2FF4A

Mycobacterium tuberculosis embr in complex with low affinity phosphopeptide
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
EKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Probable regulatory protein embR
publication title Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 132
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
A PF00498 FHA FHA domain
A PF03704 BTAD Bacterial transcriptional activator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ff4A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ff4A02
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 2ff4A03
3TG5A 1LVAA 3KT9A 3FP3A 3RIBA 3I6UA 1RZ4A 4EM1A 3KP6A 1T38A 2ISYA 1B1BA 1MZKA 2ZJ2A 1G6GA 4WF2A 2JKDA 3TG4A 3GFMA 3LCAA 4NRHB 1IN4A 5JJTA 1U3EM 3ZPLA 4CO8A 4ON0A 2IF4A 2VBYA 2QVOA 2W85A 2EWNA 2L4AA 3CKBA 3F8BA 2R7DA 1G3GA 4NB5A 2GZWA 5D0QD 4GCNA 1J2XA 3HX1A 3WTWC 2J5OA 5TRDA 3FMRA 4LLNA 3IRRA 2O3FA 3KS2A 2AVPA 2K27A 2K4BA 1FSEA 5DBKA 2ZO4A 3V4GA 5C1DA 1BI2A 2VE8A 4M74A 4M72A 3R0JA 3ZMTA 4M9SA 4Y6CA 4K2EA 2VBWA 3C3WA 1Z9CA 4GYGA 2GWRA 4WUYA 3GLXA 5LHGA 1Z91A 4RAZA 4XSXF 2YPRA 3KE2A 1REPC 2VBXA 3J81K 5LCWJ 2A61A 1T2KA 3F8FA 1IXCA 1FNNA 4GYOA 1YIOA 2IJLA 3PFIA 3ZN1A 1YQAA 5HS9A 3S7BA 4BHBA 3KLNA 5FD5A 1TQMA 1BOAA 2A6HF 4LK0F 3I0NA 4ME2A 4HA8A 4OOIA 2Y48A 3WGIA 4CGWA 2BBYA 1IN7A 4JHRA 5FJYA 5HQ8A 5AIQA 2KCLA 4XLPF 5L3BA 5JFRA 4BYYA 1P92A 3E6BA 5HS7A 4HOTA 3OUNA 2XPIA 2EFOA 4U0UA 1W7PB 5ICCA 1U5TB 1R5HA 4NQWA 3TO6A 3SXYA 3LPZA 2P7VB 3ESKA 4AM9A 2C6YA 2STTA 5KJNA 2FNPA 2DW4A 1GXQA 3E5XA 2P4WA 3GF2A 3ZN0A 2GAUA 3GW4A 1G3TA 1TW3A 2KIFA 4LD5A 1BI0A 2XGOA 4R79A 4YVQC 3B73A 4G7ZF 2PQ8A 2C0MA 2CQKA 1RIOH 2J9QA 1D5VA 5D4SA 2HZTA 2MC3A 2XROA 2IT0A 4WNGA 3MEXA 1YW8A 1B89A 4QLCU 5LGTA 1J4OA 2KJCA 4A6DA 3POAA 1DDNA 3HRUA 4ASNA 4KXKB 2VXZA 2RNJA 3K1PA 1ZGAA 3ELKA 1ZRCA 3CVPA 1XSXA 4GYWA 3N97A 2NS0A 1WV3A 1T6SA 4UI9K 1YO5C 4GCOA 3WG9A 2G7HA 3E6MA 5DYMA 1ON1A 5H6QA 3J81Z 1LJ9A 2BGCA 5E8IA 5LEKA 2XGMA 4IRHA 2RKHA 1FCHA 2AFFA 1YG2A 2QBYB 4F3VA 3EDPA 4G7OF 4UNOA 2D1VA 3DQVC 5FFZA 1ZRDA 1WI9A 1XDUA 2XVCA 2M87A 4IHTA 3ASGA 2EV0A 3ML6A 4A1SA 1JGSA 2LF8A 1GXCA 1AOYA 1USSA 5BS6A 2PLYA 3MZYA 1ZRFA 4U7DA 2CW0F 3GFJA 2QZ8A 3ULQA 3GZ6A 2H09A 4M71A 3TGNA 1FHQA 1FYMA 3QKYA 3BROA 1CGPA 2JT1A 2QWWA 1G3SA 1QZZA 3SZTA 2F2EA 2PBIA 3FFLA 2CO5A 2PQRA 1KLXA 3PQKA 3F8NA 3P9KA 4LG0B 3IWFA 1J4QA 1S7OA 4GCVA 1CF7B 3L09A 2VGXB 3GZ1A 3RTRA 1FWZA 2XV4S 2UWMA 2H6BA 1FBUA 3IC7A 1BJAA 3HTUA 3P7NA 1L0OC 3RKXA 3KCCA 1FX7A 3CVLA 1S29A 4XIFA 5ICEA 3WE3A 4L5IA 2M45A 1F5TA 4RG6A 4WXDA 2DAOA 2B0LA 2JLBA 5A7DB 1WWXA 2ADUA 5CJ9A 3IWZA 4U0VA 2FBNA 2ESHA 5FO5A 4BT9A 3G73A 2V1DA 3LA7A 1K6OA 4RG9A 1YTYA 5LRRA 5HLGA 2OQRA 1R21A 1V4RA 4KBQA 2WPVA 3HOSA 3VTXA 5EEGA 1KT0A 2HDCA 2HYFA 1SD5A 1MDMA 4GYIA 3BJAA 5F1RA 2VBZA 2QQ9A 2HOEA 5K1YA 3IL2A 3PE4A 2XCBA 1RUNA 1KT1A 3IHUA 3ZQ7A 2BV6A 1O7FA 4BHPA 2HQRA 2D45A 4MEXF 3NF1A 2JPEA 4ZZDA 2V79A 3DXJF 3HUFA 3DKWA 4D9VA 4ZYHA 1MJ9A 1ODDA 3CVQA 3KEQA 3E97A 4GA0A 4A12A 3K9IA 2DT5A 5FZRA 3N71A 2GW1A 1MZBA 2G9WA 2CFXA 1VTNC 1B59A 3KZYA 3RPUA 4A0ZA 2PFBA 3K2ZA 2KIMA 2JQIA 5HI7A 5BPIA 3ABTA 1J5YA 4WWCA 4KYOB 2ESNA 5FZSA 1IXRC 4QWQA 3T5XA 2PQNA 2ZMEB 3SFZA 1TQIA 3CO7C 3TKYA 4CICA 4IPAA 3URZA 4LJZF 3I64A 4HDVA 4G1TA 5LRSA 1FYLA 3HHGA 4JQFA 3ZMVA 5A2QK 3DV8A 2HQNA 3DP7A 4Y6WA 1LGPA 3KLOA 4I9EA 4HF2A 2X4HA 4YG2F 3T8TA 3GVAA 5KJMA 1NHAA 1IYGA 1IHGA 2A6EF 2VODA 2V5FA 1QZYA 1ZREA 3ELSA 4CHUA 1D8KA 3DPLC 4A5NA 5LGNA 2NNYA 5FTPA 4UQZA 3QAHA 4KIFA 1FLIA 1I5ZA 1RUOA 1KU9A 1QZ2A 5E17F 2KIUA 4MGRA 2GXGA 5D8KB 3ECOA 3QPTA 2OQGA 3EETA 3WTSC 1H9GA 2ONDA 4UQYA 4G24A 1WRJA 4J8DA 3ZGQA 4RB3C 3RDIA 1ELWA 4XI0A 1LDDA 2ZNZA 1TNTA 4BXUA 4MQ9F 3HSRA 3L7WA 2OA4A 4RB2C 3T8RA 2Z3YA 3F21A 3UN0A 3Q9SA 4HF0A 4EMSA 3LY8A 3OXGA 4MNUA 3F8CA 4EJOA 4IRIA 1WQ2A 4AIKA 3WTUC 2W24A 4L0YB 2GA2A 4WCGA 1R22A 3IRQA 4GA1A 3CK9A 4B09A 2JTVA 2XRNA 1J4KA 2RN7A 3O2PE 1J9IA 4XI9A 2A07F 2G7UA 3GYHX 5K5QA 1XGSA 2K4JA 5F6FA 1WSUA 1HKTA 3ULQB 4LB5A 1P6RA 1T39A 2IFUA 4RB1A 2L3DA 4UI9C 2Z33A 2YU3A 2JPCA 5A2QZ 2E1NA 1G3YA 2V1UA 1Z7UA 4I09A 1K78A 2FQ3A 1J75A 3CUQC 1YS7A 3E5QA 2TDXA 3WTTC 1WAO1 3ZP5A 1RNLA 3EUHA 5E1ZB 3RO3A 1TJCA 2IA2A 2OOEA 1ZLJA 1YYVA 4HLXA 5D5XB 2F5DA 2KCVA 1WLNA 1LNWA 1PP7U 3JSPA 1MD0A 5CVUA 2EA4A 2E2EA 5KJKA 3CTAA 2P5LC 5HDNA 3MAJA 4P9FA 3Q5MA 1XD7A 1R36A 4LLGF 2VC1A 1XCBA 2IA0A 3U9GA 3F8MA 2HYZA 5ILVA 3RKWA 4YFNF 3PE3A 3U4TA 5H20A 1GHCA 5HVQC 3CK8A 1XDSA 3NEUA 2DO7A 1HSTA 2A5YB 2CGPA 4HQMA 3HOTA 3EYYA 3ZHEA 4PGGA 4R1HA 3FMQA 1MDMB 4M6XA 5ERIA 5EKQD 2BEOA 1KA8A 1OYWA 1IF1A 1HXIA 1NA3A 2YR2A 4JBAA 5DD4A 2KFUA 4LMYA 4FX4A 2DK5A 1PP8F 3CV0A 2PI0A 4BNCA 5BOXA 1ZBPA 3RJPA 5AONA 5J8FA 5E18F 4I7HA 2VE9A 2DQLA 4MTDA 5FZQA 3LY7A 2DPUA 1K2MA 4G9YA 3BPVA 2G1LA 4EQQA 3QOPA 2H6CA 3P9CA 2F5FA 3H92A 1K7AA 1YA0A 2OZUA 3J80K 1SMYF 5D6EA 3COAC 4I2OA 3ROUA 2M8EA 3FXQA 1G4DA 1STZA 4Q48A 1LQ1A 2FXAA 4HOQA 3Q47B 5EEHA 4UQXA 3OOPA 3U1DA 3REOA 1HW5A 3E6CC 5D6FA 4UI9J 2BE5F 3ERED 1FBSA 1W3BA 3GUDA 1KYWA 4N9HA 4L18B 1UHTA 