 3V8KA 4E6KG 2O61A 5HQ8A 3HTUA 4A5NA 3ASDA 5JELA 2UZKA 3B7RL 4ESBA 3ZR8X 3LL7A 2VONA 1W7PD 1WJEA 2EB7A 1LFUP 2V5QC 3MV2B 1FPPA 3AG2H 4MLOA 4A5MA 4X0GA 1ON1A 4GXOA 2ZGGA 2XPUA 3BCBA 4A3IJ 1P2FA 2O7OA 5FT9A 4C0MA 3O8GA 3ZMUA 3V7WA 3LCAA 1U0JA 1YO5C 4GA0A 5GTHC 3SHFA 4PUCA 2YU9J 3D5SC 1H2TC 4CA0A 3NZSA 3CF5F 5CCLA 4KMFA 3B95A 2I2CA 1TYQG 4GO1A 3J5PA 4EBAA 1SUWA 5B5EC 3CMEI 2WXRA 5EF6A 3R9AB 4BE1A 2XVCA 2HO1A 2XZTG 3L2UA 3DEPA 4F6RD 5E3MA 5ENQD 1MD0A 5FQ8A 5K7ZA 2AVPA 2VSYA 4EZKA 4QWQA 2R7FA 4DBQA 1JXSA 3SEZA 2E5NA 1PVEA 2HVRA 2VOOA 4AM3A 1RESA 3AG3H 2QBYB 3QJZA 4HNUA 4B4CA 1R4NB 3F8MA 3UKGA 2R7ZJ 2Z1DA 4CGZA 3FP3A 2LKXA 3LSRA 1DPRA 3GYHX 1TNYA 3FK6A 3NZUA 5LP0A 5BPIA 1ZR2A 3LVRE 4JD2G 4RGXA 3EIQC 4V2GA 3ABTA 1J09A 1G3WA 2ZFUA 3K10A 2EZLA 3WU1B 5C3EJ 4I43A 4EZJA 4B8CB 2QZ8A 5LGNA 1ZQ3P 3F8BA 1OCCE 3DSTA 1A04A 4LOCA 3CVUA 4Q4ZF 2XDVA 3LY8A 4YNDA 1SD7A 1MZBA 2NS8A 1KYZA 5M3FJ 1Z6TA 4L9TA 1LNWA 2ZSIB 2DWZA 2H6IA 1S7OA 4JC8A 4BXFA 4TV3A 3E5QA 3WHBA 4HLYA 1MX2A 3S3MA 2FO7A 2PI0A 2J07A 1B72B 4KYOB 1FPQA 4LLGF 1WJ5A 2MA3A 3PEVB 1J0RA 4EJUA 3CVPA 4B43A 2PJRB 4FTHA 2GOXB 3ZYQA 2P6TA 1LTXA 1O3SA 2K9SA 1SVOA 1K78B 3FUIA 3N71A 3AFHA 5FQ4A 2WA0A 2NC9A 2A07F 3OWTA 4BGDA 1CF7B 1OT8A 1J4LA 2KIMA 4IHXA 3HOWJ 4GTPA 3GWZA 1H0MA 3CP2A 1FHRA 1BN5A 2AQFA 5HKPA 2R7XA 5J8CA 3CK7A 5CJ9A 1USSA 2CH0A 3REOA 1OISA 3CSFA 1OYIA 2LFBA 1U7FA 2R7WA 3RKQA 2MABA 2Y48A 2KB4A 3WG9A 3ZQQA 4IHTA 1NFIE 2B0OE 2X6HA 2GROB 2V9VA 2ILRA 4F53A 5EJGA 1XMAA 2C0LA 1U2WA 2JN6A 2HR2A 2I9CA 1LJ9A 1FBUA 1ODDA 1U9NA 2DJNA 3UT7A 3FIWA 3QODA 2O5RA 3FH5A 3OOPA 1V55E 1G3TA 3G6EI 2ZNZA 4XLNF 3UOTA 1WJAA 3MCZA 1YHQI 3DRAA 3LY7A 5FJYA 2BRFA 4O6FA 3T0YA 5M3MJ 2VC1A 1IZ1A 1ZR4A 1Z05A 2EFNA 1RRJA 1VQ6I 1FYLA 3DSHA 4KIFA 2AN1A 1O3RA 2D1VA 3LOCA 3MQ0A 5IPAA 2FBNA 3T8TA 3QYEA 2X6YA 4LIUA 4WNFA 2LAHA 1WV3A 3BJOA 3ZHEA 1W7PA 4C3JJ 2AXZA 1OWMA 3TGOA 2P5LC 3PFNA 3BG9A 1I6HJ 1O4XA 4BNCA 2X3MA 1N78A 2YNQA 3QB2A 4HNAD 1WI9A 4V3IA 1YX5A 1J4KA 1IO2A 1TC3C 1POGA 2OA4A 2P8TA 4FP7A 1TWGJ 5L3BA 1FOWA 1WWXA 2LY2A 5CVUA 5KBAA 2FE3A 1IW7F 3PIOF 1K2MA 1ZRCA 1RKWA 3B6AA 4AYBA 2NOJB 1DNPA 2XPYA 3V7UA 3D9HA 2A5UA 4LSZE 3TOBA 2QGUA 4IHSA 4WCGA 1XPXA 5C4XJ 2KRHA 3S2AA 2DFEA 3E6DA 3F72A 3UMZA 4ZC3A 2ISYA 3DXMG 3JUIA 1E3HA 3KEOA 3L2CA 