2I2CA

Crystal structure of lmnadk1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
total genus 71
structure length 264
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2cA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2cA01
1U0TA 5DHSA 2Q5FA 3V80A 5DHRA 1Y3IA 3PFNA 3V8QA 3VZCA 1Z0ZA 4L02A 3VZDA 3V7YA 2QV7A 4DY6A 3V7UA 5DHTA 3V7WA 2P1RA 1Y3HA 2JGRA 2I2BA 2QVLA 4V24A 3V8MA 2I1WA 3VZBA 2I2AA 4WRRA 2I2DA 5DHUA 3T5PA 3V8RA 1Z0UA 4WERA 3V8PA 3AFOA 5EJGA 1Z0SA 5EJHA 1YT5A 2I29A 3V8NA 3S40A 1U0RA 5DHPA 2BONA 2I2FA 4HAOA 2AN1A 5EJIA 2I2CA 5EJFA 1SUWA 5DHQA
chains in the Genus database with same CATH superfamily
1J2FA 4UNQA 5JQGF 2AXEA 4IFEA 5H02A 2NPIA 5L7TA 4AK9A 1G8KA 1E6WA 2W2PA 4TWAA 2KHZA 5K3AA 2PS9A 2PIEA 2C2WA 1WXQA 4DB4A 5JSYA 5B3KA 1TJ4A 3IP6A 4QUHA 4DHWA 3ENVA 1E79D 1D9XA 1LDGA 2BKXA 2IPXA 2XCUA 1ZI6A 1PGPA 3KHTA 3PUJA 5DLEA 4F86A 5HBGA 1ONPA 2YBEA 1WV3A 4GQBA 4YRDA 1B42A 3GV0A 4HUTA 2QVCA 3WGKA 4LX0A 3AEUB 5GADl 1XNGA 1OWPA 3TINA 3AB3A 2QRMA 5ECYA 1RYNA 3AJRA 4XB6B 5KYKA 4XI9A 2LC1A 3TOVA 4W5WA 5C1BA 1YCFA 2ZBUA 3PE4A 3JWEA 4XPZA 4BVAA 4WK6A 1FJXA 3H2KA 3B3GA 3HXKA 1LC0A 1NQWA 3FJ1A 4L9RA 2W2XA 1SNYA 3OKPA 4X93A 5BVGB 2DR2A 3KJXA 4KV7A 1UDRA 4FGSA 4M55A 2GCEA 2HQOA 1H0RA 4P4TA 3T7KA 2I4IA 2W2QA 4H17A 4O2BA 1VG0B 1B8OA 1BDBA 1QQ7A 2PSFA 3HBLA 2A1UB 3PQ2A 1E94E 1NBMA 2PUJA 4G4SO 5AWFC 1THZA 3U1VA 3VYSB 1NVXQ 4AJKA 4H31A 3RVKA 1SHLA 2IOFK 2QZPA 5TGDA 3PTZA 3NYWA 4MVCA 5FNVF 4WASA 2QX7A 4J0JA 4XKJA 3FCAA 1Z3CA 3HNPA 1I4WA 5CA1F 3NVMB 2WYWA 1YF3A 1UZUA 4G4IA 1F2TB 3G0OA 4FMCF 1A7KA 3PE3A 1T8TA 4F46A 3D3NA 3PVCA 2PLRA 4O33A 4HDKB 4P35A 4PNEA 1CUDA 1KE1A 3SXJA 4Q9DA 1W47A 1FIUA 1PGOA 5JH7B 4FR0A 1G5TA 4HS4A 1B41A 1CHNA 3AF4A 3EEBA 3N7UA 4LE0A 2CV1A 4LBWA 2J7KA 5BT8A 2IYOA 3FF1A 3MWEB 3RIEA 3AM3A 1B6RA 4A4DA 1YHYA 1SU6A 5LNK6 5TRTA 4RTMA 1RI3A 2ERXA 3EDOA 1SCUB 3HBJA 2DBRA 2H5EA 3B1FA 3FMOB 3RUCA 1LRKA 2N0SA 1E4OA 4OBBA 1ZGAA 4F2GA 3EXIA 1FU8A 3PHCA 2WJZB 2HF7A 3M6XA 4YCDA 5JSZB 1NF8A 4R31A 2BEUB 1UXGA 1X7DA 1XRRA 3TAHA 4TUYB 2YKGA 5AKZA 1CYEA 3CNQS 1KMNA 4RV9A 1AF7A 4D3ZA 5FWNA 1QIJA 1LF5A 2Q46A 4NL4H 3LLUA 4DW8A 2CFCA 2JZNA 3M4XA 4GWKA 4JYPA 2FE4A 4XD7A 5LFAA 4XPIB 5REQA 2V03A 3SDZA 1RRKA 4C22A 3DBLB 1DI0A 1FNNA 3THRA 2BTQA 3AI2A 2IYZA 3CZ9A 2QRUA 3IT1A 2ZM5A 4ICIA 1MTOA 3EOAI 2XIQA 1CUXA 2VDWA 3ZZ1A 1EK6A 4PCVA 2QW1A 4MS3A 5LQNA 4GGMX 2EFGA 1C7QA 2VJBA 3M6UA 1A2KC 2W70A 4R3UC 1N8NA 3SQMA 2EF0A 3SY8A 1NNUA 2R96A 2W6JA 3B13B 1NT2A 3CV3A 1UT8A 4UNPA 1Y80A 2YR0A 4TSFA 4YJHA 3RFFA 3IL2A 1E6LA 1HDOA 3PL5A 1T2FA 4ENUA 1Z56C 1YC5A 4HNRA 3GRRA 1MK2A 1B93A 3PNBA 5FWXA 3F67A 3KG2A 1ZVQA 3DV0B 2J87A 3KSAC 2JGIA 5A03A 3KTAB 1Q50A 1QFYA 5K4GA 2VYND 2Z3VA 2B5VA 4LZJA 4RHEA 2O7SA 2OD2A 4UEWA 3A6JA 4KDCA 3KZOA 4YACA 2XYVA 4P8RA 2O2JA 3H65A 4BN5A 2WUEA 1GZ6A 1DVRA 5KOYA 2ZJ3A 1QG2A 1KQFA 3B9QA 3BSFA 4NYIQ 1P3JA 4RA6A 1N6OA 2CVPA 1JFFA 4PU0A 4N4AA 4GOJA 1KKMA 2CEKA 3KKZA 3IBYA 4P54A 4V0SA 4F9EA 3N70A 5JNTA 1O87A 4UMDA 4IIEA 4IOJA 5BMOA 3LHDA 2YMQA 5F76A 1Y8QA 5JSUA 1RPJA 1T6YA 1Z62A 4PLFA 1CJKC 3LZDA 3RUEA 3TZEA 1UDAA 4K9QA 1E1YA 1NXXA 3KSUA 5JLJA 4KHZA 1L7RA 5CBPA 1CE8A 1SQGA 3A70A 3KL2A 2GCGA 1ZOQA 5DJOA 1TIBA 2C4KA 2GA9A 2H31A 1SC4A 2VJKA 2ENWA 2JKZA 3WR5A 1KEKA 3LQQA 4P4GA 4FOOA 4EY7A 4R9SA 1JFRA 4OUDA 4R5MA 3L1KA 3FYDA 4NBWA 1LXCA 2F1HA 1QRAA 2QVXX 4DUYB 1W0JA 3QKRB 2CL6X 1E1CB 2CWDA 4CV3A 2XGJA 2V7EA 3L46A 2L0XA 4DSTA 2C58A 3H4TA 2HZ7A 3AP2A 4HZUB 4D9MA 4MPJA 1DBSA 1F8FA 2IHJA 5C46F 4A2QA 2PTHA 1W88A 3Q0EA 4OHRA 5FEMA 4JY7A 3T9DA 3I52A 3EMBA 5DCUA 3FJYA 1ZJWA 3PFFA 3Q40A 4YO7A 4YJFA 1CQXA 4RLQA 3V1LA 2QR2A 1FF9A 4GM0A 4WBSA 1UBEA 3TTYA 2OGUA 5HSGA 1AH2A 1TMYA 2CLMB 3B1YA 4R8SA 5YASA 2X42A 5HRUA 1XZDA 4GZMA 3AH8A 3QVGA 1JIIA 4QPDA 3ZNOA 5J4YA 3HVIA 5EJFA 4R98A 4R6XA 3RK4A 5JPIA 4MQFA 4QOGA 2PVPA 4AZSA 3O75A 4I55B 4L75A 4MV0A 2IIVA 4D41A 3NHYA 4QO7A 3JQBC 2EX0A 3WISA 4E32A 1X9HA 2JFOA 1RVDA 2YXPX 4IR7A 1G64A 1SC3A 4RXTA 3EZ2A 4UHHA 3PLAE 1PWZA 3JX9A 1BVRA 2ZSDA 3IDZA 2Q3DA 1EGMB 3D2BA 2C2KA 2OESA 3NAQA 3G2MA 4GOMD 4TM7A 3SFZA 3STHA 3C3BA 1J8YF 3PXBA 5AW0A 4F7DA 3ILSA 2WE8A 3OSZA 3MHTA 2PZLA 4E07A 1TE2A 1UBSB 1XWIA 2X6QA 4JQYA 4KR9A 2WSBA 2F8TA 2P2DA 1M6WA 2IEGA 5T4BA 4X0EA 1U4NA 3CLSD 4EUHA 3BSWA 1DBQA 4Q1EA 2QD2A 1SFRA 4EKNB 1LU9A 1R5NA 1PZMA 3PPVA 2F3QA 2C0CA 2WU1A 3HXOA 4JU8A 4UEKA 1L1QA 2AKYA 1WXEA 2HSWA 1ORDA 1NPTO 1CNFA 4OQPA 4WK0B 4XUCA 1K6IA 3RDPA 3ELVA 1GO2A 3HCRA 2RGXA 3MOSA 2H17A 4FYVA 3SOZA 1LGYA 3AETA 4RTQA 5JCOC 5TMPA 1IU9A 4KFRA 5CX1B 2QNIA 1ACJA 1ZRMA 2HXSA 2RONA 3EN0A 1ZGHA 2OXRA 3IIEA 2OFWA 3K5HA 4YA6A 1W1UA 4M38A 5C1DA 2HMWA 4N0DA 2XCRB 3OPYA 4Z99A 4QG7A 3IOBA 3LIPA 1GQ2A 2GHQA 4IHQA 4UNNA 1MIOA 3NUGA 3UFBA 5CHEA 1UOQA 4PLVA 7REQA 4HEHA 2F3UA 2QTAA 2VP2A 2WJJA 3I4LA 4TMWA 2YNMA 5BWLA 4UBNA 2J0EA 3LY5A 4JQSA 1RHQA 1YL6A 1XNJA 1EVJA 4NYMQ 4ITVA 1VMDA 2AI1A 2FW9A 5EMNA 3BK2A 2ZRDA 3E4DA 3QPDA 1C7IA 4E70A 4TYYA 2P6NA 2WWWA 2BGKA 3IUNA 4FMBB 4HG2A 4PO9A 2VHYA 4WL0A 4XVRA 3VU3A 