2L02A 4N3BA 4G2VA 1BC8C 2PMHA 3WGGA 4RAYA 3JW4A 5DD8A 5DCMA 1Y0UA 1BIBA 4J8EA 3SHFA 4L9JA 2DTRA 2FMLA 2Y0MA 3LA2A 2VSYA 1FSHA 1TQPA 2DPDA 1S7AA 5J6XA 5HS8A 1O3QA 1B9NA 4H7YA 2R3SA 2M5WA 3I58A 4CDGA 1O3RA 2VN2A 1G6NA 2O8XA 2R7FA 1NA0A 2V6CA 3L00A 1LGQA 1FP1D 2LSOA 4HX8A 5D5VB 2XAHA 1T98A 4LK1F 2EH0A 1ZG3A 3LKUA 4HBLA 3LQRA 3LFKA 4NHJA 4BH9A 1HQCA 2Z9OA 1UFMA 3Q9VA 2DBBA 5JJ7A 4FT8A 1XGMA 4LFUA 2NNNA 5L3DA 2P5KA 4DNCA 1Q1HA 1XGOA 3F22A 2RDPA 5ILSA 1S8NA 4JA9A 2HS5A 1BBYA 1TBXA 1HW2A 3J80Z 1FZPB 3Q4AB 3AS5A 1UB9A 3EDTB 1YW7A 2GIVA 2EFQA 2EV5A 1ZN2A 3GFLA 3N4MA 4EJWA 5L3CA 5ICFA 4ENKA 5E50A 3KD7A 4RGRA 3WE2A 1TTYA 2WWYA 2XGSA 3GWZA 2GA1A 3R9AB 1FT9A 2KRFA 4HW0A 1QNTA 4WX9A 2ZBKA 3HIFA 2IPQX 2CG4A 3K0LA 3FXUA 4RGUA 1SFUA 4PGHA 1LEAA 1E17A 4HDUA 2FBIA 4YFXF 2C2LA 4EV0A 4KMUX 3SQNA 4WNDA 2A0TA 2JQLA 4HZFA 3CUQA 2RC4A 1P5QA 2M1BA 1FC3A 3QRFF 3K1NA 4HORA 4H0EA 3F6OA 1U2WA 2JZYA 1H0MA 1Z1DA 4EJTA 4AWXB 4G6DA 4ENMA 3JAMK 1MKMA 4HQEA 2Y75A 2Z99A 5BMZA 4M9XA 3RJVA 2GXBA 2MLGA 5E1XA 3ASDA 1LEBA 1OUVA 1ZHFA 5DV5A 2XCCA 2ZXJA 2JQJA 3HYMB 1YJ5C 2FOKA 3GFIA 4IN3B 3ZHEB 2EV6A 3RKVA 3WTVC 5JJ6A 4KN4X 1B4AA 1KYZA 1YW9A 1EV7A 2PJPA 4ESBA 2YX7A 1K3QA 4N2SA 2O61A 3WXXA 1HXDA 2DQRA 3GX4X 5DJOA 2Q0OA 5DUIA 2Q8KA 3R6SA 4YIIA 3S7DA 3SZ7A 2UY1A 2QQAA 5EX0A 1R58A 3TOAA 5L3GA 5LHIA 3DPTA 3T0YA 2DI3A 3W6KB 3BJOA 3VEPA 4KNYA 3O3KA 3UNNA 3QWVA 4KT5C 2DU9A 3BJ6A 2IP2A 3TAXA 5AYWD 3WTYC 3FF5A 4Y17A 2LKPA 3BEEA 4UVBA 2HFHA 4MTEA 1OMIA 3ELVA 3HRTA 4MEYF 1F1ZA 2FO7A 5L3FA 1ZGJA 1I27A 3M8FA 1EH7A 3MKRA 3Q15A 3JAMZ 3GQSA 4OU0A 3C18A 2CYYA 5HDKA 1HH8A 1SMTA 3E5UA 4IXAA 5G04C 4EGXA 2COMA 3GXOA 3UOTA 4U0YA 5IT3A 1B9MA 2DK8A 2P5VA 3JTHA 1I1GA 3MV3B 1J7KA 5DCMB 2W3OA 3EYIA 3BWGA 3LYAA 3ASFA 1I6XA 3L9FA 4HOUA 3TO7A 3HUEA 1SFXA 2XKOA 4I17A 4CZZA 1Z05A 4AIFA 4WXCA 3VPYA 5LBQA 3LSTA 2PIEA 3F3XA 2Y4TA 5ICGA 3RIRA 2XASA 3VB2A 4IHSA 5BNWA 3BY6A 4JL0A 3BOQA 3TQNA 4I0BA 1R5GA 3V7CA 4OMZA 1JHHA 4OIOF 2VQ2A 3J7AO 3P9IA 1KQ0A 3CEQA 1E96B 1KQ9A 1XGNA 2J5PA 1F9NA 2QENA 2FMYA 4O3MA 5KK1A 3WTXC 4HLYA 4LGWA 4HX4A 4J8FA 5G05C 4KICA 5CVRA 4CDRA 2A68F 3FM3A 2XEVA 2Y4UA 3WODF 5E8GA 1DP7P 1LDJA 4B8XA 2IRFG 5IT9K 3H3ZA 1K79A 3GYZA 4P55A 4XBFA 3FWVA 1K3JA 2A69F 4PCQA 1U78A 2XAQA 1FOKA 3KP3A 2K02A 4BT8A 2XGXA 1PDNC 4AIHA 2XKPA 4G6QA 3LQQA 5ED4A 1R00A 3QWWA 3HHHA 5F64A 3I59A 5KVRA 2Q7FA 4IJAA 3FXRA 3UPVA 1QGPA 3FZVA 4G2SA 3HSEA 1IXSB 3UQ3A 2H27A 5A6CA 3QP5A 3IEGA 3U3WA 3NRVA 2JSCA 4PDKA 3Q5FA 1H9TA 3CUQB 3KAEA 4KIGA 3HRSA 1EH6A 3LAJA 1KU2A 2VT2A 2XAFA 3M7GA 2AS5F 2WTEA 2QFCA 4BHCA 1FYKA 3VOEA 1D8JA 4Q47A 3HTSB 4UV9A 4S05A 4LLLA 4HOSA 2UWJG 3S7FA 3CLOA 2FF4A 4WXHA 4R8HA 1HKQA 3V8KA 1XB4A 2WC2A 1EH8A 1R7JA 2HYGD 3QPHA 4EGZA 1XNFA 2M30A 4P5OA 4ABNA 1QU5A 1IN8A 3KP4A 4E70A 2C0LA 1KU3A 2PEXA 4XSZF 4L5JA 1WM5A 2JPBA 5FT9A 1IZ1A 3OXFA 4MHGA 2OAZA 4O5VA 4AIJA 1ZG5A 2PG4A 5ILUA 1SAXA 3JYSA 4UXNA 3CDHA 5HLIA 4Y15A 3RPQA 1IRFA 1TLHB 4N39A 3GW2A 3F23A 3ZFWA 5K5OA 1QO0D 5DUKA 1XCVA 5E20A 1ELRA 3E4BA 1XSDA 5TJJA 4U0WA 3CVNA 2D2WA 4G25A 2UY1B 3RYRA 3K1MA 3S2WA 4LEUA 2QUFA 4Q4ZF 5DEQA 1S3JA 1A17A 4RB0A 5FLXK 1L3LA 4M6YA 2KKOA 3UMZA 3MZHA 2E7WA 3QDNA 1IRGA 5CVIA 4A0YA 3F6VA 2HTJA 1BN5A 3I53A 2L01A 2K86A 3S7JA 4XLNF 4U0SA 3SF4A 1HZ4A 2UXNA 3PQJA 3MDBA 3OV8A 1HSJA 4UVAA 3QWPA 2QQBA 3D0SA 3U2RA 5FD6A 4I98B 3LWFA 4OMYA 4HV6A 5DCFA 2QM3A 4GZ6A 2LF7A 3GEZA 4TV7A 4Y13A 4ZYDA 3KETA 2FA5A 3O6BB 3FM5A 2F5EA 1O3SA 4I0AA 4A5MA 1IW7F 1XSVA 2L54A 5LGUA 1ZH5A 3O48A 5EX3A 4F7ZA 2W57A 1S6LA 4PZJA 2NYXA 3ZMUA 4KDPA 4ZH4F 3DF8A 3TO9A 5CVJA 2Q2EA 1MJAA 4G26A 2FEZA 3PDNA 3E6DA 4N9IA 5LLQA 4U0ZA 3QOUA 2YQ8A 1IUYA 4M9ZA 1DMZA 1Z6RA 5JVTA 2EFWA 2LSUA 2XAJA 3MEKA 5A8IA 1DPRA 5J8CA 4BQAA 3CK7A 3ZMSA 1SD7A 4Z2YA 3GZ2A 3KP5A 3MCZA 5DIZA 2MA3A 2LSVA 2MBFA 2FSWA 1ZYRF 3OXLA 2XIGA 5CLSA 4L9VA 1R23A 3UV0A 3KP7A 4GZ3A 1HKSA 2VC0A 2KB3A 2CWEA 3L2CA 3CO6C 3VODA 2FNAA 1J4PA 5JI6A 5H6RA 5M72A 3KP2A 2KB4A 4JA7A 5FLXZ 4HAMA 1LB2A 2PL2A 5LHHA 5JR3A 2ZNYA 2ZMEA 3H3UA 4B94A 3LA3A 2D1HA 1PUEE 2FBHA 1ONVA 4UUVA 1BC7C 1BIAA 1FHRA 1OYIA 4ENJA 1W4MA 4UVCA 3M8EA 3KFWX 1O57A 4A2UA 2NAZA 1C0WA 1UJXA 1X3UA 1W5SA 4P9UA 4EM2A 2XT9B 1RI7A 3HUGA 3I59B 2HR2A 1O3TA 3MWMA 2JRTA 3PO8A 3IKVA 2DFIA 3AAFA 3R0AA 2ZKZA 5D4RA 3MV2B 4NQ0A 2RVCA 3BZ6A 4I1AA 4WNEA 4EVIA 2BYVE 1QQIA 1U5TC 2IA1A 3V7RA 4I02A 1B6AA 4N0BA 2HTSA 2P7CB 2HO1A 4EM0B 2V9VA 3GO5A 2NRAC 4AY5A 5ARGA 3TOBA 1SFEA 3V8LA 4JK1X 1XN7A 3MQ0A 4KYWA 3B02A 3MFKA 2LC1A 1JE8A 5BQTA 1K78B 5D0OD 3FM8A 5CYVA 2KATA 2DBAA 4XRFA 3ZMDA 3ISPA 2RQPA 1J4LA 2H94A 3I5UA 4CGZA 1J59A 1T0FA 1U6GA 1MGTA 4S04A 5LEJA 5BW8C 3VTYA 2O6GE 2ACJA 4BWRA 5D5WB 1ZG1A 1E2XA 1HW1A 2VGYA 1GVJA 3QU6A 2K7LA 2I6HA 1HBXG 4EJQA 4KFCA 2ETHA 4G7HF 2ZCWA 2XUBA 1ZAOA 4RS8A 4OIPF 2VOPA 4U04A 2QYOA 2KC7A 3RO2A 1SD6A 1XMAA 3AS4A 5CCLA 4N3AA 1FBQA 1Z6TA 4GA2A 3V7SA 1IAWA 3QP6A 4ZZLA 4YVOA 2MH2A 3BDDA 4L9TA 3BPXA 3LY9A 4BTAA 1P4XA 2IW5A 4I01A 5CCMA 4IF4A 4GGGA 4Q5SF 3C7JA 2YSRA 4OINF 3VA4A 1G3WA 1ULYA 1OYYA 2WV0A 3CJNA 3T1BA 3ZN3A 4G23A 2W84A 2OU2A 1UCRA 3VFZA 4OIRF 