3ULYA 4DLQA 2R7TA 2GM4A 1TR4A 4BQAA 1V54E 2PMZA 4HBDA 1MDMA 4JHJA 3JXJA 1REPC 5A2QK 2VJ8A 3MDBA 3WXXA 2KMUA 4L5EA 3IHYA 5CCMA 1OYWA 4EQFA 3IC7A 1TN8A 3QWLA 5LD2C 5H20A 3VPYA 2NYXA 4A1SA 1IG7A 1TLHB 4DOZA 4WERA 4R9PA 2M9HA 1HBXG 4TV7A 4HXIA 5KJKA 3OIPA 2VGXA 4L18B 2ECBA 3ZQHA 2XCBA 2KIQA 1JJ6C 1X1BA 4LEUA 4BEHB 1X1DA 3FXKA 4U96D 2FXAA 2LKPA 4N9IA 1A6IA 4GYYA 1FBQA 4UUTA 1YCSB 3B7UX 2EPFA 2DODA 4I01A 2QQ8A 4B8AA 1HXIA 4LIVA 4XLHA 3V8MA 3DSXA 4XMYA 4M3EA 3UR3C 3KP5A 4E70A 2L4MA 2LAIA 2YINA 3GTGJ 4N9HA 5FRNA 1Y39A 3VA4A 4K5BA 4B8XA 4MS6A 4GTOA 2MW8A 3LFUA 1QBJA 4UI9K 5EEHA 1N75A 1OCZH 3AS8A 1H2VC 3JXIA 3SFIA 2Y4UA 3FK7A 3ABUA 2OPTA 3H9JA 4JQFA 4L9NA 4AD9A 4EJOA 5HLTA 3DLAA 3JSPA 1OY3D 3G2WA 3LKUA 4G6TB 4IRHA 4QCJA 2ZJ2A 1XNFA 2BEDA 1AKHA 1UAAA 5B66C 4LG0A 4CUGA 1MSEC 4OIOF 1LEBA 3DEOA 3A0HC 3E37A 1BI1A 3BP8A 2WXKA 3V2XA 3ZPLA 5FO5A 4L5IA 3KSQA 2PEXA 2G0EA 5EEAA 4ZH4F 4MFEA 1HG5A 2JEKA 3G2UA 3G1OA 3ISPA 5DUKA 4DJAA 4IRUA 4TXRA 4WWPA 4DLOA 1V54H 3KP3A 3ZEFA 3S2WA 1XX5A 4CYCB 2RAEA 2VGXB 3E5UA 2NVUB 3S1NJ 1G3SA 2FOKA 4D1QA 2X6KA 1MJ0A 1TNBA 2ZIRA 3K4CA 4DPRA 3L2QA 3I3NA 1TWFJ 2ZJRF 2OOEA 1SZ9A 3MJWA 3I58A 3SF4A 3HIFA 1YFHA 3AG3E 1PJRA 4A1GA 2DA4A 2MH9A 4YRVA 4GYGA 1UMQA 2OEWA 2UXXA 1H6PA 2W1OA 3HRUA 3H3VK 3ABMH 3Q15A 2EV5A 1K3NA 4XLEA 2TRTA 4MIMA 3AKZA 2BY3A 1HE8A 4DX7D 2XEHA 3OY9A 2MC4A 2JMWA 2LY9A 1Z91A 3ASOH 4IVNA 4AC0A 5ICCA 5ILVA 5M5XJ 2DOEA 4E7IA 1LE8A 1ZGAA 2OZ6A 5IP9J 5LGUA 4KNYA 3HXCA 1WY6A 3LEWA 1OWOA 4U0YA 5F0FA 5DD8A 2LKSA 2XEEA 3VYTB 2DN0A 4DZJA 3ZN1A 2IY0C 2L3DA 3NQPA 1A17A 2PZIA 3CVWA 1MIJA 5E3NA 3M8FA 1P4AA 1LD8A 2JA7J 2EINE 2BHZA 4U0VA 1P5QA 3OSGA 1YG2A 3RYRA 4OVVA 2RG8A 4BFRA 1S63A 1W7PB 4I6GA 4WXCA 2F4IA 1W36C 2H6GA 4M72A 2V9KA 5CVVA 3R0JA 1I3QJ 4L2LA 2E1CA 2HQAA 2A6EF 1MNDA 4XONA 3PO2J 3KAEA 4P9FA 3RJVA 2ZC2A 1EF4A 3HRAA 3ZXPA 4AXHA 2J4DA 3NQOA 4BS9A 3HVEB 5A8IA 5L3DA 3HOUJ 2FQ4A 5A2QZ 2I2BA 4LB6B 1K7AA 3PNTB 6PAXA 3QOEA 2J08A 3AAAC 2O8KA 5D4SA 4XI9A 2BZTA 2E1OA 3DU5A 4I76A 4C9YA 2FUG2 1GVJA 3KPHA 3OTNA 2ZXJA 3FMSA 2AXTC 3ZRGA 4HNVA 1FYMA 3Q78A 1X58A 4QIWN 1OLTA 3WTWC 1DCQA 2LD5A 1TQIA 4RLQA 2DO7A 1HS6A 3OL4A 1DU6A 3FU0A 5AIPA 3FUDA 2A69F 1WLNA 2VQHA 3H5RA 3VSLA 2IONA 1BBYA 3R61A 1USTA 5CVIA 3BTJA 3I53A 3VSKA 4YVOA 2ZFWA 4AJWA 2CRGA 