3GGDA 4XM2A 3X1MA 4ZO9A 5MFZA 2AHOA 4P93A 5JPCA 1TRHA 2BISA 4UTRA 3K0AA 3I37X 4JI4B 3EUEA 2FQYA 3R5HA 1MBZA 3NHLA 4F93B 4H7IA 3V4FA 4G67A 3S8YA 1YVPA 1KPHA 1BQEA 4UARA 5HNKA 5CGQB 2WSSD 1HSOA 1C3LA 1L8XA 2ZJBA 2P6MA 1YI8A 1ZX1A 3EF0A 2QXYA 2F3RA 2FOLA 1M1YB 4GC5A 3OUZA 1BCRB 1UWVA 3DTNA 3OCCA 4AJNA 1AUVA 1SVIA 3G88A 3B2NA 1NR1A 2C7OA 4PRYA 1OB2A 4XTCS 4D81A 3QUAA 5TPZA 4ENSA 4WKPA 3SIRA 1MHPA 3ZKAA 3ETGA 3ZWKA 1JHXA 3CR3C 1T24A 3R23A 2GCIA 4F2PA 1LGPA 3EFEA 3RVRA 1ZCJA 2NVBA 1NDQA 1K97A 2PL1A 2XMPA 4UM9B 1H3EA 2CNDA 1KRXA 3V8BA 4QUBA 4BVLA 1PF7E 4EY6A 5JH7F 1SIBE 1U04A 1PJTA 2ZITA 4G1FA 4LTMA 3RJ9A 2XGSA 5KZMB 2RSLA 1PK9A 1FFAA 3PDWA 3DZBA 4D57A 5EWJA 5BOSB 2FUCA 3EGOA 5JU6A 2BRFA 1L4HA 4IRUB 3G8CA 2HMTA 2HUPA 4WXYB 2D8MA 1PR3A 5DX8A 1JDUA 3AQIA 4GP6A 1XTVA 2W0MA 2Z8ZA 1QOQB 4US1R 1ZM7A 5IC6A 4MI3A 1XJWA 4PLTA 3N8IA 1ISHA 4N3BA 2GSWA 1N0HA 1WQ4A 3K73O 3M49A 4TUYF 4EJMA 1FVXA 1HYQA 2HSZA 3UB2A 2D2XA 5IJ0A 2B36A 5ALGA 1U8EA 2JAWA 4PAOA 1WUKS 3CW8X 3GT3A 1C7FA 3HJNA 3KT3A 3N6RA 1R12A 3MT7A 4YJKA 2FJUA 4BHTA 4GGPA 1IZYA 1NBIA 4P34A 3S68A 3RBVA 3OQVA 2EJVA 2H7VA 4IDCA 3OPVA 2WWTA 1N25A 4J90A 3GBSA 2W00A 1MB2A 3G3EA 3DHYA 2BFEB 2NQTA 2AN9A 1XEXA 4I1UA 3O2NA 3HX1A 1FRVA 3CLSC 3MELA 2F7SA 2CVHA 1XQ1A 3BICA 4UHJA 3TECE 1A2BA 1Z74A 2RGEA 2BM9A 4TLLB 3UAVA 4KXNA 3FVRA 1HLPA 3S29A 5KSYA 4OI2A 1CY4A 1UMCB 4UPEA 4I8DA 1HH4A 1RXYA 1WXIA 1TKBA 1JJBA 1L5LA 1YQQA 4WNIA 4BKPA 3G2JA 2DUMA 1JWAB 1KVRA 4X94A 2DFNA 4CDNA 5IHXA 4NCKA 1DE0A 3PWKA 3NIWA 2NPOA 1MQ9A 4QRIA 4US0R 4MP6A 4NE2A 3FMGA 4QWMA 2QN7A 1IK6A 3ILXA 3DWFA 3LBAA 4Z0TA 5JATA 4QE3A 2Z2YA 4KLZA 5C31A 4DCVA 5KWJA 1MO2A 1WW8A 2H4HA 3GHHA 4J9UE 2R79A 3ZHSA 3PC8A 4CKCA 1SXQA 1TCBA 2QNRA 3KOYA 4H0NA 5EPUA 3ICEA 1M1NB 3QPVA 1NSTA 3ORHA 5ALDA 1MJGM 3QF4A 2OMEA 3HUDA 4KWCA 4WACA 2J4CA 1I2AA 3OT1A 1P29A 3NORA 3WLOA 1BN7A 2QQGA 1IBCA 4PZ9A 3EZ7A 4KBGA 3RAPR 4DUGD 2JFGA 3BWXA 1JEYB 4JCOA 3O84A 3R6TA 1U3GA 3G2QA 3AY3A 2PS0A 3DUFB 4TMVA 5AW2A 2AWNA 2YWEA 1ZVKA 2XITA 1RAHA 1KFBB 2W6NA 2WMYA 4IIFA 4LZAA 4MLZA 3EGIA 4MW1A 4B82A 1THMA 5B1EA 3KS9A 1EVEA 1J1UA 3I0NA 4D43A 1G4UR 4BN4A 3STTA 3MGBA 1S8FA 5JDIA 4BX0A 2GT1A 2OAEA 1E60A 2W2KA 4N5IX 1NPDA 4PF1A 4WFJA 3T3IA 2FEKA 4UBIA 4UTXA 3Q7PA 2A0FA 5B2FA 2JFFA 3JQAD 4TYPA 4C21A 3TIVA 3HA5A 5IVIA 1JQBA 3K4QA 1EAYA 1ESZA 3OJXA 1GNSA 2H29A 1EZZA 1YCDA 2FP4B 2Q9AA 3QU4A 1I2DA 3IAHA 1GTVA 1Y98A 2WSYB 3A58B 3O8RA 3VYUB 5FUYA 4TLCA 2J33A 1H2AS 3F5DA 3U81A 4C6TB 3DZHA 4DCMA 4HVCA 2IZ6A 1I6MA 2OLJA 3V48A 2J59A 3TOXA 1U6KA 1W9MA 3ORRA 3QIVA 3UF0A 3DOCA 4GR9A 4OKSA 3E1SA 3ZCQA 2PWPA 3FOEC 3WZMA 1Z15A 3I2GA 3C4VA 5FT9A 2D1RA 3QELB 1ZJ5A 3BMCA 4YMSA 3KLPX 3A1EA 4QPZA 2IU3A 4I9GA 4AJPA 5JS8A 3ZDBA 4S1PA 2KYRA 4HGPA 1NASA 5T8KA 5LZ9A 2N1MA 3A05A 3NYQA 1OFHA 2J9XB 4BFXA 5C2JB 5K0CA 4I55F 4U6NA 4AF8A 4WCFC 3L4EA 4HRVA 4ZJYA 4IIHA 1JGTA 2VBFA 3STVA 1CIPA 1L4MA 2V9PA 1MO4A 1YS1X 3LRTA 4HNSA 1YZFA 4R2IA 4YP6A 1PSZA 5BNTA 3J80A 1ZUWA 4A8PA 4JFAA 2ID9A 4I9FA 4D9VA 4FGJA 4N49A 1DAIA 2XOXA 3T9AA 4IWXA 4RIIA 2P6OA 2VYCA 3OZAA 3SZLA 5EJMA 3RCBA 3MTDA 3FPEA 5AW6A 4GLLA 4Z49A 2LIVA 2RDMA 3EARA 2JCBA 3BXZA 4JK3A 4JIMA 4NIMA 2F8SA 1RWVA 4Y2RA 2C9BA 5DULA 1XNRB 2P5TB 1QF7A 5A7GA 1HEUA 3I53A 2I29A 4UATA 3LT5A 2FFAA 2I9KA 2N46A 5J4VA 2AUTA 2E7ZA 3L0IB 3FMFA 3QNMA 3AEYA 4XM0A 3SGLA 3L7YA 4KI7A 5FPPA 2FZGA 2XT9A 1WVGA 1F0KA 3FCYA 1PZXA 3F8SA 4LOAA 4PLPA 3T1HB 2DQ4A 1CIJA 2I4MA 1A9SA 1R64A 1XMJA 2WM3A 2QTFA 2ZSAA 4WOJA 3A14A 2FSSA 4LI3X 5SY6A 1M54A 2XSZA 2QDXA 4OD0A 1K4MA 3AHGA 3WY9A 4MPPA 3PQ6A 1GGVA 1YD7A 4M60A 4Q12A 2J41A 3KXLA 3RHZA 2C97A 3FWNA 4N0EA 4L2IB 1D1TA 1S8OA 2A9PA 3EIHA 3ICWA 4ZCTA 1V5EA 1DBRA 4CL2A 4CVNA 1BGXT 4JJ4A 1QOZA 1R7RA 3RC7A 2JQIA 3TQRA 3TK1A 1QIEA 3Q1KA 1G5IA 1J25A 1GAWA 4B7AA 3D64A 3Q41A 4PO3X 3KBBA 2A57A 3JVIA 5EQJB 1C9YA 4INOA 5EZSA 3VHXB 1RXCA 4GPEA 4NFYA 4PHCA 1PDVA 4K6OA 3ZHRA 4BTLA 1ZGJA 1YNSA 4IIJB 4Q3CA 3OEEA 3R7LA 3SBEA 3B7PA 4O5OA 3Q0TA 1XDUA 4KQMA 4ZU3A 2IEZA 1QF6A 3OMXA 1W2HA 3FETA 3ZH9B 3CKLA 2QLMA 1U2PA 3AIKA 4PICA 5JAIA 2EERA 2ZS8A 2J5RA 4HAVA 3E9NA 3P0FA 1CX9B 2WRZA 3ZJ5A 2BH2A 1YKFA 1PR5A 2CUNA 3OQMA 3TSWA 5I7HA 3I76A 4CMKA 2IYFA 1CJBA 2ST1A 1GCAA 4D9FA 4I99A 2G25A 4NHOA 2ET6A 2PBRA 3SC4A 2FMKA 1DKMA 4JROA 2FDXA 1P2UA 3QVVA 3AVXA 3LBIA 4U8HA 1OV6A 4NNPA 1HZZC 4MINA 1E4EB 1YVEI 3FDIA 4QLOA 2BJWA 1N7IA 3OZFA 1EFRD 2QMHA 3H2SA 1FS5A 1ABFA 3LBHA 4BN0A 1HDRA 1T0UA 3F1KA 1C3JA 3R8XA 3UTDA 3RR2A 1E7WA 2O8EA 4BNLA 1VLVA 1E8NA 2PH5A 3YASA 3PHHA 1XZLA 3ETEA 5I4CA 1KDZA 1KRHA 4YRCA 1EZ4A 4YXFA 2ON6A 2EIXA 3JRXA 1T8RA 3SIXA 4BMXA 4L5IA 2QX4A 3MRXA 5JW6A 3AZQA 1TADA 3NFYA 2V7QA 3RYIB 3T1NA 1CNMA 1J2YA 1UKZA 1OFUA 3DE7X 3QVSA 4C6HA 5JADA 8LDHA 1K86A 4I81A 4JN6B 3DBVO 5BRNA 3VA4A 3V7UA 2V4MA 5JD5A 1L5VA 3GRUA 3IQWA 5PGMA 1AKMA 2JIDA 2PWBA 4GKVA 1S8NA 1X39A 4PSUA 3FVQA 1I5EA 4ND5A 3D6VA 1P60A 2IEYA 3HJBA 2P4UA 5CEEA 5LDDC 3AR9A 3G9QA 2PMFA 3VNSA 2A33A 5J58A 3KX2A 4ZVLA 1XCGB 4RJTA 1HO3A 4BECA 4QNMA 3O83A 2CXHA 3WIUA 4OF4A 1J56A 