3I6WA 3D5LA 4ZYGA 5FFXA 1KQ8A 4O6FA 5KJLA 3ZPJA 4BAYA 4WK8F 4DQ2A 1UHMA 2EK5A 4ENNA 1ZARA 1F4KA 3F72A 4ETSA 4KA4A 1DUXC 3QU3A 1KU7A 2FRHA 1BI3A 3E3VA 3AS8A 3RI4A 3R60A 3KEOA 2R5SA 4I2ZA 2KCKA 4EJVA 1OR7A 4YFKF 4L9NA 4ESFA 2QLZA 1NZNA 3I71A 2L6JA 4RGSA 1PC2A 2WQHA 2P58C 4CYDA 2VOOA 2OBPA 2FE3A 4CXFA 2STWA 2PMUA 2FI7A 4ZYEA 4U07A 1TW2A 2BRFA 1ON2A 2P6TA 3FX3A 4GO1A 3GZ5A 4ESJA 1OKRA 2EJRA 1QQEA 5D5UB 4APOA 4H7XA 1USTA 1I1SA 1QPMA 4M73A 3HRMA 2CSWA 3DEUA 1JHFA 4HF1A 3ZMZA 2P8TA 1YS6A 5FGMA 4YNDA 3IKTA 2IVMA 3VA1A 4MQVA 1P4AA 3ABUA 2EFPA 3C1DA 2PZIA 4I9CA 3I54A 1AWCA 3UUXA 2RGVA 2UXXA 1IN6A 4YIFA 1D3YA 1ZLKA 3R61A 3TDUC 3G3ZA 3K9TA 4JONA 3HYIA 2EA2A 5HLHA 3WU1B 1GXPA 3M1EA 3ASHA 4U88A 2E7XA 4OIQF 2MLKA 4KN7X 4FHTA 2LNIA 3KZZA 4EGYA 3TDZC 1JXSA 2OZ6A 1QBJA 1V3FA 3R4KA 2HR3A 3HSFA 1J0RA 2O03A 4H87A 5L3EA 2FBKA 1BI1A 5JHUA 1P4WA 3NQOA 3Q49B 4I2WA 2LDUA 5ARFA 2HGCA 4KIBA 2MHKA 3I4PA 1BM9A 4N2QA 2HKOA 2P6SA 2A3SA 5HOOA 4KUMA 1W7PA 4UV8A 2HEOA 1YLFA 1U5TA 3RYPA 3MA5A 5K5RA 2ISZA 4A0XA 3TGOA 2KKLA 2F5CA 1IN5A 4HX7A 1R1TA 4KMFA 3UNMA 1FPQA 4W9RA 5BPDA 3FMSA 4EQFA 2Z5UA 4BTBA 4GPKA 4EJUA 4O6JA 2ELHA 4AY6A 5HDGA 5BT1A 2MD5A 1YJMA 2HKXA 4U7BA 2XHKA 1MJBA 1UHWA 3JTGA 3DFGA 2KJBA 5CVVA 1DPUA 3CUOA 5CHEE 1SD4A 3ECHA 4LB6B 1KGSA 2EFNA 4AVPA 1R1VA 2E1CA 3FHZA 2HWVA 1K3NA 5G04J 3RU0A 4A0EA 4FX0A 1FY7A 2VSNA 1R1UA 3FWEA 1W7PD 1OPCA 2XAGA 2BUGA 2UZKA 5LCWC 5D8LB 4P96A 4G8XA 4D0PA 4A6EA 3I0MA 3CKCA 5FB2A 2QBYA 4HYEA 3EQLF 1P2FA 2NC9A 4L0ZB 4HV5A 2FU4A 2MH9A 4GZ5A 2V1XA 3W6JB 4J0UA 4GYYA 2RV8A 4WNFA 3BP8A 2OD5A 3V8JA 2EB7A 4G94A 1A04A 3LAPA 2CSOA 5E1WA 1YFHA 4UHTA 1Y8MA 1WKMA 3SZPA 1TNSA 2VONA 3WU0A 1W5TA 5IT9Z 5AIPA 4IRGA 1LDKB 3WTZA 2ZFWA 5DDGA 4QCJA 1K2NA 6PAXA 2X0LA 3JSOA 2GQQA 2W25A 4LG0A 2VT3A 1XMKA 2DLLA 1CF7A 5G05J 3M9AA 2O0YA 2VGXA 1FP2A 2YHCA 4GXOA 3RKYA 1O7LA 4IVNA 4RGXA 1ZU2A 3I0TA 2L4MA 2YX4A 4CGVA 2LNBA 4HOBA 4N3CA 3WGHA 4N5CA 2AXLA 2VYIA 3K69A 1U8RA 4AD9A 2PN6A
chains in the Genus database with same CATH superfamily
3TG5A 2FX0A 1LVAA 1JKOC 3KT9A 3FP3A 1H2TC 4BACA 3RIBA 2OV7A 3HKZN 2CHWA 2LFBA 3I6UA 2AHQA 1RZ4A 4EM1A 3KP6A 2HOTA 3K70C 1T38A 3QODA 4E85A 2ISYA 1B1BA 1LD8A 1MZKA 2ZJ2A 3KEZA 1G6GA 4WF2A 2JKDA 2X3MA 3TG4A 3GFMA 3VDXA 1HE8A 3H5RA 3D9PA 3LCAA 2X48A 4NRHB 1IN4A 4OVUA 1U3EM 5JJTA 3ZPLA 1OCOE 1T95A 2L7FP 4HG2A 4CO8A 4D7NA 2FUG2 3DTEA 4AP2A 2DDBA 4ON0A 3KYLA 2IF4A 2VBYA 5LX8A 1MW7A 2QVOA 3BG3A 3CCVI 2WADA 2W85A 2EWNA 2L4AA 4II3A 3CKBA 3F8BA 5ENTD 4NURA 4AUXA 1Z77A 2R7DA 4GDFA 1G3GA 5D2MC 3FISA 4NB5A 2R4GA 2WQ7A 2GZWA 4JC8A 2RG8A 5D0QD 3H5AA 4GCNA 1J2XA 3DEEA 1JTXA 3HX1A 3WTWC 2J5OA 1A31A 1MQSA 2DZNA 5TRDA 3FMRA 4RLFA 4LLNA 3ZVVA 1S70B 3CHQA 5HRYA 2W7NA 3IRRA 1N4RA 3S3MA 2O3FA 4CZCA 2CH0A 3SYTA 4XICA 5CEAA 1VNDA 5EZHA 3KS2A 4DI4A 1UG3A 4EZLA 2AVPA 2K27A 4A3VA 3I3NA 5BXOA 2XZTG 2K4BA 4UWLA 1FSEA 1JKPC 5DBKA 4CDMA 2ZO4A 4XRSA 4CCOA 3V4GA 2V9KA 1BI2A 5C1DA 2L9BA 2VE8A 2CJJA 4M74A 4RA2A 1RPWA 4M72A 4RM3A 3R0JA 4GU5A 3ZQFA 2XXSA 2DA5A 3ZMTA 4YDOA 4M9SA 4Y6CA 4K2EA 2VBWA 5EJCA 3C3WA 4J7WA 2I10A 1Z9CA 3BTIA 1JKQC 2ZC2A 4GYGA 4CCNA 3CHOA 2GWRA 1Y39A 3G2WA 3Q7FA 3TL5A 1U0TA 4WUYA 3GLXA 5LHGA 1Z91A 3OYKA 2WB2A 1APLC 4TRQA 4RAZA 4Q94A 1A35A 5HODA 3JUIA 4XSXF 5J47A 2YPRA 1ETVA 3KE2A 3QWLA 2R0QC 1REPC 2VBXA 3J81K 3VZCA 5LCWJ 2A61A 1T2KA 2EIJH 3F8FA 1IXCA 4DYRA 3JRCA 1AWCB 1FNNA 2B6CA 4GYOA 1YIOA 5BV1A 4BXXJ 2NVUB 2IJLA 3FXOA 3L16A 5EJHA 2D5VA 3KZIC 3QYFA 4BU2A 4Y7NJ 3PFIA 3ZN1A 1YQAA 4QPOA 3JRGA 2LD5A 4EZKA 5HS9A 2QGUA 3S8PA 3S7BA 1HLVA 2ICWG 4BHBA 3KLNA 5FD5A 1F36A 2Y0SA 2WM9A 3JREA 1TQMA 3HDXA 1BOAA 4ZDOA 1HFAA 2A6HF 1SVXA 3OYNA 3FTYA 4LK0F 3I0NA 2VKEA 3HOWJ 3S40A 5GPCA 5GAHJ 4C30A 4FTHA 2VJJA 4ME2A 4HA8A 4OOIA 2Y48A 4LOCA 3WGIA 2BBYA 2E2JJ 4BSZB 4CGWA 2CFOA 1IN7A 4D7MA 4JHRA 2CU7A 5FJYA 3MYVA 3MJWA 1A36A 5HQ8A 1BR2A 5AIQA 1HG5A 2KCLA 4U95D 4E6KG 4XLPF 3ONLA 5L3BA 1MBJA 5JFRA 4BYYA 2DA7A 3JCUC 1P92A 2IEJA 3TXNA 2Y0SN 3E7LA 3BR2A 3APDA 1HG2A 2LO6A 3H1CA 4ZHBA 3G1OA 4XNFA 2PNNA 1LUJB 3E6BA 1I3QJ 5HS7A 4HOTA 2EINE 3OUNA 2LMDA 3SZGA 4FULA 1MMSA 2MD0A 1Z0XA 2XPIA 2EFOA 2RD0A 2K85A 1W7PB 4U0UA 5CEDB 2R7UA 4DK5A 4ANXA 1BW6A 4C3HJ 5ICCA 3BZKA 1U5TB 4ANUA 3ZXPA 4AOFA 3ZEFA 1NTCA 1R5HA 2M34A 2OUMA 4NQWA 3TO6A 3SXYA 1EPUA 3LPZA 4L2LA 2P7VB 4A3BJ 3ESKA 3ZQHA 3RQIA 4RVBA 4C3JJ 2H1LA 4W97A 2C6YA 2STTA 5KJNA 2EIMH 2FNPA 2JMWA 1XPXA 3BR6A 4A3IJ 4NNJA 4XR6A 2GRMA 2DW4A 3JRIA 1GXQA 2E5NA 2P4WA 3E5XA 4IZZA 3GF2A 3ZN0A 2GAUA 2DIWA 3IH2A 3PL8A 1G3TA 2P9PG 3GW4A 1TW3A 4WWPA 2KIFA 4LD5A 1BI0A 4PK4A 4FCYA 2XGOA 4R79A 4YVQC 2K5CA 3B73A 2GBYA 4G7ZF 2PQ8A 2C0MA 2CHXA 5AQAA 2CQKA 1X58A 1RIOH 2J9QA 1ZK8A 1D5VA 2QSFX 4JP0A 5D4SA 2HZTA 4GTOA 2MC3A 4JX6A 2XROA 2ZISA 2IT0A 4IHXA 4BY1J 3MEXA 4WNGA 4DRXE 1D8EA 4XE0A 5G55A 1YW8A 1DNPA 1B89A 4L9PA 4QLCU 5LGTA 1ETWA 3HM5A 5EYPF 1J4OA 4FC8A 4BXFA 2KJCA 4A6DA 1JKRC 1DDNA 3CHSA 3HRUA 3ABLH 4ASNA 2VXZA 1X81A 4KXKB 2RNJA 3K1PA 1V55H 1ZGAA 2WAFA 2R7QA 3ELKA 1ZRCA 3CVPA 3FHNA 1XSXA 4ZDPA 4GYWA 2V26A 3V80A 3N97A 4UWGA 1HA8A 3ZQGA 2LG4A 