2XIGA 2YU3A 3FH7A 2QKMB 2QYJA 2WXGA 1ETOA 2I2OA 5EDSA 3DEEA 1QNTA 4RGUA 2ELKA 2QY7A 5E79C 4V19K 4EQQA 1K1AA 1Z1DA 1RPWA 3E30A 4GZ5A 5AQAA 3TWRA 3TL5A 3IHVA 1QHGA 2AXVA 2Y3AA 2DBAA 2BVLA 2BXYA 4W9RA 3E6BA 1F9NA 1UHMA 3OIQA 4ABNA 2VASA 3FH8A 3TQNA 2WV1A 4CCMA 4V2FA 3ZMDA 1P4XA 1J75A 1B72A 1FTTA 4PZJA 2DTZA 3EUAA 4FC8A 2Y0MA 3BOQA 2WAQN 1OXJA 1EJ9A 1DCEA 2M5WA 3GCMA 4XQFA 4GTRA 1G88A 4KIGA 5LLQA 4XNFA 1U5TB 5J1RA 2EFPA 1U0RA 1FWZA 4Y3OA 4BY7J 3OMYA 3I54A 5CPRB 2AS5F 1HX8A 3CHRA 1VQ5I 3D9LA 3S14J 1LQ1A 4K5AB 4UQZA 3H0DA 1QU5A 2XHKA 4RAFA 4XSZF 3HOZJ 2XGEA 1D1CA 1WJBA 4ZFHA 3K70D 1LDDA 1H8AC 2FO1E 2L5QA 2NXNB 4NDLA 5G04C 3UT4A 1KT1A 2HXIA 2XEVA 3RTRA 3I6UA 1KONA 2CHXA 2JUCA 2OC6A 5HDNA 3I0TA 4MLPA 1S8NA 2Y2ZA 4N0BA 4WNEA 3FU3A 2FULA 1J7KA 1IRGA 2RFAA 4JW1A 2IT0A 3LYAA 2WWYA 3ZUVB 3U66A 4J00A 5HNFA 4G26A 5B1BE 4CCOA 1KQ9A 5EZGA 5LGTA 1JKOC 2NYJA 4G1TA 4GZCA 4I9CA 3D9JA 3WTSC 3DKWA 1K83J 2W48A 3GZNB 2C0MA 2DYRE 1Z0SA 2F2EA 2WADA 1QZ2A 1LDKB 2A61A 4I0BA 2P7CB 1B89A 3KFWX 2XF6A 5KNHD 4CZ2D 4DX6D 1KHUA 1JUPA 2AHQA 2WB1N 3K2ZA 2HI3A 3CF2A 1YTYA 5J40A 1UJ8A 3F23A 1YRNB 3QWWA 4PK4A 2I1JA 2LOOA 1RUNA 4GA2A 4GZ6A 3M8EA 3BPXA 3RKVA 4KA4A 4EECA 2QQBA 3BTIA 4HPQA 3VLDA 2H94A 5FZRA 1TNOA 2R92J 2WTEA 3HXEA 1O7FA 1V4RA 4GPKA 3IWFA 1XDUA 3EUKL 5LHIA 2OTLI 1FSHA 1O1TA 1NG6A 5EYRA 3Q79A 4CGWA 3IL2A 3HPHA 4L2YA 1NP7A 3TXMA 2L7ZA 3MEKA 1BOAA 1OJLA 4FETA 4EM2A 4PJMA 2LLKA 4HEA2 2RNJA 5M5YJ 4AIFA 3FXQA 3HYMB 5EJHA 4XL9A 3DKXA 3A01A 3CKBA 3LSKA 3H92A 4KZ0A 1AU7A 1N4PA 1OUVA 1KU9A 1JT0A 2IOLA 2J4BA 2FSWA 3WTXC 4C9BB 2BVMA 3FMQA 3GF2A 2IS2A 3TWQA 4HW0A 4ZYDA 3FTUA 1KU3A 3DFGA 3S16J 1I3AA 2H6CA 2MSYA 4Q5SF 1KPSB 3VLFA 1Y6IA 2NVYJ 4XBFA 2CO5A 2HXOA 2QUFA 3RAUA 3ECHA 3UMVA 2PIEA 2FOWA 1HKQA 2HNHA 3I55I 2KDZA 1ETKA 1Z21A 3VODA 2R3SA 4ANJA 4H4KC 2Y0SA 2YR2A 1ELKA 1XGMA 1DDNA 5D6EA 3DPTA 2L9BA 4BDZA 3BQZA 1XDSA 4PH4B 4TUMA 2DA2A 2IGKA 3G73A 1G6GA 2ZXIA 4N5CA 5CBNA 1U3DA 4KT6A 2Y69E 5KNLA 3FBNB 1XTAA 3PZ3A 4DGWB 3VB2A 1VQPI 2WQ7A 3DTKA 3PUKA 1ZELA 2EA4A 1U3EM 4NIKA 1LDJA 2BY0A 3F9KA 4HBLA 5GADJ 3CMMA 2X1CA 5F0HA 3V8JA 4PJJA 1W0UA 4WRRA 3H36A 2KDOA 3R60A 3CCSI 5JJTA 1Y1VJ 4L9VA 3TO6A 1S9HA 1S0PA 2VJJA 5BNWA 5DCMA 1FIAA 3HXBA 2WXFA 1YITI 3Q49B 2W82A 5BT1A 2JPCA 3Q0VA 4KDPA 2RVCA 1J2FA 