3BHIA 2ATIA 3IX7A 1DAKA 4HQ0A 3GLHA 1PNOA 4O8ZA 3Q98A 1GLGA 4IKEA 3KVVA 2WHEA 2X2EA 4TN5A 4U7PB 3OLVA 4ACBA 1SKAA 3DYBA 4PZCA 5I9SA 3ZLUA 4JLJA 3WTBA 4EO7A 2G5PA 2F43B 1AK2A 1W29A 3Q5DA 2ZIWB 2PRYA 3Q5GA 1FFXB 1JXOA 3CTMA 2XX3A 3P9KA 1U28C 4L9AA 1QS0A 4GIBA 5EJGA 5BMVA 3ZLJA 1QGYA 3C6ZA 3V4LA 2WIAA 3WB1A 4IXDA 3OC0A 1OYVA 4B74A 3EODA 4Q37A 3AZOA 3A9RA 2GEFA 2CW5A 2ORED 1WZUA 2P68A 4H4CA 3EGVA 4HVTA 1NG1A 4JC5A 4RDHA 4WFKA 3PQEA 5LC1A 3RVNA 4B34A 4G3XA 3C8UA 2UVPB 3O8OB 1XZCA 3IUEA 3EIQA 4OAOA 4BO0A 5B57C 1AMUA 3NAZA 4RSGA 3C6KA 4LXTA 3L8CA 2VHCA 1QAQA 4D0SA 4D4HA 5I6DA 5ANRB 5FCDA 1PT6A 4RPIA 2GPNA 1KVTA 4HGRA 4H7HA 3NVDA 4GZLA 4HWGA 1C14A 4ZVSA 5B6PA 1A9XB 3CBQA 1BJKA 5IBCA 2HK8A 1PYDA 2GFHA 1NQTA 2PD4A 2P9TA 4Z6KA 2DHQA 2JHFA 4C6RA 3A9SA 3BFXA 3OQ1A 4XIFA 1KU6A 3FYUC 5FYQA 3UCEA 4DIDA 4UD6A 4E14A 3PUWA 2XKKA 2H4ZA 1X1CA 1R0KA 2QRQA 2VAWA 1CUUA 2CXUA 3U9SA 1N5KA 1J1IA 3CLKA 4DFDA 4RZHA 1Y4UA 3NALA 5U4XA 2HBQA 3CJQA 5MGNA 4P92A 3HPQA 4ZVNA 3FG9A 4XVUA 2R4UA 5GONA 5EKTA 3KLNA 4WXRA 4ZODA 1VLMA 2IUEA 5MGBA 2A4MA 3PFBA 1E4VA 4QQKA 5DGIA 2XWPA 2BFFB 2FLKA 4GSKA 1O9HA 4QEZA 3VR5H 4ZTBA 3SAJA 5L3SB 1A8IA 4YV1A 3NBQA 1SXJC 4DQVA 3HVUA 2Q6OA 3DT8A 1TYZA 3H4VA 4WNAB 3TCKA 2ETXA 2I4RA 2PG3A 2YDXA 3L92A 5EGSA 4I19A 3CPJB 3OPYI 1E3JA 5IAJA 1YAJA 3U0VA 4TTVA 4JB0A 1NJ6A 1YA8A 3Q9NA 5ELLA 5FTMA 2AD1A 3UT6A 4F9GA 5KJCA 2D8AA 3L79A 4FVTA 4AKGA 1KR2A 2A9OA 1QLHA 1HRKA 1KKLA 5MFPA 3EGEA 4ANFA 5FPKA 2W43A 4DDWA 3U7FB 3RSHA 2VKTA 4CMEA 3R41A 1U6JA 4KXWA 2GB4A 2W6ID 1C0EA 3DEAA 5JYDA 2VQDA 3ANLA 1R9MA 3WNCA 4E1BA 2VK2A 3PB3A 2MT9A 3ESZA 3OESA 4DMFA 4IWNA 2BE9A 3BX1A 1JJAA 3B6JA 4ZT7A 4LBVA 4P4SA 4WT7A 3NM6B 3QU7A 1C7EA 2GD6A 2PX0A 4Y1RB 4C0KA 5BN4B 1U63A 2COUA 3GJ7A 4FYXA 3FDZA 3GC6A 1U8AA 1XJCA 4UDXX 3SZ3A 1PW5A 3E9QA 4Q4LA 4B3RB 4HAUA 2EWVA 1ML4A 4CLHA 4PG8A 1UKAA 3BG5A 4L5CA 4NAHA 3VPDA 5JMTA 5LKRA 2YQ4A 4MGKR 1CUSA 2PX6A 2FKAA 1RKUA 4C06A 1VRWA 2WW8A 3FRIA 3KSRA 4UEQA 4I3HA 1JA9A 1H65A 3RSCA 1DMSA 3AV0B 4RVGA 5GPBA 2G36A 3NHZA 4TS9A 4BO8A 1TGYA 2ZULA 2IWRA 4Q3EA 5AI5A 3PEWA 3JRNA 4BX8A 4TKZA 3KKLA 3P9ZA 1FP4A 2BBWA 4WA7A 4Q7MB 3TD9A 2CHUA 3WMXA 1L1EA 2D2EA 3N2ZB 3QVMA 1JKIA 2HQRA 2Y99A 4FSDA 4BFWA 2QL5A 1XK7A 2JZCA 2Q4DA 3D2LA 2MIIA 3FNIA 4OHWA 1DQYA 3HMKA 3U49A 4BOYA 3KU1A 3LGSA 4IIJF 1NQOA 3WV5A 4EELA 2AJBA 4ND8A 5EMMA 2CNOA 3WDLA 4E1AA 3RM3A 4F85A 1UFOA 4BXOA 5JAMA 4ND4A 2E6KA 2ZWOA 2HDWA 1QFSA 5LQAA 4M1ZA 3ROFA 5K09A 1SBQA 2LKCA 1YQWA 4I9NA 4BMSA 1WF3A 4AO8A 4QREA 1OFTA 1PZFA 3B2EA 1KVUA 5E2AA 2I0FA 5ALOA 4ZAWA 4CM9A 5DM1A 1L3IA 1JKXA 4J4HA 1T3ZA 2AZMA 4LYFA 1P1HA 2AR9A 4IUDS 1I2BA 1KJ8A 3LGAA 5A5GA 2RGNA 3MGCA 4DIBA 2JBHA 5F78A 3OZXA 3IIIA 4L0DA 4TTIA 3STXA 4MVXA 3UK6A 5CA0A 3O92A 4DTIA 2VDKB 1V5GA 4DLXA 1NSFA 2C61A 2I5PO 1CQJA 3UMYA 3R3XA 3TDKA 5IKEA 4IH1A 3W5DA 2ZTLA 3FFTA 3K5PA 4CFZA 5LN1A 1CR4A 1IG3A 1Z2EA 3LNCA 2PEZA 1EFLA 2QY9A 2J5KA 3RJMA 5JS2A 1M34E 3R7NA 4MKHA 2XYGA 3ODGA 4NZZA 1ECLA 3BGWA 4Y6RA 1TC2A 1QQ6A 3DBOB 2CHQA 1L4YA 3ANSA 1C8LA 3LTEA 4KPEC 3L8GA 1SZJG 3MAAC 1JR4A 2BHLA 2EKPA 2J1LA 3SU8A 3U4QA 1K3NA 3D4IA 4K40A 4BIIA 4P53A 1OBVA 4X3CA 2ZZKA 3JZFA 1V2HE 1DEVA 2XNDD 3ABZA 2JJYA 3ELYA 5CM9C 1T9ZA 3VKHA 1FYVA 3AVUA 1US8B 1DIRA 3VFDA 1XZMA 3OFSA 4FXOA 2VJMB 1XPUA 5LSAA 3L8YA 4W5JA 4LXGA 1KO5A 3KFXA 1F8GA 1P31A 1VL5A 2D54A 3M6LA 5FBHA 4AY6A 3N2NA 2Z1NA 2X4LA 4AKSA 4C20A 4ZN6A 3O8DA 3KQVA 3KKQA 3IJ5A 4F5YA 2V6MA 3RTDA 4AB1A 3EUFA 1E4YA 3QY0A 3FGPA 2CB9A 2WKSA 2FSPA 2ZJYA 4WEQA 1CQPA 3RT1A 5DN6A 3WLJA 4PCUA 4WHMA 5FJJA 1ISGA 2ZI9A 1V9SA 3W5HA 3KFVA 5ENZA 2OFOA 4FLEA 3WRYA 1XXLA 3FBTA 3PX7A 4FB4A 2XTAA 3RODA 2CF5A 2RIRA 2PZAA 3ENNA 3IVMA 3AWDA 3CF6R 4KBFA 1JSLA 4Q4HA 5EA2A 2BC9A 2ECKA 5HMLA 1HDGO 2O8BA 3AEXA 1MJNA 2J5XA 5BW6B 3ZWWA 4F92B 4TV8A 3C6BA 3DDWA 5FLYA 1CKEA 1E2UA 2AJCA 4W82A 3VVLA 1ZOLA 4BV8A 2KB4A 1GDTA 4KR0A 2CXTA 3NTXA 4IIGA 3T52A 4QTYA 3W2EA 2AFRA 4YXWD 5KYYA 3K9NA 4TYMA 3HB7A 3IMGA 4J3FA 2CB0A 2CE7A 3L7MA 1BDMA 1IAQA 4KO8A 4OMCA 2FRXA 4XD7D 3TXXA 1VPVA 1P2SA 4Y2UA 3RVBA 2QVGA 3HY4A 1J0AA 2HCFA 5C18A 5LMZA 4UNSA 3O95A 1BMTA 5ALQA 4BP3A 3MYRA 1IOLA 3NJ4A 1UJCA 4KODA 1LTQA 2E4UA 5K20A 5LP1A 1FK8A 4CG1A 5AI8A 2RAPA 1UJ5A 1WD7A 1QLWA 1W48A 1S2NA 4HB2A 4D9NA 5B7NA 3AHEA 1O97D 2BUAA 2JLSA 4DV5B 1MB4A 3MZ0A 4EW3A 4NCXA 5TGZA 4IXMA 3E6AA 1RM5A 4J0DA 3MW8A 1FW8A 3ABRB 5CLFA 5E9QA 1QHFA 4AQ7A 4RM3A 3BGVA 2PRZA 3AESB 2ID8A 3DOUA 3F4KA 1WXFA 4LF9B 3LOUA 3ZVNA 1JT2A 1K5DA 2Q8NA 1QYDA 4LYGA 3T0FA 4EYKA 3IOYA 3O4JA 3LDGA 1YV9A 4LMBA 5TS3A 2O19A 1N8TA 4DRZA 4UM8B 3TGWA 4ZK2A 2R751 3LNTA 1XWFA 13PKA 2VBIA 5EJ5A 3FMVA 4K6HA 3VJKA 5I45A 5EFZA 1J8VA 4KXLA 4QECA 3WMGA 5B7QA 4B80A 3DEJA 3ITEA 1VLZA 1UPAA 5E4TA 5JWHA 1UM9B 3UQYS 4D6PA 1P2BA 1UJXA 2H8GA 3ZD8A 5AICA 3SZGA 1N4DA 3SC3A 1JHPA 3OJEA 1DJQA 4X1OA 1F4VA 4UHEA 2CDBA 3I1YA 2DUWA 5EP3A 2YXEA 4F3RA 5CB4A 3I23A 2EWMA 4RJLA 3MJ4A 5B4UA 2X8BA 1ZVVA 2CKMA 3LXUX 2FF5A 4ZAFA 3Q7IA 3BZBA 3CONA 3F5MA 4HRYA 3B12A 4FYIA 2JIZD 3JASA 3V8NA 3RGGA 3F49S 5C37A 