2NS0A 1OWPA 4BDYA 5KBAA 2F4OB 2ELKA 3APFA 2V9PA 3PZ2A 3K4LA 3X2QE 3ABKH 1JUQA 1WV3A 1N11A 3CQCB 1T6SA 3LJNA 1YO5C 4UI9K 4GCOA 2HVQA 3G6EI 3WG9A 5ENQD 2LLKA 3L6AA 2G7HA 1IDYA 2LXLA 3PNLB 3DTIA 3E6MA 5DYMA 1B8IB 3CCMI 4B8AA 1ON1A 3BR3A 3JRHA 1S7EA 2I2BA 5H6QA 3IHYA 3J81Z 1LJ9A 2Y3AA 2BGCA 4CEMA 5C4VA 2P81A 5E8IA 2IS6A 2JJ7A 5LEKA 3GTPJ 1DVPA 2XGMA 4IRHA 2RKHA 1FCHA 3AG1E 2AFFA 4B0ZA 3LSJA 1K3ZD 1YG2A 3DBHB 2QBYB 4F3VA 1XTAA 3EDPA 4G7OF 4UNOA 2D1VA 2XPYA 3PZ4A 5EJGA 3DQVC 5FFZA 2L0TB 1ZRDA 3UM1A 3CF5F 2JABA 1XC5A 2VQLA 3NQPA 1WI9A 1XDUA 2XVCA 1DGWY 4A3DJ 1TYQG 2M87A 1DCQA 5JEJA 5ENPD 4IHTA 3ASGA 2EV0A 3ML6A 1D9SA 4A1SA 1JGSA 1TWFJ 2LF8A 1K8KG 5AQ9A 1GXCA 2NYJA 1AOYA 2LK2A 1GV2A 3UT7A 1USSA 2M7BA 5BS6A 4NC8A 2PLYA 3OYFA 1Y1WJ 3MZYA 3PVLA 1ZRFA 5ENRD 3Q0WA 4U7DA 3QARA 5T8IA 2CW0F 3GFJA 1X4OA 4XONA 4N5QA 1SA5A 2QZ8A 3ULQA 4CT4A 1OQYA 4MFDA 3GZ6A 2H09A 4G8LA 2GOXB 4M71A 3TGNA 2DMPA 2K3PA 1FHQA 1FYMA 3QKYA 3I4RB 3BROA 1CGPA 2JT1A 2QWWA 1G3SA 4N4NB 2M7AA 1QZZA 3SZTA 3TP0A 4DYCA 2ID6A 2F2EA 4B93B 1WH7A 2PBIA 3Q0UA 1OWLA 3FFLA 2CO5A 4F1SA 4BY6A 2PQRA 1KLXA 1IUFA 3PQKA 1UJJA 2AXZA 4U87A 3DSWA 5FINA 3GMJA 4I6GA 5IP7J 3F8NA 3E0JB 3P9KA 4LG0B 5FLVA 3EUHC 1HF0A 3IWFA 3SQVA 3UMVA 1J4QA 1S7OA 4GCVA 3L82A 4KMOA 2KLOA 4CSWA 2KPMA 3L09A 1AKHA 1CF7B 2VGXB 3GZ1A 3RTRA 1FWZA 2XV4S 2M63A 3PJRA 2GGFA 5JEMA 1LVKA 3LNQA 2UWMA 1SZAA 1ZR2A 4JYKA 2IY0C 3F6QA 2H6BA 2ZXHA 4E7SA 1FBUA 3IC7A 5DHRA 4CUGA 1BJAA 3HTUA 4HPQA 2Z1DA 1W0TA 2DFHA 3P7NA 1L0OC 3RKXA 5DM7F 4FJZA 4TXQA 3KCCA 1ETQA 4W1UA 5EGOB 1TN7A 2A5EA 2LR8A 1IG7A 1NL4A 2M0MA 3L08A 1FX7A 2R7RA 4AVZA 3CVLA 1S29A 2DA2A 4XIFA 1Q1VA 5ICEA 3WE3A 3PNVA 4L5IA 1Z0SA 3ZYLA 2M45A 5DHTA 4L7TA 4ZTJA 1F5TA 1NP7A 2NOGA 4WXDA 4RG6A 4XLHA 2DAOA 2B0LA 2JLBA 3TJPA 1TNOA 5A7DB 4ATGA 2IBDA 3VYSB 1WWXA 2ADUA 1T08B 5CJ9A 2LTPA 3IWZA 4U0VA 5LFAA 5DS9A 2ESHA 5FO5A 2FBNA 2I2DA 1JPLA 3OYLA 1UG0A 2CG3A 4BT9A 3G73A 1BI7B 2V1DA 3LA7A 1ETXA 2DYSH 2LBFB 1K6OA 4RG9A 1YTYA 4LUNU 5LRRA 4A55A 5HLGA 5EZGA 3FUFA 2P2CP 2OQRA 1A5EA 1R21A 1V4RA 5ITZF 1Y8RB 4XKCA 4XRMA 1Z7LA 5GAGJ 3FUIA 4KBQA 2EPFA 2WPVA 2EIJE 3HOSA 4CCJA 3V2OA 3VTXA 5EEGA 1KT0A 2HDCA 1MYOA 3SBTB 3TWUA 3UKUG 2HYFA 3W9GA 1SD5A 3MX3A 4F1PA 1MDMA 4GYIA 5E3MA 3BJAA 3MZ8A 5F1RA 1X1AA 2NS7A 4FQGA 2VBZA 2DJNA 3V8RA 2QQ9A 4DI3A 2HOEA 2CRGA 5K1YA 3IL2A 4F6RD 3PE4A 3CQGB 4QPQA 2XCBA 1RUNA 4XN3A 1KT1A 3IHUA 3ZQ7A 2BV6A 1O7FA 3PUFA 4BHPA 3CESA 2HQRA 5B66C 1WY6A 2HM8A 2LY9A 3L1PA 2D45A 3OSFA 4MEXF 3NF1A 2JPEA 1PYVA 3K10A 2V79A 1IRXA 3DXJF 3KYDB 4ZZDA 3QC1A 3HUFA 4XZ4A 3DKWA 4D9VA 5JHBA 4ZYHA 1MJ9A 2WXKA 1ODDA 3CVQA 3KEQA 3E97A 2ID3A 1HDDC 1LTXA 4GA0A 3FTWA 4A12A 3K9IA 2DT5A 3QAQA 4AEZC 4CZ2D 5FZRA 3GQSA 3N71A 3FKIJ 2GW1A 3R9MA 1MZBA 5B1AH 4JXTA 2G9WA 2CFXA 1DD1A 1VTNC 1JGGA 1MJSA 4U8VD 1B59A 3KZYA 3RPUA 4A0ZA 2PFBA 2X1CA 3AG2H 1Z67A 2LKSA 3K2ZA 2KIMA 2JQIA 2KBXA 5HI7A 2GRQB 3EUAA 3C2HA 4EECA 2BEDA 1V54H 3IV5A 2V4JC 1U2VG 3K70D 1JCQA 5BPIA 2GRRB 2H6IA 2E36A 3ABTA 2WXQA 3H9JA 3L2UA 3PUJA 4M3GA 4XX5A 1BR4A 2DA4A 1J5YA 5IYCJ 1HX8A 3C72A 4A93J 2EZHA 2BZTA 3MKQA 4WWCA 2ETCA 3J5PA 5EIBE 4KYOB 2ZXWH 2BKKB 3BLYA 2ESNA 3D5SC 4HSTA 3E32A 4U63A 4FADA 3TXMA 3FBNB 2WAQA 5FZSA 2O5RA 2F48A 1IXRC 2EIME 4IQ4A 3EUVA 2LOOA 4QWQA 3T5XA 2XSDC 2PQNA 1OCOH 1X1PA 2HXIA 3FTSA 2ZMEB 4FISA 3SFZA 3SDBA 1TQIA 3CO7C 4GFBA 4AJWA 2BONA 5BVIA 1WVRA 3TKYA 1BU9A 1K1BA 3UM0A 2CW7A 3DSUA 3RKQA 3PFYA 4CICA 1NI1A 4IPAA 3PZDA 3URZA 1WJFA 3M4OJ 1IV8A 4LJZF 2OF7A 3I64A 5F0CA 5LRSA 2UUZA 2KDZA 4HDVA 1FYLA 1SC7A 1SQMA 4G1TA 4HB5A 3HHGA 4JQFA 5G2NA 3ZMVA 5A2QK 3DV8A 3AFHA 2HQNA 3DP7A 4Y6WA 2WAQN 2CV0A 4J8SA 3KLOA 1D0ZA 1LGPA 4I9EA 3AFOA 2WQ6A 2CG2A 4HF2A 1MNEA 2X4HA 4JIWD 4YG2F 3MKLA 3T8TA 3ABLE 1FEXA 3GVAA 5KJMA 1V55E 2XZDG 1FOXA 5A23A 1NHAA 2DODA 3GTLJ 1IYGA 1IHGA 2A6EF 3DBSA 2VODA 4NQWB 1GT0C 3UIPC 1TC3C 2V5FA 3S1MJ 2CUFA 3RPUD 2OTLI 3ABKE 4PUCA 1QZYA 1ZREA 4ZYAA 5HS0A 4CHUA 3ELSA 1D8KA 2R7TA 3C2BA 3DPLC 2H6HA 4A5NA 2YHEA 5LGNA 4L5EA 2NNYA 3LXUX 3CQZJ 3VLEA 2DVWA 5FTPA 4UQZA 1I50J 3QAHA 4KIFA 4WAFA 1NG6A 3BG1B 2XDVA 3TWXA 2XB5A 4LIUA 3L2QA 2AW6A 3RRNB 2JA8J 2F4MB 3TWSA 1MBFA 2ZGDA 1FLIA 1I5ZA 4LNGA 1RUOA 1KU9A 5JHAA 1QZ2A 3H0DA 5E17F 2KIUA 4MGRA 2GXGA 1TEZA 2X6OA 3ASOH 2KM4A 5D8KB 3ULEG 3ECOA 2P9IG 1OLTA 3QPTA 2VKHA 2OQGA 3EETA 3WTSC 4B47A 5M3MJ 3QOEA 1YI2I 3G71I 1H9GA 5E79C 1W1WE 3PUBA 3D9JA 3H9QA 3SFIA 1N95A 2R59A 1Z0UA 4HNVA 5M5XJ 2ONDA 4UQYA 3GTGJ 2V5QC 4G24A 1WRJA 3S2HJ 4J8DA 3ZGQA 2WMNA 4RB3C 3RDIA 2XEHA 2ILRA 3DSXA 2WA0A 4LG6A 4C2TA 1ELWA 1K6YA 1E8WA 4MO7A 4XI0A 1LDDA 2Y2ZA 2ZNZA 1TNTA 4RAGA 1LF8A 4BXUA 4MQ9F 1VDYA 3HSRA 3L7WA 2OA4A 4RB2C 3DXKG 1V5GA 3T8RA 4GTQA 2Z3YA 5DHSA 3F21A 1U9NA 3DKYA 3Q9SA 3J7AY 2VTBA 3UN0A 4LSZE 1BL0A 4DOZA 4HF0A 4EMSA 2H1KA 3D9IA 2R2LA 3LY8A 3OXGA 4I6JA 4UB6C 4JVSA 4MNUA 3F8CA 4H4KC 1OWMA 1SA4A 1YJ5C 4EJOA 3G1MA 4IRIA 1WQ2A 1BI8B 2A5UA 4URKA 4HNAD 4AIKA 2KFDA 3WTUC 2W24A 1LE8B 4YDEA 5CPRB 3G2TA 1MX6A 4L0YB 3Q9UC 4GTTA 2GA2A 4WCGA 1R22A 2VASA 2HVSA 2GROB 3HEFA 3IRQA 2DMQA 4GA1A 3CK9A 4B09A 2JTVA 2I2FA 