2MLKA 3SZTA 5FTPA 4FJYA 2GZWA 4OAZA 5DIZA 3NARA 5ANRA 2M34A 4ACLA 3ELVA 2E19A 2WXOA 5EG0B 3JAMK 5EX0A 3ZQ7A 4UI9J 4G7OF 4ILHB 4XRSG 3DXKG 1MMNA 3ZMTA 4L0YB 1BC7C 1IUFA 2QCOA 2Y69H 3NRVA 1APLC 4GZ3A 4FX0A 1YW8A 2P2CP 3KP2A 5D0OD 4IRIA 4I6JA 2XENA 1R4MB 3EHMA 2L9SA 2PM7A 1LVAA 4G94A 3DF8A 3GZSA 2F8XK 3ZN3A 5D6FA 4EGYA 1VQ9I 1H89C 4G8LA 1E2XA 4GZDA 3CGHA 3L22A 3CR3A 2DQRA 1YLFA 3S32A 3ZMSA 3I4RB 1ZGJA 3SFYA 5LEKA 3ZQGA 1I1SA 4BEHA 1WAO1 3KS2A 4IYPA 5E8IA 1ZG1A 2GRPB 4CXFA 4EVIA 5M72A 3SDGA 2L9VA 4Q48A 2ISZA 2DA7A 5JLXA 3ASNH 2L54A 1W3BA 1TBXA 4M3FA 2IW5A 1X2NA 1E7UA 4FASD 3I0NA 5KJLA 2VBXA 1S70B 2I2FA 1K2NA 4FHTA 2HU9A 4F7ZA 2W85A 2EQXA 4PGHA 2KL4A 2F5EA 3OYHA 1UHSA 1LE8B 5E76A 2CV2A 5D2MC 1DU0A 4Q94A 1T0FA 2CQ7A 4O60A 3H9QA 2E2JJ 2A4ZA 5D5UB 4I7HA 1Y8MA 1ZRFA 3DBRB 3AS5A 3Q4AB 2QSHX 4U0UA 1ZKGA 4J6IA 1R21A 3FM3A 2E7XA 2B0LA 2QF7A 2XF5A 3MKWB 1SEUA 3BG1B 2IPQX 4RB1A 4BE2A 1STZA 2K7LA 2XAFA 3OSFA 2Y4TA 3S2HJ 2HKOA 3MZYA 3S7BA 1SMTA 4QPOA 1HQCA 5JHUA 3D1NI 5FKOA 1ACIA 3D3MA 3KT9A 4BQQA 4O3MA 4DY6A 5AENA 1ENHA 3HOVJ 4ZDLA 4JHKA 2IJGX 3QPLA 3FUKA 3J7AY 1PUFB 5FROA 2UY1B 1OR7A 4ANVA 4FLBA 2KLOA 2FRHA 5CLSA 1XGOA 5IT3A 3IKOB 2ETAA 3HB9A 3PL8A 4HRLA 3X2QH 2WY7Q 2Q7FA 3B02A 4N39A 2LNBA 4XRFA 2F5VA 4KICA 5M5WJ 3OS1A 2E2HJ 1NH3A 1VQ8I 4CZZA 5FKKA 3BC8A 2VLAA 3W2VA 3H9GA 3C2HA 4LG3A 1JJ8C 1S6LA 2PNNA 4CYMD 2VJIA 4CYDA 3WTUC 1XSDA 3FFLA 3ZYMA 2O8XA 3OYLA 1RUOA 1AWCA 2VSOE 3APCA 4HQDA 1O57A 3LY9A 3DCFA 1D3YA 5GAGJ 3IWZA 5KWDA 2UWMA 1F43A 3ENEA 2TDXA 2ZMEA 2P58C 2X6XA 1FY7A 2CGPA 3ZVVA 3PEUB 1SW6A 3CLJA 1YS6A 1HKSA 4NUBA 1D8JA 3SNXA 4B3XA 4N2SA 1U7FB 4BSZB 4NACA 5JJ7A 4JOMA 1IJWC 4G11A 4Z2YA 2JJ7A 5CKTA 5L3CA 1LB2A 1V5GA 3S3NA 2E35A 4BX8A 2JWTA 2X6WA 1H2UA 4G2SA 2YUSA 3LSTA 3OYGA 4RG9A 5HS9A 5BV1A 2V7FA 4O1PA 2L0TB 2ELHA 1UG3A 2Y1LE 3ZGKA 1MH3A 3L9TA 2HFHA 2ZXWH 3CDHA 1N54A 3FM5A 1YI2I 2PJRA 2AFFA 3PSFA 4HS2A 5DCFA 5DDGA 3ABKE 1QGPA 3K4NA 2L7FP 3KX2A 3F6QA 4M6XA 1MBEA 3C18A 5DCMB 2PN6A 2EWNA 1EH6A 3CLQA 1TT0A 3P7NA 1X1PA 4A3CJ 4I02A 1DP7P 1BPOA 3V7YA 2KHMA 2BOLA 2X9DA 4U0WA 1K61A 3K4BA 3WG7E 4U8YD 2HPIA 4NC8A 4OMYA 1FVHA 2VYIA 2DQLA 3QP5A 2KJBA 2ZMEC 5BV0A 1VTNC 4ZYAA 4Z68A 5JA4D 1JKRC 1N0RA 1UW4B 3ZXSA 2O9LA 5KNGA 4HAOA 2PG4A 1VQKI 4EMSA 2OV7A 2RNGA 2YPRA 