2K4MA 3O91A 2ZR9A 5K0TA 2IIQA 3HL4A 4HMOA 1JWBB 4J1TA 4L0CA 5THQA 5MN6A 1DP4A 1U3FA 2GSDA 1PJ8A 3PT5A 3VR0A 1HTBA 1ZW1A 2E48A 2L82A 4W5RA 2AOUB 3ESCA 2R62A 1Y48E 4C7BA 5CPBA 4ZKDA 2F4VB 1W93A 1PEAA 4XEUA 3AI7A 1Z13A 3WLSA 3PPXA 3ZVMA 1RS0A 1XRLA 2WZBA 3QVUA 1COWA 2C8JA 1D0SA 4ZYVA 4KGXA 1VXRA 3PYMA 1X7WB 3VHRA 3WGIA 4PX9A 3VA7A 4B31A 1TJNA 5DYGA 4AN0A 4B7CA 1DKLA 1RHMA 2XZPA 1JQ3A 3LUJA 3D1LA 1M2GA 4H4EA 1XTQA 3FIUA 1NW6A 5B12A 2P65A 3P0JA 4LQDA 3FFAA 2WIFA 5HZKA 3ISJA 2Q6IA 5DIZA 4HWRA 4MLPA 2Y2VA 3AUXA 3CEJA 1IC6A 3LX5A 4BL5A 2Y05A 1VB5A 3AONB 1V39A 3EW9A 3K05A 5K9ZA 4IFTA 5KTSA 4QBIA 1EDZA 4ZYWA 1MH9A 2GNPA 4C5AA 1NHWA 2YH2A 1RAFA 3AHJA 1C1XA 1V0JA 2PZKA 4PONA 5A6VA 1JB9A 3IHKA 3D4BA 4E12A 1JALA 1F4LA 3IDOA 4RQAA 1E5TA 2RHGB 3AP1A 1ZA1A 1DC7A 1U8UA 3GLRA 2VSXA 5CFQA 1ESCA 4LPSA 4Q34A 1MEEA 1KQNA 2CXPA 4BGUA 1PZHA 2DWCA 2VDJA 1FNSA 4M8KA 3KXIA 3BE6A 1IY0A 3O4VA 2HLNA 3NWOA 5E95A 3VU9A 1JR3A 4AJ9A 3NPMA 3THXB 1TF5A 5CVEA 3EVBA 1RRMA 2REXB 3E3MA 3ZTWA 3H5IA 4B0PA 1VHJA 2CVQA 3DV2A 5JNUA 4O08A 4GYKA 4HQ6A 1OHHD 3S27A 3ZY5A 4DT1B 4EL0A 3LWNA 5K3FA 1OXKB 3KOOA 3CBGA 2E5LB 1STOA 1Y5MA 3G5UA 3AEKB 5TNXA 3R7SA 4YYZA 4GYJA 4RK5A 2XDAA 4K9OA 3PR3A 5CM8B 1R16A 1ZISA 5AUNB 4PLZA 1RP7A 5DNYB 1I7SB 4JAVC 4EBFA 3GFRA 3O8BA 3V5NA 1Z88A 3UJ7A 4LRSB 5KDDA 4BFTA 5KCMA 4EB3A 2BR5A 2GCOA 1DTWB 1KJQA 4L1KA 2ZWMA 2WP8J 1NFQA 2W6MA 3I58A 4Q4JB 3V34A 2W37A 5J4KA 3X1JA 1NMYA 3C5WP 1PAUA 4GZ6A 4X71A 5AW8A 1SOWA 4HDCA 2CUTA 2CMFA 5F9HA 3GCDA 1QSGA 2R2GA 2IY8A 5JBQA 2B3TA 3MGAA 2IV7A 4YV0A 3EIOA 1DEOA 2ONKA 5JC1A 5LXTA 1JDSA 1VP9A 2C5AA 5CRIA 2XECA 2AD5A 1G20E 1IYZA 3GRAA 2I99A 1GDDA 4P36A 3K8ZA 3C4QA 3LHFA 1HDYA 3EGDA 1L1RA 5DNWA 5FQOA 5D3QA 1BN6A 5KTYA 3ZI7A 4GOKA 4OI4A 3ANMA 4RPHA 3ROTA 5A4AA 2B34A 2YFHA 4B3SB 3GHYA 3BFJA 4G8CA 5TQ2A 5KNBD 3K2QA 2EBUA 3QUCA 4DV1B 1GXSA 3I42A 3LJKA 4DSZA 3DDNA 5FYDA 1T9HA 1IK4A 4BV2A 2VPWA 3AKYA 1L6RA 1TXGA 4MRVA 4ZCIA 3OOEA 2I4LA 2NP7A 1XVTA 3OWXA 1G9TA 4G1EB 4J16C 4JR2A 4RSRA 4AULA 2ZYUX 3CEMA 3IHTA 3Q7TA 1RACA 4MJLA 4EF5A 4WKCA 3V8EA 1AO3A 3Q3GE 5HA5A 1JJIA 3WB0A 1M66A 4MRMA 3EW7A 4QKQA 3DEZA 4QUIA 2NVWA 1M8GA 2XDQA 3Q87B 4UVDA 1UBTS 4UU7A 4TKVA 1NUQA 2X1LA 3CPHA 3UAYA 3VQTA 3EPHA 4AX8A 3TB6A 3M4NA 2GPTA 4WPGA 3HCWA 1G19A 3MMNA 5KWVA 1ZKMA 1FYEA 3P26A 2JG3A 1SXJE 3EZNA 1IM8A 4UCXA 4YCMA 1R8SA 2JIOA 3BRSA 4JOQA 4B2IA 4BNWA 3R5FA 5JZ9A 1M6YA 4MVYA 4M9RA 1XL1A 4G07A 4RQUA 2VHUA 4IAOA 3VJRA 3EIXA 5FL7D 2REQB 5EEGA 4COKA 3D6HA 1M2NA 4XW2A 4I5EA 4MR7B 4YO8A 1TAGA 1X1RA 1E9FA 2XT0A 4WKBA 2G40A 1DMZA 5F52A 2PLNA 3RRXA 3L9WA 3MS7A 1D2MA 4R1QA 4YAWA 1II8A 1UK7A 1MD9A 2FU5C 1XTPA 2Q3MA 3VH3A 1V48A 3H5LA 2QT9A 4JXZA 4JVMA 1M0TA 4PQYA 2IYTA 4PGMA 3E1GA 3PJEA 5EFOA 3RFTA 3EZ6A 2NZWA 1ES9A 1Q0ZA 1QDUA 1GQYA 1TK3A 2Q4OA 2VHVA 3BXOA 2XD4A 5F2EA 3LO5A 5F7XA 3NEYA 3EH2A 2QSZA 3U44B 2UZ3A 4I1PA 1A3CA 1LNSA 2QUJA 2ZS7A 3N6VA 2QM3A 3NHWA 1WVMA 3GWGA 3H5OA 4AJEA 3B6EA 3X2EA 2FWIA 2PBLA 1NRJB 1QQBA 1VA5A 2VSYA 5GIOE 1E2MA 3WYFA 2HO4A 1AS3A 1YMUA 2OCXA 1Q0QA 1M8PA 3REQA 3VO8A 1IZ7A 1ZH6A 4MUBA 5CVDA 5L8VA 2JB9A 3I45A 5AOAA 1UMDA 2XR1A 2MTBA 1AKTA 1TM1E 4HPWA 3MD9A 3SIPA 1YCGA 4TM8A 3UK2A 3UCXA 5BSKA 1VL8A 5LM3A 4P4LA 4CDGA 2NW6A 4RZXA 1KZHA 2XMDA 2HRCA 3A4TA 8ABPA 1T9GS 5H70A 2H3HA 4KNVA 1L5YA 3CH4B 2H1VA 5IKMA 1KP2A 2WG2A 3KCQA 8OHMA 1OVMA 1PDWA 4CL3A 3UPDA 3NC1C 3KXKA 1TUBB 3WYEA 4BGIA 1WU7A 2GNAA 2ZRKA 3KUXA 4DA9A 4PN7A 1NQXA 3I8XA 3EQZA 1T5BA 3L8ZA 3UMZA 4ZYUA 5K6RA 4JI3B 3UFXB 3ZU3A 3A26A 1HNWB 1EINA 2NSHA 4UXHA 5E1DA 1JSXA 3I4FA 3N0TA 3Q12A 3AMVA 1B8NA 2R8RA 5EJ4A 2WD7B 4J7UA 4IV0A 2C1XA 1NZJA 1Y37A 4TS4A 4YHBA 2O2IA 5DSZA 5LJLA 3QHQA 3IQIX 2AH5A 3QX9A 5HZMA 5AKYA 1E3MA 1V1RB 1PTJA 2G0AA 2WJ6A 3BGDA 3GPIA 4V39A 1C9MA 2IIPA 3H42B 3KPUA 3BQMB 3MAGA 3QX7A 3ND9A 1WZNA 2NVUB 3VR3A 1PVDA 1TQ6A 3HBNA 3AEUA 4K9NA 4MR8B 2CC2A 1A1VA 3CPEA 2JAPA 1K27A 5LJIA 1XZFA 3O26A 1KK2A 1NVFA 2JFYA 3KK0A 2JJ2A 3AY7A 5BO5A 1JU3A 3NTRA 3R3HA 2LIPA 4XZ3A 4LFBB 7GPBA 2H5LA 3IPRA 1JVNA 1RWMA 5BVGA 4FKBA 3WSTA 1QO0D 2Q6KA 1RTTA 1WZIA 4GRAA 4BZPA 1YR7A 4QGHA 4QGAA 2F3SA 1AF4A 2FZLA 4OXRA 3DO8A 3R0IA 3ZHXA 4KR2A 3K9CA 4RTLA 2ZJAA 1CUWA 5AKEA 2JKYA 2FEWB 3QG5A 1X87A 2VP5A 5CNKA 3TDMA 2FMUA 2QQ0A 5LQRA 4L50A 4L8YA 4OHPA 4DDHA 4H1VA 4MVJI 2ZYHA 1I51A 4QUJA 3AJ9A 2NYAA 1XD9A 1FQKA 4L3OA 4RY0A 4YLEA 5IK2A 1TQ8A 4P7FA 2BJVA 4XGKA 5E7MA 2G07A 2FW6A 2J6CA 2VHTA 3AKCA 4UCWA 5CJPA 2AOVA 3GZNB 5FTWA 1KH2A 4HDKA 3TTUA 1XR3A 1JG2A 2QG6A 5AHKA 2F9FA 2GAFA 1WMDA 5HQJA 4JR0A 1AXRA 5CVCA 5GZ1A 1ZA2A 2BEJA 3UXHA 4UZSA 3GO4A 2O8NA 4DQUA 4KR6A 2FMTA 3QNUA 3KR0A 2AC7A 1XF9A 3E84A 1BDIA 2YUTA 1P1RA 3H6GA 1SCUA 1JH8A 3JD2A 4ZTZB 2ZDHA 2AFFA 3IALA 3O3MB 5CXXA 3ZWMA 2Z58A 3HCAA 4A0GA 1ZCBA 2XCTB 1AURA 3Q8MA 1COZA 1XZJA 4XEHA 5DU2A 4YPVA 5IJ9B 5JSZA 4TZ0A 4ME6A 1TJPB 3T4EA 2QE7A 1O94A 2BEUA 3D81A 5AW9A 4WXMA 4CBVA 1YDMA 1A2QA 1R27A 2OCIA 1E59A 3ZGOA 2IJGX 3H1TA 2V8OA 2HRDA 3D1JA 1V35A 2B25A 1OXUA 5CW2A 5FOWA 4Q18A 3L7BA 5FTJA 3U16A 4LMAA 3S1SA 2HNAA 2PGXA 