2QQ8A 1N75A 2XRNA 4XOTA 3M1CA 4I6ZA 1J4KA 2RN7A 3O2PE 1J9IA 1YCSB 1S0PA 4XI9A 2A07F 1Y56A 4XLAA 2G7UA 2XF7A 3K2AA 4GRIA 2AO9A 3LFUA 5K5QA 1SANA 3GYHX 3U21A 1XGSA 1MBEA 2DT7B 2K4JA 3BQZA 4NBQA 5F6FA 3LSGA 5KNLA 1WSUA 1HKTA 3ULQB 4LB5A 1N4PA 2Y0BG 1K61A 1P6RA 1EDUA 1T39A 3ZW3A 2IFUA 4RB1A 1TN6A 2L3DA 1ZB1A 3JRFA 4UI9C 2Z33A 2YU3A 2JPCA 5A2QZ 1ETOA 2E1NA 2X1DA 5EG0B 1G3YA 3UX4A 3PSFA 4AM9A 2V1UA 1PAQA 1Z7UA 4I09A 3GLLA 1VQ8I 1K78A 2DZOA 4RLYA 4UUCA 4TXRA 5TISC 2FQ3A 1J75A 4PDXA 3CUQC 3HGGA 1AKHB 2IO3C 3H5NA 3FU5A 1YS7A 3E5QA 5JLWA 2TDXA 3WTTC 1WAO1 3ZP5A 2WXJA 1T33A 2MOWA 1RNLA 2OEVA 4BESA 3EUHA 1H6OA 5E1ZB 1S9HA 5ANLA 3RO3A 3I5PA 1TJCA 3JXIA 2IA2A 2OOEA 1ZLJA 1YYVA 4HLXA 3ASNH 5D5XB 2F5DA 1WCMJ 2XF5A 2KCVA 2R5ZB 1WLNA 1LNWA 1PP7U 4JEHA 3JSPA 1MD0A 2L7KA 3DBLB 3UI2A 5CRUA 5J90A 5CVUA 2EA4A 4XLEA 1DU0A 1MZCA 1E7UA 2E2EA 5KJKA 2V8SE 4ITVA 3OYMA 2IS1A 3CTAA 3OS1A 2P5LC 5HDNA 3MAJA 4P9FA 2M8GX 3W2AA 1XD7A 1JT0A 3Q5MA 1R36A 2MC4A 4LLGF 1WGXA 1JI8A 2L5QA 1XCBA 2VC1A 3S3NA 3ZNGA 3BG6A 1E3PA 3CR3A 2IA0A 3KEAA 4KU0D 3U9GA 3F8MA 1HOMA 2EIKH 1FPPA 4CYCA 3KEYA 3OR1C 4CCLA 3B7UX 4DZJA 4IHVA 4DX6D 1YOVB 4KZ0A 2HYZA 3EU5A 1MSFC 4HRIA 5ILVA 3S1RJ 4EPZA 3OMYA 3RKWA 4YFNF 3PE3A 4IHYA 3CDLA 3OIOA 3U4TA 5H20A 5KWDA 3A77A 1GHCA 2GLOA 1SZ9A 2J09A 4K5BA 1VQMI 5HVQC 4BBSJ 3CK8A 5IY5E 4M6VA 1XDSA 1TZLA 4PUSA 3NEUA 1R4NB 2DO7A 2VJ4A 2VKDA 3O4ZA 1HSTA 4K0RA 3SNXA 2A5YB 3BQOA 3LSMA 2CGPA 5B1AE 4HQMA 4FLHA 3HOTA 3EYYA 1QA6A 4G12A 3ZHEA 1RW2A 5JERA 4PGGA 3DSVA 4R1HA 1I3AA 1M1EB 1DQUA 4F53A 3FMQA 1MDMB 3V8MA 4BQOA 3S16J 4M6XA 4IYPA 5ERIA 1V54E 3FHEA 5EKQD 3PNTA 2BEOA 1KA8A 1OYWA 4UB8C 3WG7H 1IF1A 4FA6A 1D5YA 1HXIA 2J08A 2VB6A 1NA3A 4LERA 3FEYA 1Z21A 2OPTA 2YR2A 2ZXWE 4TUUA 4JBAA 3O8HA 5DD4A 4U7EB 4ANVA 4BL0B 1ZR4A 2KFUA 4LMYA 4FX4A 2R7SA 1UN9A 5CBOA 2WXLA 2DK5A 2Q5FA 2JA2A 3I4GA 1PP8F 3CV0A 2PI0A 2R92J 4BNCA 1FTZA 1DP3A 3PNYA 5BOXA 1ZBPA 3RJPA 2TRTA 5AONA 5J8FA 2PJRA 3OSGA 4AC0A 5AJDA 5E18F 4I7HA 3VYUB 3ML9A 2BW3B 4U96D 2VE9A 2HU9A 2DQLA 4PJNA 2WY8Q 4XOPA 4MTDA 2BKGA 5FZQA 3LY7A 2DPUA 1K2MA 4G9YA 3T8MA 1FMWA 2KRCA 3BPVA 3OS2A 2G1LA 4EQQA 3HIZA 3QOPA 2PX9A 2RFAA 2H6CA 3P9CA 2F5FA 1YE9A 2CUZA 3ESLA 3MKQB 3H92A 4GAAA 4A3FJ 3J7YJ 1K7AA 1SFOJ 1YA0A 2OZUA 3J80K 4BY7J 4BJ5C 1G2HA 5LP0A 3HOYJ 1SMYF 5D6EA 3COAC 4I2OA 3ROUA 2M8EA 2I2CA 3FXQA 1G4DA 1STZA 4Q48A 3SEZA 4MLPA 2JSPA 1FT1A 1XGWA 4HEA2 1LQ1A 4OVVA 3EU9A 1UN8A 4D5CA 2FXAA 1H19A 4HOQA 3Q47B 3VLFA 2QKMB 2WXRA 4OAYA 5EEHA 4UQXA 3OOPA 3U1DA 3REOA 1HW5A 3E6CC 5D6FA 4UI9J 3AG3H 4BUPA 2ME0A 3LSRA 5AAOA 2CQ7A 5B5EC 2BE5F 3ERED 3V42A 3AKZA 1FBSA 2W4SA 3ASOE 3DPYA 3HVEA 1WG0A 1YT5A 1W3BA 3GUDA 2IGKA 2FQ4A 1B72A 3EIJA 1KYWA 3PSIA 1KZPA 4EBAA 2IQCA 1RESA 4N9HA 4L18B 2ECCA 3I9V2 3PIOF 1UHTA 2L02A 1VI0A 3UR3C 3FU3A 4N3BA 4Y3OA 4G8KA 1KZOA 4G2VA 1BC8C 3F0CA 2PMHA 3HXEA 3WGGA 4RAYA 4A3LJ 3JW4A 3MZLB 2MSYA 5DD8A 4BBRJ 2X6WA 1GVDA 1RETA 1BIBA 1Y0UA 5DCMA 1TNZA 1U0RA 5J1YA 2LXMA 4CCAA 4J8EA 3SHFA 2WB1A 4L9JA 2DTRA 2FMLA 2Y0MA 3LA2A 3FUJA 2VSYA 4BEPA 3IBEA 1WJBA 1TT0A 4LCTA 3PFNA 4KJZA 3CVUA 1DEVA 1WFXA 1FSHA 1J09A 1TQPA 2DPDA 3DU5A 4E7HA 3OWTA 1S7AA 5J6XA 5HS8A 2BY3A 3CMYA 1B9NA 1O3QA 2DT6A 4E7ZA 1U3DA 5CQEA 3HL2A 2J4BA 2L0IA 4H7YA 3CVWA 4DX2A 2HYJA 2R3SA 2M5WA 3I58A 4CDGA 1D1CA 3CC7I 5M5YJ 1O3RA 2VN2A 3TWWA 2JVGA 3E30A 4KISA 2R5YB 3DSHA 2WB1N 1G6NA 2VKVA 4BDZA 5FKMA 1SAUA 2O8XA 4RLQA 3F9KA 2R7FA 4DYQA 2V6CA 3L00A 1NA0A 1LGQA 1FP1D 1FIPA 2LSOA 4HX8A 5D5VB 2XAHA 1OJLA 3BU8A 2KZVA 4QTRA 1T98A 3ZUVB 2CQNA 4LK1F 1N4QA 3FTXA 3O8GA 1KHXA 1ZG3A 3LKUA 2EH0A 4P1WA 4HBLA 4G6TB 1W36C 3CHRA 2J4DA 3LOCA 3LQRA 4GTVA 3LFKA 5GADJ 4BH9A 1VQLI 4NHJA 3S2AA 4NC6A 3AU4A 1HQCA 2Z9OA 3DRAA 1UFMA 3Q9VA 5FIOA 2DBBA 5JJ7A 2JA6J 5F0HA 3HXCA 4YEJA 3CZ6A 4I43A 3ZKJA 3GTJJ 4FT8A 1XGMA 3J7ZI 4LFUA 2NNNA 5T4YA 5L3DA 1VFCA 5JEOA 2P5KA 1TT5B 4DNCA 2VLAA 4D10C 1Q1HA 1XGOA 3F22A 3GZNB 4BETA 1OCRH 2I29A 2AXTC 3DXMG 5ANRA 2RDPA 5ILSA 1S8NA 4JA9A 4MBGA 2HS5A 3CC4I 4KT6A 1K4SA 4M3FA 4PS8A 1BBYA 1TBXA 4RAFA 5LOZA 1HW2A 3J80Z 2AXUA 3SO8A 1FZPB 3Q4AB 3QJZA 3S17J 4M3EA 2QZAA 4UY8I 1UB9A 3AS5A 3EDTB 1YW7A 1R9TJ 3FXJA 2GIVA 1P7JA 2NXNB 2EFQA 2EV5A 2VSXE 3Q78A 4XLFA 4BE0A 1ZN2A 3GFLA 4IO9F 3N4MA 1E0EA 3ASNE 4EJWA 5L3CA 4C0EA 5ICFA 4ENKA 5E50A 3OIPA 3KD7A 1ORKA 3VYRB 4RGRA 5JMND 3ERMA 3WE2A 1TTYA 2WWYA 2XGSA 2JUCA 1IQUA 2EH3A 3ZQIA 3SBSA 1YIJI 2NXPA 2WXHA 3GWZA 2GA1A 3R9AB 1FT9A 2KRFA 4HW0A 1MMAA 2COBA 2V7FA 1QNTA 5B3SH 2ZBKA 4WX9A 1V5FA 2ZXIA 4S0HB 2EIKE 2LAHA 3JXJA 3HIFA 3MKYB 2IPQX 3B7TA 2CG4A 1BR1A 3OOUA 1EF4A 2KZTB 3K0LA 3FXUA 4RGUA 3FTVA 5E3LA 1SFUA 4PGHA 3HXFA 4FJYA 3Q79A 1LEAA 1E17A 4BFRA 4HDUA 2GRNB 1QNFA 2FBIA 4DX7D 4B1RA 4YFXF 4EV0A 2C2LA 3V2XA 4KMUX 3SQNA 4WNDA 2A0TA 1BOBA 1JUMA 2XB0X 2JQLA 2HDDA 4A63B 4GMLA 4K03A 1JUSA 1HU3A 1Y1VJ 4HZFA 3OYBA 3CUQA 2RC4A 1P5QA 1U0JA 2M1BA 2QV7A 1FC3A 3QRFF 3K1NA 3K4BA 4H0EA 1E7VA 3F6OA 1U2WA 4QIWN 2JZYA 1H0MA 4HORA 1VZ0A 1Z1DA 4EJTA 4AWXB 4G6DA 4ENMA 2AJAA 4B89A 3JAMK 2QCOA 4UUSA 2CFUA 1MKMA 2XS8A 4HQEA 2Y75A 2Z99A 3H9GA 5BMZA 