5BW8C 1OPCA 3ZYKA 3GUDA 4JP0A 3C3QA 4NRHB 4M9XA 2VKDA 1OCPA 3DLLF 3PIPF 2E0IA 2DMNA 3Q0WA 4B89A 3ESWB 1JTXA 2VT3A 5CERB 2CWEA 5J1YA 1T98A 1WJFA 2IS6A 3PNLB 2MFZA 2GOMA 4CDGA 4C48B 4GPMA 3UT8A 4E7LA 4YVQC 2F4MB 1QPIA 1DVPA 4CCAA 3GTOJ 4ETSA 3G2SA 4BY1J 4U7EB 4P1WA 1FSEA 4LG6A 2H27A 3M7GA 5EIDA 4NC7A 3TW6A 3LQRA 3PZ1A 4MTEA 3D5LA 2GA1A 5GAEJ 2QENA 3RI4A 5A7DB 5J08A 3APDA 2JQLA 1OCRE 5CRUA 1OWPA 3TWTA 1D1AA 2DT5A 4LNBA 4L7TA 2EZKA 3W2WA 5T4YA 2XGDA 2IA2A 4LITA 4OAYA 2NVXJ 2HZTA 2W24A 2XRLA 1WSUA 2RFMA 5LOZA 2PBIA 2R7DA 3C1DA 4OIRF 1K3ZD 5HS0A 1GXQA 2Q1ZB 2VB6A 2M87A 2F6CA 2Y0BG 1HSTA 2AJAA 1Z77A 4TXPA 4Y13A 1EV7A 3I4MJ 3T8KA 2D45A 1ORKA 2L2OA 3L09A 1U6GA 1IN5A 3DTEA 3FX3A 2UUZA 2XC7A 1OWNA 4APOA 4BACA 4WWCA 1WFXA 1NTCA 5J4VA 2I6HA 2P1RA 4TUUA 1YIOA 1OCZE 4UV9A 4KIBA 3LA2A 2EILH 1Z9CA 2E2IJ 4XM3A 1UN9A 3B6CA 1HW5A 3UX4A 2HPMA 1XGWA 1JTYA 2XSDC 1BIBA 4WAFA 1YOVB 2MRIA 3LJ3A 3PDNA 3LSJA 1R9TJ 3LSPA 4IOCF 1MX6A 4ANXA 1MGTA 3CUQA 2ECCA 5DM6F 2HTJA 3ERED 1YW7A 3GTMJ 4FCYA 4DQ2A 3JRCA 4HQEA 2UV1A 2R59A 3K9TA 3OL3A 3AG1E 2RDPA 4ILGA 3R6SA 1T39A 3VOEA 1JE8A 2KCVA 4MEYF 2JKDA 1B8IB 2CQKA 2MBFA 4J8EA 5DHUA 3GMJA 3JTHA 5AJDA 3I3LA 4A0ZA 2LY1A 4WK8F 2DA6A 2X6JA 3JUEA 3HHGA 3J81K 5EX3A 3ULEG 2JSPA 4G6DA 4YFKF 4CDNA 3DSVA 5ARFA 2ZGDA 2DPDA 2WV0A 3M9AA 3FKIJ 3ABME 5BS6A 2H09A 5HDKA 4YIIA 3QDNA 3UIPC 1XSXA 2CV1A 3ML9A 4K2EA 1IGNA 2QBYA 5JLWA 5J3LA 1MKMA 5E3LA 4BJTA 2P9KG 3LS8A 1IF1A 1VDYA 1QVUA 1WH7A 4L02A 3TW7A 2X1DA 4BJ6C 1U5TA 3SZ7A 3U3WA 2LSOA 1HH8A 3KP6A 2PX9A 4WWOA 4YDYA 3HOSA 4XOPA 2A0TA 2KFUA 4NC6A 3GTKJ 4RBOA 2LBFA 2VOPA 2QQ9A 3Q9SA 4B0ZA 3B73A 3BCAA 3AU4A 5FKLA 1ELRA 1XGNA 3B7SA 2KATA 3HYIA 1O7LA 3ERMA 4DYRA 3NOCD 3H1CA 3GZ2A 1HSJA 5FINA 4OVUA 2BKKB 2PM6A 2DOAA 4HYEA 2M4KA 1FLIA 1XC5A 1JCQA 4Q69A 2DPUA 3M1CA 3HUGB 4BL0B 1R00A 4WNGA 2KZTB 4B44A 3BG0B 3CK8A 2K02A 4JONA 1UB9A 3GFLA 3VPRA 3Q5FA 2YHEA 2VJ4A 4XLPF 3JCUC 5GP9A 4ANUA 4E7HA 3HBLA 4X1EA 3FZVA 4C2UA 2Q2EB 1H0AA 2MD5A 3Q75A 1MW7A 5DBKA 1MBKA 3PUJA 3ABLH 4BHBA 1TNTA 3CHQA 4FADA 3CK9A 3WGGA 4XRSA 1WZ2A 3S7JA 4F1SA 1B4AA 4QTRA 3SXYA 2DT6A 4UUCA 4HAMA 3GTJJ 4UUSA 5CQEA 2K4JA 2I2DA 4BWRA 3FU6A 1GLNA 1TNSA 1UFMA 2B7EA 3HSEA 2FBKA 5BNGA 1IQRA 4M6VA 2HM8A 2ZXWE 4RQIA 2QYOA 4LUNU 3TWVA 3OYKA 4II2A 1XCVA 1BI8B 