2ZM6B 3V1NA 2WYHA 2VTVA 5L3QA 3A9VA 2Y6UA 3PC8C 2R8ZA 2AJ8A 3OBIA 1JFTA 3SHTA 1WDLA 4YRMA 4I50A 2BUCA 1XQWA 3AF1A 1Z7EA 3QA3E 2VF5X 5KTKA 3DC7A 4F9TA 4H3SA 1B6TA 2B98A 1RQXA 2PZFA 4A0HA 1KOFA 1KSJA 2CE2X 2FMIA 3KD3A 1E1QD 4G5GA 4XGQA 4Q9JA 1VYUA 3SJZA 4Q7QA 1J42A 1EBFA 2OHHA 4IGIA 3FCSB 4RCVA 1XDZA 1ZOPA 3EZ9A 3JD4A 4JJAA 5HOEA 1GT6A 2FWRA 3GAAA 5GV7A 5T57A 4GXTA 1KEVA 3ADDA 4K1LA 4D96A 5B64A 2I2AA 2D2FA 3ZNNA 4N82A 3FD8A 3P19A 3NANA 1I7PA 5JERA 3A6HA 3S2GA 4PO8A 1OB5A 3H5TA 3UIEA 5FWAA 2P5SA 3VX3A 1ONNA 4RF5A 2ES4A 3ASYA 4WZBA 3B5JA 3FSRA 4YUXA 1GTSA 1L7NA 4A23A 3I39X 4KTVE 3NHMA 5CLHA 3NQ41 3UOAB 1SC9A 2ZQYA 1SC1A 2I54A 2YV4A 2Z1MA 3NEPX 5D84A 2PSJA 3HRHA 3F5QA 3P20A 4XB2A 2PPVA 5AVOA 2OO3A 1DLIA 2K7FA 1VLLA 1W4BA 3B9PA 3F6CA 3BOSA 3IJRA 4C0WA 4OB6A 2PKCA 1GG5A 3K0FB 3KEOA 4NG4A 4E5YA 3WAJA 1LI5A 2ZTSA 2OTCA 3EB9A 3RQIA 4KAJA 5IH7A 2CK3D 1L2TA 4NARA 5F3RA 3VH4A 5FA5A 3QUSA 4NTZA 3Q6IA 3KIPA 4M87A 2ZRJA 3N0RA 1NBME 1XYYA 3EGXA 4TOIA 4ZRMA 1E7RA 1PNTA 1VL1A 4RK1A 4UUQA 2Q4TA 1C3EA 1E3LA 2OENG 3L7NA 3OY7A 1D9ZA 3UG6A 1WJGA 5F5LA 1NV8A 1C8VB 4ZGWA 3TMYA 4ZOEA 1T4BA 4ZWNA 3FUWA 2ATVA 2C54A 1CEQA 1U8XX 1A7AA 2VP9A 2D1YA 3EXHB 2C9OA 4E5KA 3CU5A 3GLFB 1CFJA 2EQBA 3K8QA 3L02A 1I4DD 1PGQA 3M6VA 5KSPA 3VTAA 4PAMA 2ATEA 1QYVA 3DXYA 4W1PA 1NKSA 3KB1A 4MYTA 2IITA 3ZU6A 5C80A 1T15A 4IO0A 1FNMA 1JN0A 1T8YA 4XWYA 2C7RA 1G42A 1VDMA 2P3LA 3QG1A 4HTFA 4UCQA 3MXTA 4EQ6A 5TF0A 1CUEA 1ZQ9A 1RJGA 2DVMA 2Q5OA 2QP3A 3QWHA 5AI6A 1CR1A 4QJBA 1RQRA 3CNEA 1CUJA 5DRTA 3PLRA 3CSDA 2OKCA 4YWHA 2BTEA 2IS2A 5DBGA 4OMFG 5CDFA 2ID4A 3T0GA 3WDKA 5CDTA 3HR4A 5J4HA 4ERNA 4G8BA 1NQAO 2WHYA 3NHJA 1ZIPA 3LBYA 4TT3A 1OXXK 1E64A 2WM8A 3BDVA 4Q66C 3T15A 2AQKA 3FTDA 1U7UA 2VSQA 4RGYA 3I6IA 5LYJB 3BULA 1U1GA 5BR1A 3O8QB 2J0VA 1EP1B 1EX9A 3LQKA 2VT2A 3HXMA 3NNNA 5CDSA 2HJ9A 2GYWA 5B2EA 3GD7A 1DV2A 4RCZA 1N2JA 2OCYC 3GVIA 1G7TA 3JW8A 1X70A 5ED0A 4C03A 3ED5A 5CDUA 1SA0B 2CD9A 3ZD7A 2NQ2C 3I9JA 1TTHA 5E3JA 4IUBS 3NAMA 4LHWA 5AHRA 5TB5A 4UVHA 1Z6GA 5AKHA 4KN6A 3W90A 4CKBB 4RWEA 3NNSA 4DKJA 1XPOA 2GN6A 4JU9A 2J7PA 1M8FA 3VO9A 2X7XA 2P6RA 4FW8A 4JFRA 3PJDA 4GRDA 1N3LA 1EBUA 4XRGA 2D6FA 4EA8A 3RQSA 1ENYA 2PE5A 1KZ1A 1Z0ZA 2GUWA 4MUAA 3VR6D 3FZNA 3CH7A 2XNHA 4FTWA 4L95C 4HVLA 2WB4A 1AY0A 3QVXA 4HFMA 3BGSA 3U31A 1MOQA 5D6OA 4DV3B 1F48A 3RJ5A 2IV2X 2IP2A 3SLKA 2Q49A 3A1UA 4K9SA 1MJFA 4MW6A 4EFDA 5LMCA 1M5TA 1XEFA 2GZ1A 3NIFB 5CT6A 1GPJA 2PU7A 5E50A 3ID6C 3T3EA 4E94A 3TRHA 1ODCA 1FUIA 1PS9A 1GFZA 3VR1A 4M37A 1UDWA 3RIHA 4DUPA 1GV0A 3R8FA 3HJGA 4X41A 1IOWA 2I3AA 4Y9UA 3V4SA 1RYZA 1QRUA 1VDZA 3TQTA 1Y81A 1U0TA 4HPJB 1IHYA 3U3JA 1H2FA 1BS9A 1KQ3A 4Y2HA 2PZGA 1SUFA 2E0IA 1JHUA 3MA0A 1AGNA 1RC1A 2G1KA 2RH5A 3PUYA 3PG5A 4R2MA 4YJ2A 2GXAA 5ERYA 3A4LA 1E2KA 4B6RA 2ZYWX 4WDRA 4XGRA 3D4OA 4OHZA 3V46A 1L9KA 1VSVA 2OWDA 2XMZA 3MD0A 4QGFA 4Z0HO 5BNFA 3ZW9A 4EVRA 4ER5A 4JC0A 2YV2A 1BXGA 2OYCA 3W6ZA 2FWAA 4EB6A 5BN3B 2VPTA 1C81A 2IPLA 3PUZA 4JP1A 4R7GA 4OLAA 4UUAA 1XX6A 2PMBA 4Q02A 4V02A 4Q7KA 1K63A 3BE5A 3V3KA 2DFPA 2PYZA 5FH9A 4UULA 4TSKA 2WYIA 4JXXA 3A6KA 2EKBA 1RJDA 1L5SA 3TF5A 4OJTA 2FTKE 1LPOA 2LDXA 1XDDA 4QC2A 4R7ZA 2YJZA 1CY2A 1SVKA 4ZMSA 2MSDB 2HJHA 3ME5A 3HKBB 3QMVA 2FSFA 3ZDRA 1NLMA 2YN2A 1I7LA 1NVAA 3OF3A 5D6NA 2I22A 2A9KA 4KQ6A 1WXWA 5JISA 2OBMA 1BXRA 1KI8A 2CYAA 4J0EA 2BY4A 3HXTA 2C4MA 3K1AA 4FBMA 5AK6A 4B2YA 5CFLA 1JL3A 4PZEA 3HB1A 3BKXA 1EM8B 2EL7A 2IOHA 2PX5A 2QY6A 3MERA 3QIAA 5B1SA 3VR4A 1MT0A 4IW3B 3C5HA 1ORTA 3NRCA 4KDEA 4PSDA 4ARIA 5DBOA 4W1RA 1C4KA 2XXJA 4D9IA 4EY8A 2H4FA 2Q5LA 3W8RA 4KU4A 5L4LA 4YJ3A 3FR8A 1F1JA 2Y1OA 1B73A 1RFLA 2XKBA 4Q3BA 2Q4BA 4CMBA 4F38A 4BUCA 3B7WA 3F3MA 1U0LA 3NT4A 1AQYA 1M9NA 4K3UA 1QMPA 1SOVA 4REMA 4AVYA 2H54A 2PGIA 3UMBA 1TQ4A 4NFHA 4NBKA 4YCSA 3ZV4A 2GEBA 1VG9B 2K87A 3DKVA 1UMCA 2YC2C 3HZZA 1NUPA 3LZCA 1E6KA 4J75A 1I3MA 2Y1DA 2C83A 3BBLA 4P3YA 5ABPA 2O2SA 1GR1A 3HM9A 4RTSA 2NSDA 4UD2A 4CHGA 4HATA 4EFMA 5BORA 2JGMA 4L4UA 2NP6A 4S04A 4A73A 4GPIB 1EPUA 1KI7A 5KVSA 3J7TA 2IEIA 3G82C 1BA3A 2GEUA 2Y1KA 3AUKA 4XX0A 3SJUA 3QPBA 1LTHR 1U7FB 3KRTA 3CLUD 4DIEA 3SKXA 1LQUA 4EENA 4QJ4A 1RZVA 3ZE1B 2DGDA 4BWYA 1FRFS 2IXAA 3FRHA 4LDAA 4EY5A 3IRUA 1DUSA 4OGLA 4WFQA 5EE3A 4GL2A 3DZJA 1C0KA 4CM9D 1EDOA 4OHUA 3MCZA 4M83A 4DG8A 3CISA 3HDJA 2IHKA 1AQLA 4QNRA 4LJRA 5J1SB 2LCIA 2VAXA 1VMAA 3DUFA 1WLYA 2JAQA 3G8BA 2LDBA 1MJ5A 4F6RB 5C8ZA 2IH5A 1CJTC 3AF5A 4B3DA 2OM2A 5C1PA 1PZGA 1XBTA 3OQJA 2DR3A 2EARA 1H6AA 4DIKA 3H3FA 3CY6A 1CZNA 5HRAA 3ZS8A 5DNVA 3K6SA 1ODSA 1HT2E 2I9PA 3GGSA 4GRIA 2J5BA 3BXGA 4P6VF 4V2IA 4ZCRA 1FVOA 1VRCA 1O77A 4RXUA 2C78A 4PLWA 3FB1A 2P4EA 4F4UA 4BBPA 1WHTA 2YJNA 3VPCA 1IH8A 4QXRA 4OLBA 1L5MA 1SOMA 1V11A 4W6ZA 1TT7A 3W7BA 3E9ZA 1GZ3A 3KQWA 3HZOA 2IWHA 2VDVE 3OX1A 2AEMA 3E9YA 1HURA 2CNBA 2Z98A 4XLTA 5E9AA 4DCGA 1KO7A 5JNWA 1EIWA 1FJHA 2CJFA 4JV5B 1E2IA 1TM5E 3ROZA 4C6TA 1VLQA 1WE2A 3D8HA 1U90A 3OFJA 3PXXA 1AS0A 1FXUA 1I4LD 3HZRA 2M6RA 4WGFA 1R2QA 1Z6AA 2HWWA 3IV9A 1KJZA 2R0QC 4EM6A 4PYNA 4HPXB 1L8OA 5AXAA 5D7BA 