4M9XA 3NAUA 3FUHA 3WG7E 1DU6A 3RJVA 2GXBA 5C4XJ 3K4JA 1TJFA 2MLGA 2XGEA 5E1XA 2F6CA 5FKLA 4BEHA 3CCYA 1QWTA 5GPAA 4L23A 2Y30A 1VQPI 3LVQE 2WXFA 2LY1A 3VSKA 3D9KA 4RMNA 4XMYA 3JRAA 1O4XA 3ASDA 1WH5A 2RREA 4DIQA 1FVFA 1LEBA 2V1NA 4HS2A 1OUVA 1ZHFA 5DV5A 2XCCA 2ZXJA 1I6HJ 1N9AA 2EZKA 2KT0A 2VI6A 4IHWA 1OXJA 3HYMB 5EYLA 1IGNA 3QB2A 5BV0A 2FOKA 2MABA 3E1SA 1R71A 4AU7A 3CVXA 3U64A 4LNBA 3GFIA 4DY6A 4XN0A 2X6FA 4IN3B 3ZHEB 2EV6A 3RKVA 3WTVC 4A4YA 1EYHA 1T56A 2K9LA 5EDNA 4KN4X 1B4AA 1KYZA 5JJ6A 1YW9A 2VPLA 1EV7A 2PJPA 1YITI 1L5JA 4QQIA 2N8GA 4ESBA 3CJTB 3M8JA 2YX7A 3PNTB 1K3QA 4N2SA 1JUPA 1Z0ZA 1R6RA 2FD5A 1VQKI 2O61A 5FKKA 4G11A 3WXXA 4F55A 1HXDA 2DQRA 2JQ7A 4I1OB 1YJNI 1PVEA 2P0WA 2AWIA 5KAFC 2WBMA 3GX4X 5DJOA 2XF6A 2Q0OA 3OY9A 2L9NA 5DUIA 1UOHA 3K4MA 4GPMA 4JPSA 3D3MA 4Y52J 2Q8KA 3UINC 4I76A 3R6SA 3VPRA 4ANJA 4YIIA 4XK4A 3S7DA 3SZ7A 5DM6F 2PMZA 3ZXSA 3FDHA 3ZYMA 2UY1A 2QQAA 3IXEA 5EX0A 3AAAC 4HQDA 4CCMA 3HJEA 1MIJA 1K4TA 2OVBA 2PJRB 2OCCE 1R58A 3AG3E 5J40A 4HRMB 4GB9A 4F93B 3G2UA 3N05A 2Y69H 2KHMA 3EHNA 3RRUA 4IL6C 3TOAA 5L3GA 3EIQC 2KISA 3DPTA 5LHIA 3GBGA 3A03A 1KZHA 3T0YA 2IOLA 3FEXA 2E1MC 2DI3A 4M3OA 5JELA 3W6KB 3G4SI 4A3TA 3BJOA 3VEPA 2PMZN 4KNYA 1U7FA 3O3KA 2PM6A 3UNNA 2XPVA 3QWVA 3PO3J 4KT5C 5E76A 2DU9A 5EYRA 2LVSA 3BJ6A 4XM3A 1AP7A 2IP2A 3TAXA 5AYWD 2LREA 4ANWA 4E7KA 3NZUA 3A1YA 2QC9A 3WTYC 2H6GA 3FF5A 4Y17A 3I4MJ 3ZOBA 1GUUA 2LKPA 2ZJQF 1E90A 1MNDA 3BEEA 1Y3HA 3OR2C 4UVBA 5IY5H 2HFHA 1QYMA 3HB9A 4MTEA 1OMIA 3ELVA 4KZCA 3HRTA 4MEYF 1N78A 2P9UG 1MH3A 4DZPA 3V7WA 4Y33A 5FKNA 1F1ZA 3C5RA 1R4MB 2FO7A 3HBLA 1RR8C 5L3FA 3H35A 5FRMA 2XPZA 3S2DJ 1HS6A 1ZGJA 1I27A 2GXAA 3FUDA 5IPAA 3M8FA 4NACA 1MNMC 1EH7A 4BQNA 1Y8QB 2XENA 3MKRA 3TP3A 4AYBA 3JAMZ 4OU0A 1XG1A 3Q15A 4L1BA 1TNYA 2L9SA 3C18A 1MJ0A 3HVEB 3CC2I 2KP6A 3UTMA 3G2BA 2F0YA 2E5ZA 4BKXA 3S93A 1EA3A 1B72B 2CYYA 4DUIA 1DC2A 3NWSA 5HDKA 1SMTA 2IEKA 3E5UA 4IXAA 1HH8A 5G04C 2E35A 2XPWA 3BG9A 2COMA 3GXOA 2QY7A 3UOTA 1Y6IA 1IXVA 3IV0A 4U0YA 5IT3A 1X1CA 4WWOA 4AV7A 1B9MA 2DK8A 2BVMA 2P5VA 3JTHA 3OIQA 2ETAA 4HSRA 2R02A 3ABME 3PS6A 2I2AA 1I1GA 5B1BH 4DW6A 1DCEA 3MV3B 1J7KA 2BOLA 2F4IA 5DCMB 2W3OA 4YDWA 3EYIA 3BWGA 2MYOA 3WHBA 1YHQI 1BPOA 3LYAA 3HHMA 5K7FA 3ASFA 4AYBN 1I6XA 1MX4A 1U3CA 5HNFA 2W1OA 3L9FA 3OTNA 4HOUA 3IH3A 3TO7A 1SFXA 2XKOA 3AL0C 2PM7A 4I17A 4A1GA 3HUEA 4CZZA 2B63J 1Z05A 4AIFA 4WXCA 2MRIA 2JQJA 2R05A 1G8XA 1UMQA 3CDIA 3DKXA 3LSTA 5LBQA 4DX5D 3VPYA 2PIEA 3OL4A 3F3XA 2EBIA 2RFMA 2Y4TA 5ICGA 3RIRA 2YU9J 3PEVB 3V8QA 1O1RA 2MW8A 2XASA 2R93J 4I6EA 1H2VC 1EJ9A 3C3RA 5HNHA 1OCRE 3VB2A 4IHSA 2E71A 3VSLA 5J1RA 3UXGA 5CECB 1S5LC 3UKRG 2A6TA 3KPHA 5BNWA 3U66A 3BY6A 1TNBA 4JL0A 2ZSHB 3BOQA 3RSEG 3CSFA 3TQNA 4ACKA 1RR7A 4I0BA 1OWOA 3FH7A 1R5GA 1POGA 3LSIA 4OMZA 3V7CA 2YS9A 4LRZA 1JHHA 4B3AA 4OIOF 2VQ2A 3J7AO 3P9IA 1UHSA 1KQ0A 3CEQA 4YIRX 1E96B 1KQ9A 5E75A 2CQXA 2MG4A 4ILGA 3TWVA 1XGNA 2IXSA 2J5PA 1FT2A 1F9NA 2QENA 2JUGA 2EILH 3CMEI 2FMYA 2BF0X 3TW6A 5K7ZA 4O3MA 2EZIA 2DOEA 2ZMEC 3CCLI 3LSPA 3I55I 5KK1A 3WTXC 3JR9A 2CV2A 4HLYA 4P29A 1FOWA 2WXNA 4LGWA 4NC7A 1ZKGA 4JZYA 4HX4A 3ZRHA 4J8FA 5G05C 5B3SE 4KICA 2X1EA 5CVRA 4V3IA 4FHKA 5GP9A 4CDRA 4IKFA 3K6GA 1BD8A 2A68F 3FM3A 2XEVA 2Y4UA 3WODF 5E8GA 3QYBA 1DP7P 3TWQA 2ZIRA 5CRVA 5FJ8J 1LDJA 2ZFUA 1JTYA 2BXYA 3CJRB 3ESWB 5CKTA 4B8XA 3CCSI 2IRFG 3H3ZA 3BQYA 5IT9K 3P5JA 1K79A 3GYZA 1OISA 4P55A 4XBFA 4RDUA 4A3CJ 3FWVA 3L22A 4APFA 5FROA 1K3JA 2A69F 4PCQA 1O5MA 1U78A 3PREA 2XAQA 1FOKA 3APCA 3KP3A 2GRPB 3L54A 2K02A 2R17C 4BT8A 2XGXA 4RQIA 4XKBA 1PDNC 3V31A 4AIHA 2XKPA 4ABZA 3MN2A 4G6QA 2V0PA 3LQQA 3G1LA 4C9YA 5ED4A 3POAA 1U8BA 2QYUA 2X6XA 4II2A 3QPLA 1R00A 3QWWA 3HHHA 3MMYB 5F64A 3I59A 4LG3A 5KVRA 2Q7FA 4C2UA 1SW6A 3FXKA 4IJAA 3JUEA 3VYTB 1MMDA 4V2FA 1G88A 1TNUA 3FXRA 1ETKA 3UPVA 3ZQQA 2BY1A 3K4CA 2UV1A 1QGPA 3I3LA 3CHMA 3FZVA 4G2SA 4OAUC 1TP4A 3LJ3A 3ZCOA 2MYSA 2EQRA 3HSEA 3MKWB 5DHQA 3K4NA 4PSWA 3WU2C 1IXSB 4B43A 3OYHA 2E0IA 2AQEA 2BY2A 3UQ3A 2H27A 1SVLA 5A6CA 2HXOA 3QP5A 3IEGA 4JHKA 3U3WA 3NRVA 1W36D 3S1QJ 9ANTA 2JSCA 3J5QB 2ZSIB 4PDKA 4QSHA 3Q5FA 1H9TA 5FRNA 2I9CA 3CUQB 2M4KA 3RCOA 3DTKA 3HRSA 4KIGA 3KAEA 1N77A 1A6QA 1H8AC 4FLBA 1EH6A 2DYRH 4PFPA 3LAJA 1KU2A 2LC2A 2VT2A 1NFIE 2VJ5A 2XAFA 3M7GA 5DTDA 2WTEA 2AS5F 1Z5SC 2NVYJ 2QFCA 3IHVA 4A69C 4BHCA 4AXHA 1FYKA 2XSJC 3DLLF 1N54A 4HRLA 3VOEA 1VQNI 4ZJZA 1TN8A 4UUSB 4Q47A 3HTSB 1D8JA 4UV9A 4JB8P 4C0MA 1ETYA 5KAIC 4D5FA 4S05A 4LLLA 3C2GA 2UWJG 3S7FA 2E1OA 3CLOA 4MLOA 1G59A 4HOSA 2FF4A 4WXHA 2M3AA 1HKQA 4R8HA 3V8KA 1BA5A 4BEHB 5C3EJ 1GW6A 1XB4A 2L9RA 2WC2A 5J4YA 3GMEA 1EH8A 5F04A 2JGRA 3DBRB 4YDYA 1R7JA 2HYGD 3QPHA 4EGZA 3HGYA 1VQ4I 3IUOA 4DGWB 1XS9A 2IOSA 3PUKA 1MMGA 2M4GA 2R7WA 1XNFA 2M30A 3E37A 4P5OA 2AQFA 2VQCA 2FULA 4ABNA 3IKOB 3NAWA 1QU5A 3M07A 1LFUP 3CGHA 1IN8A 2W82A 3CD6I 2X6IA 1IJWC 3KP4A 4E70A 2C0LA 2K3FA 3CCRI 1KU3A 2Z2SB 1T0FC 3ZGKA 2K40A 5H7PA 4F7AA 2PEXA 4XSZF 5AIJA 2Y9ZA 3TWRA 1INZA 4L5JA 1WM5A 4CT0A 2JPBA 5FT9A 2X6JA 1IZ1A 2QYJA 3OYCA 3OXFA 1ZOQA 2Y69E 4MHGA 1X1BA 2OAZA 2CHZA 3D9MA 4O5VA 4C9BB 