4ZTJA 1HCRA 4HV6A 3UINC 4U0ZA 2DU9A 4IQ4A 4W97A 2WPVA 2XRZA 1J4OA 2BONA 2PMZN 2M4GA 4UWKA 3L82A 2JGRA 2F5CA 4JX5A 3Q7AA 2KXPC 1EYHA 3MKQA 4DX1A 2OF7A 2OBPA 2BUGA 1LKXA 2DXIA 5D66A 3LPZA 3PZ4A 4XI0A 3CCVI 1DPUA 4D7MA 2JA6J 3DPYA 2XV4S 1J5YA 3BJAA 2ID6A 1MBHA 2V5FA 4AM9A 2KZGA 3Q0UA 3FKJA 5ANLA 4MRUA 1DC2A 3SO8A 2PQNA 5BPPA 3E4BA 4CH7A 4CT4A 1J9IA 1UJJA 2WXJA 4A63B 4S0HB 3UM3A 5FQ6A 4BTBA 1BR4A 3IRRA 4UWHA 1FIPA 4PS8A 4E7KA 5ARGA 4PFOA 3CUQC 1ERDA 4GFBA 2R02A 4QFVA 1Z0ZA 2AW6A 4YIFA 2CG3A 1B1BA 1V3FA 1R7JA 3OYFA 3GFIA 1N4RA 4U95D 3V31A 4KVMA 4ZJZA 2WMNA 4A93J 2JA5J 3NAUA 3BQOA 3RRMB 4APFA 2MOWA 1WKMA 4GA1A 2R4GA 4I1AA 1IYGA 1SA4A 2NS7A 1GXPA 3SY2A 3VA1A 5LBQA 3WG7H 2ZNYA 1FTZA 4R1HA 3QKYA 2OUMA 3L2RA 3TOAA 1ZLJA 5ED4A 1N94A 4IN3B 2EIME 5ILSA 1C0WA 2CHWA 3NWSA 2V9PA 2YS9A 1YMPA 2J09A 3K4LA 4Y15A 2KRCA 3NBNB 3RPUD 4FA6A 2VTBA 4JA9A 4EEFG 2M63A 4A4YA 3TGNA 1MJ9A 3PFYA 2I10A 1SANA 2ZBKA 4MQ9F 3QAQA 1N4SA 1AHDP 3RRNB 1HA8A 1HZ4A 1R58A 1RETA 3IUOA 3ZPJA 3BG7A 2QSGX 2LMDA 2R7OA 4HDUA 3K6GA 4BHPA 3UNNA 4XKBA 4F92B 5BUZA 4KT5C 1A5EA 4G25A 4ACKA 4GTTA 2TCTA 3D9NA 2DBBA 3EHQA 1E8YA 5CEAA 1Z7LA 2XPWA 2I29A 4UWLA 4HLXA 1R1TA 4GMJA 2W7NA 2O3FA 1OCCH 2L01A 1V55H 2BY2A 3EYIA 3PZ2A 4IULA 2KKLA 2B6CA 5AIQA 2HZDA 5C2YA 3FUEA 4E7JA 5DS9A 3HHMA 2QLZA 2MD0A 4MGRA 4ON0A 4HF1A 2ME0A 3LSGA 5BMZA 2QKLB 4BBRJ 1L5JA 3MKQB 4FHJA 3R0AA 3OYNA 3GXOA 3SI5A 2K86A 3W9FA 3E6CC 2VXDA 5B3SE 1KQ8A 4QPQA 3FXRA 1I39A 3KETA 3FMRA 4DZPA 4U0SA 2FU4A 2J5OA 3V7SA 3QYFA 4GMRA 1H19A 2IA0A 5D5XB 3RKXA 3F8NA 3MZLB 3HIZA 3JRIA 1NL4A 4XSXF 3TEDA 4A69C 1HXDA 3DP7A 3LSIA 2B9SA 2IOSA 5FFZA 2X4HA 4HRNA 4AUXA 1Y8RB 2XGCA 4HRIA 2L9NA 2EILE 3IP4B 3TAXA 3A4CA 3CP8A 2WBMA 3C5RA 4NBQA 2Q2EA 1TWAJ 2K40A 2KISA 1Q1HA 3FISA 3SYTA 1SZAA 1U7VB 1DUXC 4HOTA 3RU0A 3HDXA 4A3TA 2WXMA 4M71A 3ZW3A 1MDMB 5D8LB 1KA8A 3DBLB 3GFJA 1G3NB 1YT5A 4CCJA 1D8EA 1SFUA 4M7CA 1YRNA 2HTSA 4A3FJ 3E33A 1UCRA 3EJNA 4N3AA 4ATGA 3QU3A 1KQ0A 2CMPA 2VODA 3BG6A 3JYSA 4HQMA 1XN7A 3L9FA 2HVQA 1U9OA 2K3PA 1YW9A 3BROA 3FF5A 4IF4A 4YDOA 2P5VA 3CJTB 4BAYA 5FLMJ 2OTJI 4JX6A 5CRVA 3EDTB 4KMUX 1DD1A 1XGSA 2EH3A 1HC8A 3MFKA 5EYPF 4HOQA 2DK8A 1LVKA 2XAHA 3N97A 1R71A 4EATA 4QQIA 2LRDA 2DK5A 3N05A 2VI6A 4B47A 4I17A 2Y9ZA 4HOSA 4A3BJ 5LEJA 5D0QD 2X85A 2HGCA 