5TR9A 2OBYA 4BX3A 2FWNA 1UFQA 4D9GA 3RUHA 4Y18A 4LSGA 2IEBA 5FWYA 3TD6A 2JLXA 3F1LA 1C2TA 3ND8A 1YRAA 1N7GA 4ZI2A 3D7KA 2JCSA 2N75A 5T6BA 2LCFA 4AS3A 1AB5A 2X4IA 3N0XA 1X1AA 1NVEA 2QN1A 3QXHA 1N5JA 4C4TA 5FO0A 4ALJA 1D6JA 2CSXA 3IPLA 1NNEA 1J24A 3BDAA 1YR1A 3C7CB 5EE9A 2FFJA 1ZJYA 1GADO 3BD7A 4U0KA 5AJUA 4WE3A 4NMHA 2WJVA 4YFVA 1GT91 5FFMA 1ZHOA 5LYJF 3NNDA 4H9GA 2DHRA 4J3JA 2EEPA 2FZVA 1AT1A 4UQOA 1XD2A 2HKIA 1K6XA 2OILA 5TEWA 2FX5A 1OLXA 3PFIA 2JJ1D 4U2DA 3SYLA 1HSZA 1T4GA 1M34B 2XXSA 2H7CA 4QWWA 3GH1A 4PR3A 5IMBA 3A1CA 2AZTA 1CR0A 1E0KA 5FUBA 4HN9A 3FHOA 4BO5A 2V3VA 4LPKA 4XJVA 4OI0A 3H84A 5DCYA 1QHYA 4NAUA 2ODAA 4QQRA 1UWLA 3DVSX 2A5LA 1N77A 1ZPDA 3GCXA 4OXXA 3EXEB 4RC9A 3U80A 1FXWF 1V8ZA 1E5QA 4V0OA 5ALVA 2ZGVA 3PWZA 4QDKA 1N5OX 1VMKA 2DM6A 3W8EA 3TSAA 4EFNA 3SYMA 1E62A 4BFZA 4JLUA 1KPIA 4NY1A 4A0QA 3C0KA 3FGNA 3NCHA 3R2JA 4JEIA 1DAGA 1CLEA 4G36A 3HCFA 4WJZA 4OQDA 2WABA 1IJKA 1U0SY 1U0NA 2J3MA 2WUGA 3A6DA 4JLSA 3CLUC 4QEKA 3OI7A 1FMCA 1KARA 1UP4A 3UHAA 2X76A 4X8OA 1HKHA 2X8WA 1MO5A 2QG4A 3NATA 1RKQA 4AJLA 3JWIA 1EVQA 4AQDA 4EG8A 4A6DA 3A3KA 4KLCA 1AUQA 2OORC 1PS8A 3ROQA 3M6FA 5ECDA 5ALXA 3AFIA 1PV1A 5FI0B 3ZHOA 4RD4A 5F1PA 2PUDA 4C0HA 1AHHA 3I5YA 2RGNC 5JXJA 1SJ9A 1J9GA 1DEHA 2RB4A 3CTPA 3VKVA 3HGMA 4Q3DA 1Y1LA 3GUZA 1GFSA 3MINA 3WB9A 1A97A 1IRIA 5KYUB 1O5TA 5F4BA 4EKDA 1VE7A 4E5VA 3NBYC 5F21A 1Y3HA 1U4SA 2PSSA 2QVLA 4II7A 3H4MA 4GX5A 1QGZA 2XDYA 5IF3A 3ICPA 2VLIA 3ITDA 1Z6QA 4LE2A 5A3QA 1YTUA 5LZ5A 1PJCA 2TYSB 4GX2A 1K2NA 3THYB 4NU6A 4BQNA 5GJBA 3T3GA 1U80A 1X1BA 1V16B 3DBRA 2P0EA 5I7FA 4JLAA 2WU4A 2O8FB 2GN4A 4O4HA 1EM6A 2F3PA 5LMNB 1T36A 1KK1A 3DG9A 4QL3A 4UKDA 1TX4B 3WKAA 1LQ2A 1JA0A 4EQZA 1E4EA 2PV7A 2CXRA 1T4DA 4C89A 5GTDA 5JZSA 5IVHA 1IJEA 1ZGZA 1Y5IA 2VP4A 4HDSA 5E4YA 1I24A 3S28A 1LLCA 5IKOA 4ALMA 2CLKB 3IERA 5KVAA 5CCXA 3OZBA 3A0RB 3AUUA 3U4HA 2GCNA 1RKBA 1FVHA 1P39A 1ZGGA 2NZVG 4NJEB 3GIDA 2FEOA 2HHLA 4TGLA 3WAKA 5F9MA 4BB0A 4KBYA 2J0SA 2JIQA 5GQSA 4PM4A 4HTAA 1BSVA 4MARA 4B3BA 1II0A 5I4IA 1CK4A 5D2CA 2JIPA 4ETNA 4AIRA 1RSZA 3ETHA 4K87A 4BC1A 1GYPA 1JXMA 1C0PA 2J46A 1IEVA 3GJSA 3MRVA 4Z4IA 5BWNA 1H8HA 1VLJA 1AU9A 2Q27A 3I2JA 1J0EA 1LNZA 1WSAA 3SBDA 3WRYC 3I6ZA 5JI3E 2RE8A 4JL6A 1O7JA 3OETA 2W2NA 4MVJM 1ZR4A 1JB1A 1V9LA 3AP3A 1JPUA 5AJXA 2QMYA 3C3KA 1DRKA 4I5FA 5D3MB 5LA6B 3UN1A 1Z26A 2VHJA 2V6BA 2B30A 3LXRA 1RT9A 1U1IA 1AN9A 5AFSA 5CFPA 5KTPA 1KXJA 1MB9A 4DILA 3B5EA 3DMFA 5DCLA 3ESXA 3UNMA 4OL9A 4JODA 5DXJA 1K3FA 2D5BA 2E89A 1G8YA 3B1VA 1RR6A 1CT9A 1WMEA 1ID1A 3KSBC 3ZWQA 1KI4A 4BX9A 2IF0A 2IV3A 2XEDA 1AK9A 2F00A 2DFLA 3IEKA 5DN9A 5AUPB 2ZCVA 2GMWA 1L1FA 1J0DA 4XJSA 5HCUA 2VUUA 4PHGA 1QG6A 3M3DA 4ZYZA 3ZCTA 1TGVA 3L07A 3OECA 3GG9A 3GPCA 4L8FA 4PQEA 5KQGA 1HDZA 1EJ2A 2EW1A 3ELSA 2RGGA 3MHPA 3QJGA 4P58A 1UR5A 5AHWA 4GECA 4F5EA 1N3YA 4AUMA 1Y4ZA 4MO9A 1JBQA 3R24A 4KI0A 4V3CA 1JAHA 4C7KA 5CFRA 3GL9A 1BU5A 3DLHA 1E0SA 4HRXA 1OZFA 3AR6A 5EMJA 3TZ6A 1KU0A 3E0XA 1F38A 1Z0SA 2OZLA 3AJEA 4WLNA 1QCYA 5JLAA 1LPSA 2GAOA 4U2BA 3WK4A 1UIRA 4IP0A 3NX4A 5BNIA 3DVRX 3ABOB 3D43A 4KWEA 2XMRA 2LTAA 3HP7A 2YYYA 3GDFA 4I8XA 4WY5A 4IJMA 3T54A 4X1YA 3ZI4A 3A2LA 4G81A 5IFKA 1Z22A 5K3CA 1W5BA 1Y7HA 2OXCA 5CP8A 3N2KB 4ZOLA 3FKSA 3HXPA 1E6MA 3IPYA 5E8JA 3AFHA 3RD5A 1Y7LA 3WRVA 4CQLA 5JAZA 2GZDA 4U3JB 2UYHA 3K5IA 4G0PA 4QO8A 3TZLA 2BGRA 3EQ9A 1Q1QA 1W1IA 3GCGA 3IAS6 3PC7A 4P08A 1QV6A 5HE9A 3E7FA 3WYNA 1C7ZA 3TAXA 3HI4A 3L77A 4B3XA 3UMMA 2XBLA 3UAZA 5DNCA 4MV5A 3LYAA 3ISVA 1PP4A 3ISTA 2FHPA 3FE2A 4IIBA 1HF3A 4FWBA 1XHEA 4MUNA 2RAVA 5BN5B 2X0FA 4K6FA 3SJAA 3WYGA 5K6AA 3BGOS 2VNSA 1OI7A 3C8HA 2HO5A 821PA 2VI5A 3GNTA 4QTTB 4CT5A 2HYDA 4J1TC 2EBFX 4HZIA 4Z9BA 4GOXA 4JHLA 1Z8HA 4A26A 2A35A 1OU4A 1E9SA 3A2NA 4DWOA 2DEUA 1XDGA 3V6LA 1Z2CA 2VBGA 4RDCA 1T3HA 3RADC 1K9VF 2PT5A 5KO2A 2YBDA 1CUBA 1U7VA 1R21A 2Y1CA 4ERXA 2YJ6A 2Z6AA 4D45A 4Q1AA 3TX6A 3U9TA 4BDSA 3CVUA 4D99A 4X3PA 5A3RA 4BVFA 2WJGA 1KFCB 3BL6A 3F7NA 3AKEA 4HWSA 4ZJZA 2B8TA 2PPLA 3KOWA 4EG6A 2IODA 4HLUA 3LCJA 3INGA 4A8JB 3NWJA 2VUSA 3M5PA 3PDUA 1ZW6A 3LE8A 2Y66A 2D7DA 1ORWA 2RB5A 4R2KA 4GYYA 1T35A 1IY1A 1OVGA 5CVVA 3ZTTA 1YQUA 1NN5A 2A1IA 1MEJA 2Q50A 3FFWA 1RHJA 2I65A 2O0KA 4OVKA 3ROXA 4E6EA 5FAXA 3R6WA 4Q6BA 3MRSA 2XTJA 3N2GB 1UBMS 1ISPA 1U9IA 3G2IA 4G2NA 4M0CA 4PS1A 4ZEWA 4B6SA 2PUFA 3QWBA 2R7LA 1PL0A 3OTGA 4XDHA 1YS7A 1ADYA 4HLCA 3C8ZA 4EGAA 4CLRA 3BQNB 4MVJP 4BUJA 1ISJA 5JNSA 4NMWA 3ZHVA 5TEVA 2BGTA 4JBLA 1IHDA 3TSCA 3TLMA 3WMWA 1R0CA 3GLHE 2JGJA 4WECA 4BO2A 3HB5X 3ZY4A 3R0XA 1M2VB 4FN4A 4MP8A 1P77A 4J07A 1BS1A 2MU1A 3NKVA 4CTJA 4NX2A 2YMPA 2RHLA 2XYQA 3GGOA 1P73A 1P6UA 1NG9A 3AC0A 1UBFA 3OZGA 1RW4A 2J85A 3D0OA 2AOTA 1SM4A 2O1WA 3VGJA 2V4ZA 4XWOA 4W4TA 4ZYYA 1B2LA 5FADA 1YZGA 4FFBA 3BHMA 1K98A 3BVPA 2GF0A 4NYJQ 2AC4A 4D8VA 4X92A 2YHAA 2JFXA 3JTEA 4Z7JA 2FPGA 2IYWA 1SXJB 2G9RA 2PL5A 4OJQA 1YFZA 3O1JC 4GPZA 3VA1A 3O03A 1UJNA 4KUEA 1CRWG 4MQ6A 3TW8A 3U13A 4H59A 2HD4A 3S1AA 4N8DA 5I8ZA 2JATA 3NG1A 2WT8A 2WR8A 4B6JA 2P7IA 4X61A 1W75A 1G59A 1VBMA 3N0WA 