3CIAA 2F5VA 3D9LA 4AIJA 1ZG5A 4E7IA 2PG4A 5ILUA 1SAXA 3JYSA 4UXNA 1EF1C 4Q96A 3CDHA 5HLIA 3GTMJ 4J01A 5M5WJ 3KYCB 4Y15A 3RPQA 1GDTA 1IRFA 3Q75A 1TLHB 4N39A 3GW2A 3F23A 1YJWI 4ATZD 3ZFWA 5K5OA 2DXIA 3EHQA 5F0FA 3UIOC 1QO0D 3OYEA 5DUKA 1XCVA 5E20A 3D9HA 5CMYA 5CERB 3V30A 1ELRA 2BXZA 3E4BA 5JVGF 5TJJA 2HQAA 1XSDA 1D0XA 4U0WA 1YX3A 3T5PA 3G2SA 1HO8A 1SFKA 2D2WA 3CVNA 3E33A 4G25A 2IU1A 2E2IJ 2UY1B 4EZJA 3RYRA 3K1MA 2DA6A 3S2WA 2HE0A 4LEUA 3L13A 2QUFA 4Q4ZF 1QVTA 3GCMA 3QQAA 1UW4B 5DEQA 1JWFA 1S3JA 3S32A 1A17A 5GAEJ 4RB0A 4NDLA 4A3GJ 2JVHA 5FQ4A 5FLXK 1L3LA 1IDZA 4M6YA 2QF7A 2OVFA 2KKOA 4TV3A 5CMWA 3MZHA 1KHUA 1WJCA 2E7WA 3SDGA 3KX2A 3UMZA 3QDNA 2G0EA 1IRGA 3FUMA 5CVIA 1T8IA 4A0YA 3F6VA 2HTJA 5IP6A 1BN5A 3RQ4A 3I53A 1Y3IA 4AIDA 4FETA 2L01A 4E7JA 2K86A 3NWTA 1OFCX 3R7RA 4E7LA 3BR5A 1F43A 1ELKA 3S7JA 4XLNF 4U0SA 3SF4A 1HZ4A 4JD2G 1D8DA 3IAM2 2UXNA 4FP7A 5BUZA 3PQJA 4IEJA 4HBDA 2WXGA 1PJRA 3MDBA 3OV8A 1HSJA 4UVAA 3DWLG 2X6HA 3QWPA 3ZR8X 2XGDA 2QQBA 5B1BE 3D5RC 2WY7Q 4HLEA 4RSYA 3D0SA 3MD2A 3U2RA 5FD6A 2QSGX 5EIDA 4I98B 3FBIB 1FIAA 5GTHC 2R7ZJ 3CHPA 3ISMC 3LWFA 4OMYA 2F37A 4Z68A 1WJ5A 4HV6A 2HNHA 3SJMA 2VJIA 1KPSB 5DCFA 4Z6YA 2WMOA 2QM3A 5FQ7A 4GZ6A 4LIVA 3HG9A 1YMPA 4QFVA 2LF7A 3GEZA 1VF9A 2B0OE 4TV7A 4Y13A 4ZYDA 4D9JA 2YUSA 2LBFA 3KETA 2FA5A 3O6BB 4CYMD 3D1NI 3CP2A 2HDWA 3FM5A 1QPIA 1DGRM 1ZTRA 2F5EA 1WZ2A 3QNKA 4OAVB 1O3SA 3B7SA 4I0AA 4FHJA 4A5MA 1IW7F 1XSVA 2L54A 5LGUA 2ME6A 1ZH5A 1OR7C 3B13A 3O48A 4F7ZA 2W57A 1GV5A 5EX3A 1S6LA 2WXPA 2JN6A 4PZJA 2NYXA 3ZMUA 4XKWA 1MSEC 1IHBA 4KDPA 2QA4I 5IYDJ 4ZH4F 3CLQA 3DF8A 3TO9A 5CVJA 3ZQCA 2Q2EA 1MJAA 2VXDA 1R49A 1LFBA 4G26A 1N0QA 2FEZA 4K5CA 3RK6A 2ETBA 3PDNA 4F92B 3BCBA 3E6DA 4N9IA 3HRAA 2FJ1A 1IQRA 2EILE 3DSTA 5LLQA 4U0ZA 3QOUA 4DJAA 1SVOA 3BZCA 2DWZA 1U9OA 2OCCH 1IUYA 3AG4H 2YQ8A 4M9ZA 3MKZA 3MGBA 3NOCD 1DMZA 1Z6RA 4XL9A 5JVTA 1IRZA 1FOYA 4MRUA 2EFWA 2OTJI 2LSUA 2JA5J 3C98A 3DITA 2IONA 2VQGA 2L9VA 2IS2A 2XAJA 3MEKA 4GTSA 3FU6A 5A8IA 1DPRA 4B44A 5J8CA 4BQAA 3FUEA 3CK7A 2DJIA 3ZMSA 1SD7A 3FUKA 1H88C 4Z2YA 3GZ2A 4PFOA 1OCPA 2LRDA 2TCTA 2XGCA 3KP5A 3BC8A 3WHCA 3MCZA 4HXIA 3BG5A 5DIZA 4BQQA 2MA3A 4YELA 2LSVA 2MBFA 1PY1A 2FSWA 1ITYA 3Q0VA 5FQ8A 2BHZA 2KQRA 4B3XA 2E60A 1E8YA 1ZYRF 4XORA 3CJQB 3DCFA 4U8YD 3OXLA 2XIGA 3A02A 5CLSA 5FWQA 3LVRE 4L9VA 1R23A 4KVMA 1X2NA 3UV0A 3KP7A 3JRBA 1TL8A 4GZ3A 1HKSA 3CMMA 3R7QA 4V2GA 1JJ8C 3SEQA 1O1TA 2VC0A 2KB3A 2CWEA 2DMNA 2MGQA 3W3CA 3L2CA 3CO6C 3VODA 2FNAA 2OV8A 1J4PA 5JI6A 2XAUA 5H6RA 3GTQJ 3KP2A 5M72A 2KB4A 4JA7A 5FLXZ 4HAMA 1V5EA 1LB2A 1QU3A 2BHYA 3ML8A 2PL2A 5LHHA 5JR3A 1SEUA 1TWGJ 2I1JA 5DHUA 3PZ1A 1VQ6I 2ELJA 2ZNYA 2ZMEA 3H3UA 3L17A 4B94A 4JOMA 4AVXA 1D0YA 1X3ZB 3IP4B 4UWFA 3S1NJ 1SUWA 3LA3A 3NOGD 4F91B 3CSTA 2D1HA 1U7VA 1PUEE 3ZYQA 1HCRA 4MIMA 3HC7A 2FBHA 1H2UA 5IP9J 3W9FA 1JCRA 4OWRB 2ZJPF 3ABMH 1ONVA 2IGMA 4UUVA 1A5JA 3EHRA 4J8YA 1UZCA 5J4VA 1BC7C 1BIAA 3KSLA 1FHRA 1OYIA 1UG2A 3D9NA 4ENJA 1W4MA 3Q7AA 4WWNA 3EPZA 5H2FC 4UVCA 1ZGWA 3M8EA 3KFWX 2DYRE 1O57A 5AN8A 5C4JJ 3PZ3A 4A2UA 4HAOA 2NAZA 5J3LA 1C0WA 1UJXA 1X3UA 1IC8A 1W5SA 4P9UA 4EM2A 2VTBB 1A6IA 2HI3A 2XT9B 4ILHB 1RI7A 2E34A 3I56I 3HUGA 2J49A 3I59B 4C3IJ 4C48B 3KIOA 2HR2A 4WERA 1O3TA 3MWMA 2JRTA 3SI5A 3PO8A 4N4OB 3IKVA 2DFIA 5IOYA 3AAFA 3R0AA 3UKGA 4LNUD 3FKJA 2ZKZA 5D4RA 2ECBA 5KCMA 2I1KA 3MV2B 4NQ0A 2RVCA 3BZ6A 4I1AA 4WNEA 2M9HA 1XMXA 4EVIA 2BYVE 1QQIA 1U5TC 4HI8A 2GOMA 2ZU6B 2IA1A 4J6IA 2L7MP 4DBQA 3FXLA 4RM2A 3V7RA 5K7HA 1N94A 4I02A 5EILA 2CUEA 4PJMA 3V8NA 1B6AA 4N0BA 2HTSA 3FULA 2W00A 2CQQA 1Y0NA 1ZQ3P 2P7CB 2HO1A 4EM0B 2V9VA 2ZB9A 3GO5A 2NRAC 1FVHA 2J07A 5ARGA 4AY5A 1SVMA 3TOBA 5EDSA 1SFEA 2H8RA 3V8LA 3GTKJ 2XQ0A 2JRMA 4JK1X 2O8KA 4GMJA 3B6CA 1RKWA 2XHEA 1XN7A 3P2BA 2BVLA 3MQ0A 4KYWA 2XS1A 3HZJA 3B02A 3MFKA 4GZDA 1JE8A 5BQTA 2LC1A 2R03A 2DFEA 4XQFA 1K78B 3BG7A 3QYEA 5C2YA 4IRUA 1YRNA 3UNGC 2K9NA 1AHDP 5D0OD 3FM8A 5CYVA 2KATA 3V7UA 3OYDA 2DBAA 2MFZA 2OJED 3T5VA 1MR1A 4XRSG 4XRFA 3ZMDA 2M2EA 3MCXA 4L2YA 3ISPA 2XPUA 5JA4D 2GIZA 2RQPA 1J4LA 5BXUA 5TGTA 1IO2A 2H94A 2P9LG 1N52A 3A01A 1Z3YA 2M0CA 3I5UA 1J59A 1WJAA 1LE8A 4CGZA 3SFYA 3LEWA 4UWKA 1OCCH 3W2VA 4EEFG 1T0FA 3HOVJ 4U8HA 1U6GA 1MGTA 4S04A 3DU6A 1QZEA 5LEJA 5HLTA 3BTCA 3L2VA 3PRZA 4FE7A 3ULYA 3LL7A 3EUKL 4JX4A 5BW8C 3W2WA 2J8SD 3PH0C 3VTYA 3CCUI 4C2MJ 2O6GE 4O60A 1MBGA 1E8XA 2ACJA 4BWRA 4BERA 4KVOA 1LD7A 5D5WB 1ZG1A 1E2XA 1HW1A 4CA0A 2VGYA 1GVJA 3QU6A 4GTPA 1S63A 3U9WA 5F08A 1OCTC 4DLOA 4EATA 2XRLA 2K7LA 4CYCB 3LMMA 3OYAA 2BTDA 2I6HA 4O1PA 1HBXG 3M3YJ 3G2VA 3I4NJ 4EJQA 4KFCA 1D1BA 2ETHA 4G7HF 2ZCWA 2XUBA 3OS0A 4XIDA 2WXOA 3DEWA 1ZAOA 4EBAG 4RS8A 4OIPF 5EJFA 4MS6A 2HQ5A 3Q3SA 3A4CA 2LH9A 1VQ5I 2VOPA 3IH4A 1JWGA 4U04A 2QYOA 2KC7A 3RO2A 1SD6A 1XMAA 3LSHA 1H89C 3AS4A 5CCLA 4N3AA 1FBQA 1Z6TA 2CMPA 5EG0A 3B95A 3OAWA 4GA2A 5CQGA 3V7SA 4JEUA 5HKPA 1TWHJ 1YYHA 1IAWA 4OAZA 1Q2ZA 2P9NG 5DHPA 4YRVA 3QP6A 4ZZLA 1OCZH 4JX5A 4YVOA 4CH7A 2NVTJ 1QBQA 2MH2A 1G3NB 3JCKC 1P7IA 3BDDA 4L9TA 1NG7A 3BPXA 1BLXB 3BG0B 3LY9A 4BTAA 4JIVD 2DMUA 3K4KA 5C44J 1P4XA 2IW5A 