1MJAA 1TWHJ 2BYVE 3AG1H 3DV8A 3DWLE 3F21A 2Z9OA 1NK3P 4XIFA 3R7RA 3FXUA 3U64A 4CEMA 2I1WA 2E1MB 5EJFA 3TXNA 2FBHA 3N4MA 1K79A 1X2MA 1S7AA 1WI3A 3RIBA 5LX8A 2QSFX 3ZHEB 2FNAA 1DGWY 3ONQA 2DOFA 1YYHA 3U1KA 4ZDPA 4GU5A 5CYVA 3JRFA 1IXRC 1Z3XA 2CSOA 4I09A 5HLIA 3VDXA 4BE0A 1FCHA 1AKHB 3ZQFA 2XF7A 3CESA 2XSJC 4OWRB 2A68F 2K9QA 4KZCA 2RGVA 3K4JA 5DYMA 1EH7A 2CUJA 3RPQA 4DW6A 4AIKA 4ANWA 4F1PA 3PZDA 1HDPA 1V5FA 1DGRM 2HWVA 3M8JA 3BG5A 3FXJA 3FTZA 4A3LJ 3CJNA 4PFPA 4YFXF 2V1UA 1JUQA 4YIRX 3OYCA 4XORA 3FTWA 1Z0UA 3P9CA 1PC2A 2CYYA 3AG2E 1ZGWA 2M1BA 5KHDA 2ETCA 4GCOA 4GMLA 1X1AA 3KLNA 1UELB 1ZAOA 1JCRA 1ETXA 2E1NA 2ID3A 2JK3A 5G05J 5KK1A 3D9KA 1IUYA 9ANTA 1W0TA 3JRDA 5E1WA 1F36A 4HZFA 4CO8A 2BF0X 4M3OA 3ZFWA 2VPRA 5JEMA 3BR2A 1RIOH 5KAFC 3M1EA 4GCVA 2A5EA 1RKTA 2GWRA 3OYMA 2VGYA 2ZU6B 4J8SA 4ME2A 3HUFA 3VZDA 1Y1WJ 2LF7A 2UWJG 4Y33A 2HOTA 4FQGA 4WNDA 2WAFA 2UXNA 3W9GA 3O4ZA 3VTYA 5JR3A 1KT0A 1S64A 2KBXA 4RA2A 1ETYA 3L08A 3S1RJ 2X6OA 2CS3A 1F4KA 2IAIA 3PH0C 4BX9A 2QVOA 1WJDA 4GTQA 2XZDG 2IEJA 4K5CA 4IO9F 3BG3A 4BUPA 3P2BA 3SZPA 3BZKA 3BEEA 3HG0D 4BY6A 2R7QA 4DX5D 1B9MA 4XKCA 3I59A 3MZ8A 2H1KA 2Z3YA 2F0YA 3VEPA 3ROUA 1G2HA 2WXNA 1BI2A 2A5WA 4G24A 5JEOA 1Z5SC 1F1ZA 1FOXA 5GPCA 2CUFA 3HPGA 3S2DJ 5JERA 3JRBA 4BEPA 4MHGA 4P55A 3JR9A 3R9MA 1E90A 2QM3A 2R5ZB 3V80A 5KCMA 2K27A 3KZZA 1QZEA 1K8KG 1FT2A 1QZZA 3IXEA 1LGQA 2RC4A 3FXOA 1MQSA 3V8LA 4B1RA 2XASA 4GGGA 2V6EA 3AL0C 3A0BC 3BQYA 1W4MA 2V26A 3BPVA 3U9GA 1RR7A 2A05A 5K1YA 3Q5MA 5TGTA 3WTYC 5AJLA 4N3BA 1T0FC 3KZYA 4RM3A 1JUMA 3PE4A 3URZA 5IY5E 1WHUA 2CW0F 1WJCA 1SC7A 2EIMH 2H8RA 3DSUA 4P96A 2IGNA 4Z6YA 3DWLG 3S3OA 3ONLA 2BHYA 1T33A 2GXGA 1FC3A 1VQLI 2IFUA 1OCTC 3D9IA 4OAVB 3T5PA 4JXTA 2XS1A 2KFDA 2W84A 5IT9Z 3FUJA 4NURA 4HLEA 3A03A 1KYWA 1J4PA 5D8KB 3F8FA 2P0WA 5LCWJ 3OR2C 2FD5A 3T1BA 3F8CA 3DSSA 2VBWA 1MZCA 2Q8KA 2K3FA 2F37A 3S7FA 1R5ID 2DCPA 3K1PA 1MHQA 1MBJA 3QWVA 2DFFA 3EUHC 3JSOA 2WXLA 4BETA 3U9WA 1W5CC 4PSXA 3CDLA 2EIJH 2P9NG 4NB5A 4G23A 4JZYA 3NAWA 1HOMA 3UM1A 1INZA 2VQCA 3BTCA 2OVBA 1FMVA 1R36A 2WXIA 2XXSA 3GYZA 1N77A 2L0KA 5EJCA 3TO7A 2RQPA 3E7LA 4IXAA 5EZHA 1K78A 4UY8I 2V1DA 3DBHB 2GGFA 2VKHA 1PP7U 1N9AA 3M07A 2JQ7A 2VIXA 3HRMA 4RLYA 3K69A 2ZB9A 1D1BA 1TT5B 1YYVA 5TISC 4KT6B 2GIVA 2EK5A 1TQMA 1FMWA 