5FAKA 3U60B 3EFOB 4GEKA 3OC6A 3MB8A 4AJIA 4DABA 3E2MA 4TMZA 3LTNC 2I1QA 3L7OA 1Z33A 1WKVA 1EFVB 1NR5A 1R10A 2F62A 3AUFA 3B8HA 1I7DA 4KPUA 1ID8A 4AKIA 1ZCZA 2NXCA 2X5XA 4L4RA 1OTYA 3CMMA 4O4JB 1XHLA 2W22A 3R3JA 2PBZA 2UYYA 4MUYA 3H9UA 4S0ZA 3DV9A 2NVOA 4L7QA 4GNRA 1I4EB 3Q0IA 3WNDA 4CWAA 3I9KA 2O8CB 2CBZA 2O0LA 2O23A 2E2WA 1TIPA 3MCUA 1E7QA 1E9CA 4LY6A 3SFVA 2FQXA 1I1OA 5I4KA 1LQTA 4NE7A 5JZMA 4CM8B 2VUHB 1U8ZA 3NU1A 3VNRA 1KI1A 3OD5A 1LK0A 4Q4AB 1N9GA 3KYDB 1XEAA 2OC4A 4Q39A 1JLSA 3KE8A 1KVSA 2ZWAA 4FFLA 4WOCA 3TZBA 1OH8A 4JA0A 4G0OA 5CYOA 4ZT4A 2OZEA 4B5LA 3O1IC 2QBYB 5A4MS 4D4MA 1P1JA 1T0BA 4B45A 3U4GA 2JJ2D 5AKJA 3CT6A 2XRZA 2GBLA 1JUDA 1PZEA 1TEVA 2IY7A 2B8WA 2NN3C 2YIJA 3K9WA 4I4IA 3BB3A 4PQFA 3SNKA 4IL5A 2G9VA 1V9CA 1VBKA 2G63A 3GWZA 4LZOA 3DOJA 4HNUA 4QM6A 5GJCA 5I7UA 2HWYA 1UFKA 1NBOA 1TM2A 2GN2A 1GTG1 2A94A 1JH9A 2GXSA 3GRKA 2B20A 1M2OA 2GUGA 1TD1A 2VZ0A 4YRJA 5JRDS 2BMFA 4Z9FA 1OXVA 1GKKA 2DKFA 2JZOA 3VZQA 1IN7A 1XTTA 5LA6F 3O1LA 2QVBA 1H1DA 4MCAA 3IGFA 5DYIA 421PA 3PSAA 4CU2A 1QG4A 4C3OB 1R0XA 5P21A 2KWIA 1YVUA 1CIVA 1PR9A 3EXFB 3PP8A 4V24A 4S24A 1GXCA 5JE8A 3HSKA 1VECA 4DC9A 2QX8A 1OZHA 2IOQA 2HA0A 4BFLA 4NPCA 3MYYA 1KHHA 1T3TA 2RHRA 3DEFA 4RX1A 4ZD6A 2O4CA 2Q29A 4DRYA 5TQ0B 1Y8ZA 1FRQA 2H4YA 1BNCA 1TF7A 3CZCA 2QWXA 3M9XA 4AY5A 5CH8A 1P4RA 4EA9A 3AV3A 1HPLA 3SF8A 1GU7A 1OWNA 5DWVA 2FG7C 3NASA 3QU2A 4RPKA 4BNXA 4C87A 1M7BA 2H5JA 2P30A 5IN5A 3K0HA 4UDYX 3VTFA 4ND2A 1BCSA 2W83A 3PNOA 3Q8WA 4S1VA 1SCDA 1SUWA 3CUEF 3O5AA 4YWJA 5AIBA 1AVTA 1IQ0A 1UXHA 1XXHB 4HOYA 4M0FA 4TQUS 2HYIC 5CLQA 1XNHA 5G0WA 3ER8A 1R6BX 1YUMA 2ZJ1A 4L72A 2V65A 2NNLD 2A67A 1KDPA 2OGZA 4PLGA 5IABA 4C05A 4LF4B 5BVIA 4DIUA 2FETA 3EPPA 4NMMA 1YL7A 2GQ0A 2KX7A 5I9LA 2F9MA 2AX3A 1WMSA 4AQYB 2HIHA 2IW3A 2YIVX 1JPVA 1T2UA 2ZTUA 4HUQB 2BUBA 4LJYA 2Y4OA 1NYTA 4JGGA 5JWRA 5L51A 4UJ5A 4XGIA 2CBXA 4YI5A 4YCBA 3ZZNA 2FWMX 5I9NA 3R3VA 1QHEA 4P3NA 1KP9A 2VSFA 4ZQCB 3M9WA 3H7IA 4Q47A 2C2HA 2ZUVA 3RVSA 1H4VB 5DYTA 3QX8A 4UE2A 3HJHA 2XMSA 4NFLA 3RF7A 3K0BA 5K03A 1BH6A 5JT1A 2J0UA 3IVXA 4MMYB 2A0WA 5JRJA 1KR5A 1HL7A 4Y0NA 1DDOA 2Z30A 3MWFA 1O95D 3X1YA 2BAGA 2PSDA 1VJRA 2GK7A 4I4LA 3ICCA 2YWGA 3ORFA 5IYZA 1PTJC 3PPWA 1KWKA 3GGGA 1OTXA 4GYWA 5JECA 4CKYA 1J7KA 2RAFA 3L43A 1E3SA 2DCMA 3DEIA 3RV3A 3M4JA 2WKWA 1ACMA 4K0RA 2XUFA 4RY9A 3M0EA 3OBBA 1UM9A 1HTTA 3KEMA 3AZPA 3ZE0B 3PUKA 4DIOA 4ETIA 3I8SA 1WPQA 5E6UA 4GXRA 4JEUA 4CM7A 1QYXA 1RBQA 4NV3A 1PHRA 2YC4C 4X6XA 5AVXA 4F6CA 4BS9A 3JVEA 4FMPA 1NU6A 1QFMA 3VJLA 2CJWA 1SKQA 2W6ZA 1QX3A 1CEXA 2JIMA 1XA4A 6REQA 3RTEA 4KNWA 2PR7A 2P3OA 4HR7A 5EJ8A 2ZROA 3I2YX 3IR7A 1MOSA 3MIZA 2QLLA 3QLUA 3A9UA 4KX5A 5HFNA 4CFYA 4IQGA 5JFTA 2HU5A 1ISMA 2EZ8A 1ZD2P 2WMNB 4OATA 4J0QA 3PXUA 5JAPA 2WV7A 1ZAKA 2CMKA 3UEOA 3PGMA 4ZGBA 3VHQA 4QBGB 3G5LA 2HAEA 2VJLA 3KUCA 3SKYA 3J7AC 1Q1BA 2MYPA 4JJZA 5DBEX 1BHSA 2J0QA 2PKYX 3JQCA 1W36B 2BFOA 3CW2A 2JFNA 1ZH4A 2AK3A 3JQRA 4NZOA 3BMOA 3GCWA 4JMLA 4UOZA 1Z0KA 2QJFA 1MVLA 1BX1A 3ER6A 3W6PA 4IJ5A 2I2DA 2O3RA 1RXVA 2IHTA 4TL6A 4YN3A 3G2NA 1M8JA 1X6VA 5KU7A 5BUCA 1XRSB 1U4OA 2RHDA 3C43A 1H2WA 3FPCA 4PSVA 1KYXA 2EF1A 3UJHA 3LUAA 3PPYA 2AB0A 3SZOA 5CMLA 3TTXA 2PFKA 1WP4A 3UJ3X 3RTAA 1Z4KA 1N6LA 4DE5A 2Y67A 1KRWA 3JCZA 3IMCA 2VAMA 3BD9A 4ZQHA 2QTWB 4KMMA 4W9MC 3VZRA 4A0FA 5JY6A 5K0LA 5EIXA 1O94C 1T8PA 1T9DA 2P35A 3GJXC 5JS7A 1UODA 3P2JA 2I7XA 2HSDA 5CB8A 3QXJA 5JNVA 3TD2A 3TR0A 3KWLA 1A5SB 1RXWA 4BNVA 1NN0A 4OB8A 2AHRA 2HEGA 3AHCA 4C2BA 4MDFA 3KAPA 3ROMA 3L4KA 221PA 2YY5A 4O2BB 1JDPA 2W0SA 3TNFA 3T7IA 3SBOA 2QR3A 4KRYA 4BB9A 3AUSA 1USVA 1XFDA 3PC3A 4JSTA 4RGVA 3COYA 3CZRA 2VLBA 3F8WA 2OY0A 1CDDA 1I5RA 2C57A 1AZWA 2ZRPA 5D1NA 4CTMA 4OAPA 4YX9A 3AYZB 1DIBA 1TW3A 2CHGA 2OEPA 3B36A 1Z06A 3PFGA 3PJGA 4HAYA 4N18A 4UE3S 1WB4A 3KSDO 5BSVA 1ZU5A 1UJ4A 4RZSA 3MTGA 2N3ZA 5EIHA 1IB0A 1O95C 4J2OA 2O1SA 1SB8A 5ILQA 4O4JF 3WK6A 4EUKA 3D3WA 3ESQA 5EPEA 1DTWA 4R0MA 4JVOA 1T6ZA 3C6YA 3L8HA 4OK3A 3SEFA 4GMFA 5DEOA 1RAAA 3DC2A 4LGYA 4IHAA 5FXMA 4A3SA 1BD3A 5EIBD 4LVOA 1MENA 3HLKA 3WK8A 1DXHA 1GLNA 3ILVA 4IUCS 5KJ1A 1OPRA 1V5IA 3EXIB 3TQQA 4C78A 1I2CA 4WV3A 4RTKA 2Z2JA 1LEHA 4EBBA 4J91A 4PVCA 2ZJ4A 2BEWB 1UJ6A 2MMGA 3S2YA 1CB7A 5FLKA 4L6AA 3T4PA 5ESRA 3DTVB 1O4VA 4AXBA 4ZJPA 1Z25A 4IVRA 5JROA 2XXBA 2HK9A 3E3OA 1W46A 3B5IA 3M6MD 4C1NA 1Z6PA 3ZWVA 1E61A 1O96B 1YE3A 4OKNA 5REQB 4ZZ1A 3OLWA 4IGKA 4FUQA 3DL2A 5HJ2A 4PTZA 3KHSA 4BWGA 3ZV3A 2HREA 2BTQB 4RVNA 3ASVA 2PUHA 1P6XA 2HK7A 5BR7A 1H3FA 3IXQA 4TWIA 2XE4A 1XTSA 1OAOA 4Y0AA 4N40A 3D8NA 1ETUA 1MA3A 2PRSA 1AOXA 1SIUA 3KHUA 4MS3B 1U3DA 5HF5A 3ZNQA 4EI9A 5IT9A 1J0CA 1LFAA 1AK1A 4LGCA 1ODIA 3QW4B 4KACA 1U2GC 4GZ3A 1UDXA 1B0ZA 1LZKA 1XQYA 2J9GA 4N12A 3KNZA 5KTRA 1TEZA 3O2QB 2ACVA 2EFDB 4X97A 1Y4SA 4YI3A 1XRNA 2POQX 4HAWA 4IGAA 4M0UA 3N1UA 1KE2A 5JCJD 3WS7A 1Y8RB 2G88A 4M76B 2Y76A 1CQWA 4PPFA 4I4TA 1HNZB 3TQIA 1UK6A 2G83A 3GI1A 4UM9D 3HKDA 1SXHA 4L3WA 4H1HA 2XDWA 1H5QA 4OYHA 4QICA 5FWXB 3ADPA 2PMDA 3EDYA 3QYPA 3PFWO 5ICGA 2H8KA 3FPLA 1X42A 2B7BA 2RKWA 3A2MA 