3QPSA 4I01A 2LAIA 3W6VA 4IF4A 2O9LA 3A0BC 2X85A 4GGGA 3NB2A 5D66A 5CCMA 4WRRA 2IS4A 4Q5SF 3C7JA 2YSRA 4OINF 3VA4A 1G3WA 1ULYA 1OYYA 2WV0A 2E1MB 3CJNA 2R5ZA 3T1BA 3RZOJ 2VJ8A 3ZN3A 4ACLA 4X0GA 4TXPA 4DBRA 5GTIC 5JHFA 3PO2J 4G23A 1QRYA 3ZRGA 2W84A 2P1RA 2OU2A 2HOAA 4BJTA 1BW5A 1UCRA 2NOJB 3S14J 3ZYKA 2DA3A 3VFZA 4ZTFA 3DEPA 3BT9A 4BE2A 4OIRF 3I6WA 3D5LA 4ZYGA 4HRNA 3TEDA 5FFXA 4M3DA 5ENSD 1VQOI 3OYJA 2IGNA 1KQ8A 3AG4E 5JEKA 4O6FA 3TW7A 5AARA 1YX5A 1YGSA 4V19K 2V6EA 4ILIA 5KJLA 4EHMA 3ZPJA 4BAYA 4WK8F 3ZIMA 4DQ2A 1LFPA 1UHMA 2E2HJ 4M7CA 2EK5A 4ENNA 3V8PA 4D1QA 1ZARA 5EEAA 1F4KA 1MK2A 3F72A 2FO1E 2IO2C 2WV1A 2L2OA 3B6AA 4ETSA 4JHJA 4KA4A 1E3OC 1DUXC 3QU3A 1KU7A 2FRHA 1LKXA 1TWCJ 3MVPA 1N4SA 1BI3A 1PUFA 2CW8A 3E3VA 3AS8A 1KONA 2OEWA 3RI4A 2EZLA 2O7OA 3R60A 3FK6A 3KEOA 3NBNB 2V4HC 2YINA 2R5SA 2Q2EB 1FTTA 2BY0A 4B48A 2HPIA 1OR7A 4EJVA 4YFKF 1K83J 4L9NA 2KCKA 1D1AA 4ESFA 4A3KJ 2QLZA 2K9MA 4F3QA 1NZNA 1UAAA 4XKVA 3FTUA 3I71A 3ZU7B 3CVVA 3VZDA 2L6JA 3VWBA 4RGSA 2KL4A 3A2KA 2I8DA 1PC2A 1TR4A 2JWTA 2WQHA 4A3MJ 1RC9A 5F1JA 2VL8A 2P58C 3FH8A 4PJLA 5JLXA 3DLAA 2A4ZA 4B8CB 1I39A 3H36A 1WDYA 4CYDA 1N25A 2QKLB 3AJIA 2VOOA 2OBPA 2FE3A 2WXMA 4IX7A 4CXFA 2CFZA 4L02A 3AL0B 2LYCA 4PS7A 2STWA 2PMUA 4BS9A 2FI7A 5EN5D 3SFXA 4ZYEA 4U07A 1TW2A 5J1UA 1ON2A 2BRFA 2E19A 2HVRA 2P6TA 2VIXA 1MX2A 3RAUA 3FX3A 4GO1A 3GZ5A 1BJZA 2R7XA 4ZDLA 4ESJA 3TMOA 1OKRA 2NVQJ 3GZSA 2NSZA 2BW3A 2DDAA 1ACIA 2EJRA 2JA7J 4FE4A 2Y31A 1QQEA 1X5BA 1VQ9I 3V79K 1YJ9I 2AXVA 5D5UB 2X6KA 2Y1LE 4APOA 4H7XA 5T3RA 3CLJA 1USTA 2WXIA 1H6KA 1I1SA 1W5CC 2JK3A 1QPMA 3BUAA 3HXLA 4M73A 3HRMA 3OYGA 1UJ8A 3UT8A 1ZELA 2CSWA 3DEUA 4ZC3A 3FIWA 1X1DA 4R9PA 2F8YA 1JHFA 3RSNA 2VPRA 4BX8A 4A3EJ 2DOFA 2CV1A 4HF1A 3LS8A 3ZMZA 2P8TA 4PS3A 1YS6A 5FGMA 3FH5A 4YNDA 3IKTA 2IVMA 3VA1A 1MBHA 4MQVA 2HOSA 2I5UA 2X6YA 4IOCF 3FDYA 3HDDA 1P4AA 2DA1A 3VLDA 3NARA 1RRJA 2I1WA 2V4LA 3ABUA 4I2ZA 2EFPA 1VQ7I 1NH3A 2R7VA 3C3OA 4GZCA 5IYBJ 1X2MA 3HXBA 3CF2A 3C1DA 4HVBA 1U7VB 2VQHA 1MBKA 4OYSA 4DX1A 2PZIA 4I9CA 3I54A 2F8XK 1AWCA 3RZDJ 4FU3A 4PJJA 3UM2A 3OYIA 3ONKA 2B7EA 2R7OA 2RGVA 3UUXA 2UXXA 1IN6A 4YIFA 2XRZA 2L0KA 1D3YA 5EF6A 1ZLKA 4PSXA 3R61A 3TDUC 3G3ZA 3K9TA 2IJGX 4E6HA 4JONA 3SY2A 3HYIA 2EA2A 5HLHA 3WU1B 3LSKA 2XC7A 3TWTA 1GXPA 3BCAA 1FMVA 2VSOE 2DOAA 3M1EA 3ASHA 4U88A 2E7XA 2H6FA 4OIQF 3ENEA 1S72I 2WAEA 2MLKA 3L2WA 3HOXJ 4KN7X 3HUGB 4FHTA 4Q69A 3H0GJ 2LNIA 4GMRA 4EGXA 3DPUA 3KZZA 4EGYA 3Q73A 4M3BA 3TDZC 5AENA 3HOZJ 5M3FJ 4NIKA 4BE1A 1JXSA 5FLMJ 2OZ6A 1QBJA 1V3FA 4O1OA 1TWAJ 3S15J 3R4KA 4UWHA 2OC6A 2P9SG 2HR3A 3FTZA 3B7BA 1P9QC 1HDPA 1J0RA 3HSFA 2O03A 3Q9NC 5BPPA 3SD5A 4JW1A 4KT6B 4H87A 5J08A 5L3EA 3AU5A 2FBKA 1O1SA 4GTRA 1WPKA 1IV6A 1BI1A 5JHUA 4HLLA 2K9SA 5IOZA 4IOAF 3D9OA 1P4WA 3NQOA 5F27A 3Q49B 2DCPA 4I2WA 2LDUA 5ARFA 2HGCA 4KIBA 4HFGA 2L6BA 2MHKA 3I4PA 2NS8A 2K9QA 2YNQA 1BM9A 4X6AJ 3CP8A 4N2QA 2HKOA 2P6SA 2A3SA 1GLNA 4HNTA 4KUMA 5HOOA 2NVXJ 1W7PA 3ONQA 4UV8A 1JJ6C 2HEOA 1QVUA 1YLFA 1Z3XA 3JRDA 3CCJI 1OCCE 1U5TA 3RYPA 3TBIA 2R5YA 5K5RA 3MA5A 2ISZA 4A0XA 3FK7A 3TGOA 2KKLA 1CQTA 3A0HC 1J2FA 2F5CA 3HXDA 2X9DA 1IN5A 1W0UA 1X4PA 1R1TA 3HPHA 2IAIA 4HX7A 1AU7A 4KMFA 5LD2C 5KNHD 3UNMA 1FPQA 4W9RA 5ENNA 1NK3P 3BTJA 5BPDA 4DLQA 3FMSA 1WJDA 4EQFA 2Y9YA 2RNGA 2Z5UA 2GM4A 3RRMB 4BTBA 4GPKA 2KDOA 1XX5A 4EJUA 2B9SA 2QVLA 4O6JA 2ELHA 4I99C 1YRNB 4AY6A 4RBOA 5HDGA 5CBNA 2KMUA 2LKXA 3DSSA 5BT1A 1S64A 2MD5A 4CRWA 3H3VK 2A5WA 1AA7A 3BR0A 4KITB 1YJMA 4HNUA 3CCEI 4MFEA 2W48A 2HKXA 1HC8A 4U7BA 2XHKA 3FUNA 1MJBA 2DTZA 4CCKA 2L7ZA 2KXPC 3UT4A 1UHWA 2EINH 4IULA 3JTGA 3BTLA 2KJBA 3DFGA 5CVVA 1DPUA 3A01B 3CUOA 1OCZE 4F52A 4R7LA 5CHEE 3KSQA 4LITA 1SD4A 1RKTA 3ECHA 4LB6B 1KGSA 2EFNA 4AVPA 1R1VA 3CCQI 5ENOD 2X51A 2E1CA 3FHZA 3PM1A 3L2RA 2HWVA 3GTOJ 1K3NA 1QHGA 4A3JJ 5G04J 1E3HA 4XLCA 3RU0A 2KIQA 2Q1ZB 2VUMJ 3E34A 4A0EA 1MH4A 4FX0A 1MMNA 3SGHA 1FY7A 3OL3A 4TUMA 2ZGGA 3HPGA 2VSNA 1R1UA 3FWEA 1B8IA 1W7PD 1K1AA 1OPCA 4PH4B 1E8ZA 2XAGA 2BUGA 3T8KA 3B7RL 2UZKA 2XEEA 5LCWC 5D8LB 5FQ6A 4P96A 3K7AJ 4G8XA 3TL4X 4D0PA 3CVYA 2H8WA 4A6EA 3DPDA 2FOWA 2IGOA 3I0MA 3CKCA 4DPRA 5FB2A 3EHMA 2QEXI 2QBYA 1UELB 4HYEA 1FJLA 3EQLF 4FASD 1X3WB 4V24A 3NZSA 4J19A 1P2FA 1QHHD 3U1KA 1NK2P 3HOUJ 2KZTA 1OY3D 4K5AB 1HF8A 2NC9A 1H0AA 4L0ZB 4HV5A 2XRYA 3L9TA 2ZJRF 1N0RA 2DCEA 4Y4RA 2DYSE 2FU4A 3JQ0A 2MH9A 4GZ5A 2V1XA 3W6JB 3UM3A 3PEUB 4GYYA 4J0UA 4BSXA 4E4HA 4J00A 1WJEA 2QSHX 3P1UA 5FKOA 1ERDA 2RV8A 2Z16A 4WNFA 3VZBA 3BP8A 3V7YA 2OD5A 3X2QH 1JCSA 3BR1A 4NUBA 2EB7A 3V8JA 3IAS2 4G94A 3DWLE 1A04A 4I1MA 2CSOA 5E1WA 3LAPA 1YFHA 4XEIG 4UHTA 1OT8A 3FXMA 4IQJA 3ZQLA 1IKND 1Y8MA 1WKMA 3SZPA 1TNSA 3PIPF 3EJNA 1UJKA 1JT6A 2GRLA 2OCEA 2VONA 1LPQA 3WU0A 2DMTA 1W5TA 5BNGA 4GTMA 5IT9Z 4B4CA 2KZGA 5AIPA 2WVIA 2HZDA 2LY2A 4IRGA 4AM3A 2X38A 1LDKB 3C3QA 3WTZA 3QK0A 3FU0A 2CUJA 2AN1A 2ZFWA 1WHUA 3AG1H 5DDGA 3T9KA 2CS3A 4QCJA 1K2NA 6PAXA 2X0LA 3CMAI 1OWNA 3JSOA 2GQQA 2RQQA 2W25A 4MKTA 5AJLA 1ENHA 1WI3A 3LDZA 4LG0A 2VT3A 1XMKA 4BGDA 5AQ7A 2LP0A 2DLLA 1CF7A 5G05J 5EJIA 3M9AA 2O0YA 2VGXA 1FP2A 2DFFA 2YHCA