2HYJA 4G12A 2LTPA 4DYQA 4HFGA 2QYUA 1O3TA 2RREA 5FLXZ 3CVYA 1W36D 1GW6A 3MMYB 4X6AJ 4I2ZA 3PNTA 3ML6A 1KZPA 3ISMC 4MKTA 3DITA 3QPSA 3FY4A 5AN8A 2XKOA 3J7YJ 2HQNA 3WTTC 2XROA 1K6YA 5IY5H 1HKTA 3UIOC 1VQ4I 4Y6WA 4LCTA 4WUYA 3K1NA 3NOGD 3OYJA 4M6YA 1I27A 1TNZA 5EYLA 1KZHA 1MNEA 5HODA 1XCBA 1ZRDA 5AQBA 2L0IA 5L3GA 1ULYA 4F93B 1QU3A 1S3JA 5FD5A 4PDXA 1TQPA 4GYOA 2M8GX 3HUEA 4TRQA 3FDHA 3E5XA 3L6AA 2ZXHA 3WGHA 4RAGA 4C3IJ 2K9LA 2COMA 1PDNC 4PJLA 4GYWA 3S7DA 2G1LA 1MJBA 4N4NB 4G9YA 2GBYA 5J6XA 3JREA 1OMIA 3CCQI 3AL0B 1G6NA 4IKFA 4AOFA 3C3OA 3ZQLA 1X3ZB 2DZOA 3G1LA 2E5ZA 4WXDA 2FJ1A 4NHJA 4LB5A 2JT1A 4H87A 4KITB 1BR1A 3BTLA 4KXKB 3CCJI 5B1AH 5KVRA 2R05A 3RQIA 3TMOA 1HDDC 1QRYA 3ZN0A 2BY1A 3LSMA 3L1PA 3CHOA 3OXLA 2FNPA 2J49A 1X4PA 3LMMA 3VFZA 1NA0A 1IAWA 2KB3A 2D2WA 2CSWA 3MV3B 2ESHA 3SQNA 1RNLA 1SAUA 2CFOA 5AQ9A 2DT7B 4LMYA 1R23A 3RKYA 4HG2A 3HVEA 1MNMC 2MYSA 1RR8C 1O1RA 2V6CA 2IF4A 5J47A 2GIZA 4U8HA 3HL2A 2RKHA 3QP6A 1PY1A 4UV8A 4LK0F 2LNIA 3U21A 1SA5A 2DA5A 3Q47B 5FKMA 4CDMA 3FXLA 2QQAA 3U2RA 4KBQA 3MZHA 3HRTA 1JHFA 1MMAA 3S15J 4GYIA 1BM9A 4XLCA 2KCKA 1YJNI 4FX4A 2VUMJ 2C2LA 2IU1A 4C3HJ 4ZHBA 3GQSA 4XE0A 2LF8A 2DTRA 4RS8A 5A6CA 5F1JA 3PREA 4EZLA 2JLBA 4A6EA 1W5SA 1SAXA 3ZU7B 1FEXA 4IJAA 4CDRA 1ZK8A 2HDWA 2NS0A 2DIWA 1M1EB 5JHFA 1ELWA 1JUSA 1YS7A 2L6BA 5G2NA 5E3OA 2XHEA 3ZMZA 4OMZA 3RCOA 2D1HA 5LRSA 1NK2P 3D9MA 3CEQA 2Q0OA 2QEXI 3QK0A 1XD7A 3BR3A 4BHCA 3JRAA 3FHEA 1Y0UA 3UXGA 2VSNA 4GDFA 2EH0A 2LC1A 3I71A 4G7HF 2GW1A 3FM8A 4K0RA 2OU2A 2V0PA 4PDKA 4JBAA 4AEZC 2DA1A 2KT0A 3LDZA 4KUMA 2LDUA 2ZJQF 3A1YA 4R79A 1UN8A 3D9OA 3VYRB 4YELA 1XG1A 3CD6I 3LFKA 3CZ6A 3ZNGA 4DRXE 3L2WA 4O6JA 5JVTA 3TWSA 3KD7A 2A5YB 2RN7A 3HXDA 4GTMA 4PS7A 3F3XA 5JEJA 4CYCA 2HS5A 4HB5A 2P5KA 1PUEE 3IAS2 2Y0SN 3W6JB 3SFZA 3RO2A 4A3MJ 2P9IG 3FTSA 2ESNA 3V8PA 2JRMA 5HDGA 1RI7A 2D5VA 3AU5A 1XB4A 4LG0B 4JIWD 4M9SA 2DFHA 5ERIA 2B63J 1PAQA 3TP3A 2LXMA 5E50A 2KRFA 1D9SA 2W4SA 5E18F 3CQGB 4KU0D 3LXUX 2XB0X 1IN6A 5DV5A 4CT0A 4E85A 2J8SD 3JRHA 4U8VD 1MMSA 3VZBA 3IKVA 1MX4A 5K5QA 4TXQA 4D5CA 3RZOJ 3CVNA 4LNGA 2DMTA 3K1MA 4G8XA 4UXNA 4I0AA 3C7JA 1U78A 1A6QA 1YGSA 3OYDA 2OQGA 3TJPA 3GLLA 3KEYA 3I5UA 2WY8Q 2E2EA 2E36A 2COBA 5DTDA 5ENNA 4A55A 2VPLA 3FXMA 3MN2A 4WF2A 3C98A 2EQRA 4LLNA 3PFIA 2YQ8A 4O1OA