4KE6A 1JIXA 3M89A 4M1WA 3QVOA 1JW9B 3N74A 1HOXA 1K4KA 4DLTA 4FE3A 1CZKA 4Z3KA 2J32A 2J3QA 2JFBA 5EQDA 4V0QA 2QTMA 2YJTD 2ZXFA 4MGYR 2KE5A 2YICA 4WKNA 4HEJA 5FNZA 2ZI5A 2IX3A 3AXTA 5EY5B 4RELA 3VR4D 5MHTA 4RKEA 5AVSA 2IIBA 1Z8NA 2HU8A 4P7GA 4RA6B 1QV9A 1JFFB 4D0RA 3W6UA 1ORIA 5KBYA 2X0NA 3G0IA 1YB7A 1B6GA 4WN9B 1W0KD 3NLLA 4ESVA 1RC8A 3T3PB 1Y8QB 4AG6A 1KOLA 4C1BA 1QWSA 1JZQA 1NVWQ 1TKCA 4K6GA 3BRQA 3U44A 2VRCA 1P4SA 4RVFA 4U63A 1CE8B 4JZYA 4DEXA 1JR3E 3CNOA 4IBOA 2X1VA 4DR5B 1NSYA 3IH5A 2Z0MA 3IV6A 5GM1A 3WE7A 1D03A 5BQ5A 4ZZ3A 4X00A 1QCZA 4D97A 4EITA 4MXDA 2R4QA 1D2NA 2FJ0A 3U09A 2LXNA 3TRDA 4LRQA 3C3YA 4OUDB 5EKDA 3ASUA 3Q7RA 3ZU5A 5ICSA 3ESRA 1NVGA 3TJZA 1PNQA 3KVYA 3WNVA 4KWIA 3VPYA 1FUYB 4GLBA 1Q7TA 1AKQA 1VCOA 3HV2A 3LG2A 3P45A 4CG3A 5IU6A 4WZAE 4IIUA 3OFKA 1SEVA 1R5OA 1VGQA 1W88B 2JDIA 4Y2TA 3BJRA 4AF6A 7MDHA 4FUTA 1LLFA 5J59A 3MMSA 3KQNA 5EC8A 2UZAA 2DJ5A 3AVWA 3JQGB 4YJFB 4Q5IA 5HUQA 1PZNA 3MN1A 2O07A 2X15A 4G2TA 4JBXA 1FC0A 4F0JA 1F7VA 4ECEA 3RSSA 4QZVA 3VPAA 3QVGB 2VXOA 3CXRA 1QR2A 4LQLA 5JAUA 4NMLA 2Z4RA 4YDSA 4S12A 2PZBA 1BVUA 1KKUA 4MQFB 4RHFA 5AK4A 5EN4A 3UFXA 1FYWA 1C30A 2DWOA 1WY5A 4XR4A 4GO1A 2W93A 2VP6A 4KQFA 2NTEA 4WY2A 2ZR8A 1G2QA 4CEIB 2RC5A 3MTIA 2IH4A 5KOIA 2JGFA 2UZIR 3JZDA 3NH6A 3OJLA 4PBTA 1UBGA 4HDNA 1IHPA 2HZBA 2RGCA 3ZIAA 4D4KA 5KNCD 1WEHA 1GL3A 1SCKA 3A4IA 2JI8A 4NWIA 1NVVR 1UIMA 2FCAA 4KAAA 1CB0A 1HRDA 2JQLA 3JD1A 3L82B 5K99A 3QFHA 5JJBA 3OZSA 4NCBA 3EISA 2JARA 3P4UA 1QVWA 1D8TA 1BE8A 4YTEA 4INPA 9LDBA 5CEJA 3HWX1 1JI0A 1YRYE 3OOHA 1Y3BE 2NIPA 1ADCA 4M1MA 4L02A 4IWYA 1C1YA 1PFVA 1ODJA 1QUFA 4Y98A 4C08A 3AETB 3A1WA 5EUMA 1T6NA 3GU3A 4MAFA 5FPHA 4OPMA 1RWQA 3MGKA 3ABIA 4E5PA 2BZ1A 1DO8A 2QIPA 1CY0A 3Q11A 3GQBA 3OPYB 4WOKA 5A02A 3VO2A 2DFVA 4X9XA 1MIOB 1WQ1R 5B37A 1SQ0A 1SURA 4D9CA 1HE3A 1PN3A 1BMFA 3VOSA 4CIDA 3TGLA 2D4AA 1GSHA 2XODA 1AUPA 1CU1A 3NCTA 3ZC3A 2W9XA 5D86A 1M1XB 1OSNA 4ZC8A 2DF8A 4KB5A 2VUTA 3F9RA 3RYFA 3WGOA 1KHUA 1IWPB 1S7CA 2DT8A 3OE7D 4M7OA 3B3QA 1Y3FE 3RVPA 3VAAA 1IONA 1XZAA 4YCCA 3V97A 2V7VA 5DNAA 1T1EA 3UXMA 3N6XA 1TYDE 1PJSA 3GZNA 3BM5A 3MFYA 1NF2A 3G68A 1OILA 5E9JA 1GPUA 4W8GA 1WXDA 3CUYA 4Q9LA 2EGGA 4ZDIA 5IX8A 3QEAZ 3RARA 1KOJA 1ZNWA 4KYVA 4MVJG 1QH8A 1F8YA 3WWOA 1TPZA 4AM8A 4LY0A 2NZ8A 3LA6A 4M98A 4O2BF 4KHPB 3V00A 4YP7A 1TCVA 2HTEA 3UYLA 2VRBA 3CURA 1WOMA 2A0YA 3LUPA 2QD3A 1HI9A 2YHSA 1KAQA 2J4DA 3I01A 3TLZA 2O0JA 1IPEA 1KETA 1GCOA 1RADA 4AY3A 3ERCA 1Q19A 2O0MA 3EBOA 1XGKA 3QUBA 3PCXA 4R9NA 1E3IA 4MUIA 3W04A 4JB8A 3BJMA 1QRTA 1VSQA 4DNOA 4R1OA 4QU8A 4CNQA 4J43A 2I2BA 3EMDA 2JRCA 2FQQA 4YONB 1BKDR 4QGGA 4YRPA 1W85A 5CPFA 1FRNA 1QPBA 4UBLA 5SICE 4E5NA 3B1WA 4PCLA 1GA4A 2IOYA 4AECA 4B3IA 3P0IA 5EWJB 5SY4A 5E4JA 4G4SP 2OWEA 3U5ZB 3A32A 1GIAA 4HWTA 2HHCA 2IBSA 1ZNXA 5DCWA 1RLOA 3G1TA 1C29B 1NI5A 1ZXBA 2BN4A 5A62A 2A1TS 4R69A 5ADVA 5JQWA 1XJ0A 1AHPA 1RAEA 3K4PA 4WLEA 1RQ2A 1G2PA 1WWKA 3Q9SA 4EATA 1QYCA 2FDRA 5ERGB 2G9NA 1JMKC 4XQ9A 4DC0A 1ZH0A 5A6SA 5IJ0B 1SUSA 5HBRA 4IJWA 1OJ7A 2GK6A 2Q9BA 2IE0A 2WBLC 3TRFA 1O6BA 1YR3A 1E3WA 1G4HA 1C80A 3K1JA 4MGEA 4CCWA 2PN1A 4E2YA 3W3AD 1TJYA 1Q91A 5ALLA 2QVYX 5JALA 3DTYA 1U81A 3DZGA 4N0PA 5IBQA 1XEXB 4YK7A 1OC4A 2XKJE 1N3BA 4JQCA 4N7RA 1KI6A 3PUIA 3W34A 2VHQA 1N4AA 4EY4A 1UMBA 5KNBH 1WA5A 1QHNA 2B9EA 2BZGA 3H1AA 4BE7B 2G08A 4URWR 4RETA 6PFKA 5JMPA 1LRLA 1ZJJA 2GARA 1GNPA 3NBMA 2R00A 1ADFA 5E7QA 4IGEA 1PX2A 2ACWA 2HNKA 8AT1A 4ESEA 3L49A 4TKLA 2VJOA 4JL8A 1UPUA 1R9NA 4C5BA 2A2ZA 3IOCA 4IQ8A 2ZJFA 3DJYA 2L2QA 2FR8A 4AYXA 4QFCA 1Q21A 2B21A 1WDMA 4ZAYA 4CKCB 2P9ZA 1PW7A 3AG6A 2BTOA 1MRZA 1E89A 1OJLA 4LZPA 4GE0A 4RIHA 4EYQA 4K0KB 1H2EA 1EJ6A 1TNDA 1WTCA 3M3PA 3QF4B 1HNNA 3O82A 1QJ4A 1NLFA 4HH3C 5EMHA 4HAOA 4J4BA 4M99A 2WHXA 1M2FA 1IZ8A 1GGJA 4WMLA 1GKYA 4A2WA 5B1IA 1DDGA 2WUWE 2BE7A 4R54A 4RKYA 3LXMA 4V2UA 3EA5A 2GTHA 3GLFA 3PJFA 3IAM6 4NH0A 2TS1A 2V1XA 4HKTA 1V47A 4N6NA 2ZT8A 1NT4A 3GF4A 5AI9A 1CDEA 1FFHA 3IRVA 5E6RA 3W7AA 4DANA 2A9JA 4HS9A 3SI7A 2IA5A 1LPNA 4QOSA 3U37A 1T4MA 2HF9A 4RTOA 1JR6A 3I12A 5FI1B 3KTOA 1LDYA 2W2KB 1KYZA 5ALHA 3UOWA 1FNDA 4B79A 1QVZA 2D7CA 3FSJX 5JC8A 2CJYA 1EUYA 2IZ0A 5HIIA 2GFIA 3A6PC 3UV0A 5MDHA 2I2CA 1RWPA 3HJFA 1ZN2A 3T7CA 1CVRA 3EIUA 3FFXA 4X3OA 2ZRHA 4YMLA 2PKQP 5IWCA 3A36A 3QEBZ 4BQFA 4RACA 2HF8A 2I4OA 1BOOA 4U1RA 4CQMA 4S0XA 3I09A 4WW0A 5IASA 1DAMA 1G38A 3CUUA 1Y5LA 3VPGA 2ODWA 4PYJA 1IFXA 1IY9A 2H0QA 3UKOA 3D8SA 3WYDA 3NRJA 2P4QA 1BWRA 2DXIA 1JXQA 1WB5A 2G9QA 1IQRA 1SA0A 1CY6A 3WADA 4C3ZA 1G98A 2Y1FA 3E7PA 4G4JA 4KJZA 3W4KA 5IS2A 2GH1A 4B3FX 4ND7A 3D7MA 3U40A 2H59A 4AUEA 2R8EA 2HT6A 4EUNA 3CVWA 1OWLA 1AGXA 1YJCA 5HRCA 1K2VN 4QM7A 5KVQA 3GJRA 1GDHA 1V25A 3IAS1 1SVWA 1AZLA 2H2HA 5A3JA 2IYVA 3OVMA 1GQRA 1Z4OA 1O6GA 3VR2D 1K7XB 3IO5A 2QSUA 4JWTA 5THKA 3SJ7A 4CR8A 1XVIA 1YZLA 3CEPB 3FMIA 3P9NA 1Z0AA 3DDSA 4WK2B 5CVJA 5FHQA 5G4KA 3WHIA 4TS1A 1W5FA 3KQKA 2RCNA 5EJ6A 4IOMA 1V5WA 1UP7A 5ALNA 3N7AA 4DUZB 4CEIA 3G13A 3KT9A 4BVJA 4WZBE 5INTA 2MINA 1GA6A 1QMGA 3IPXA 1B26A 1KEWA 4M8NE