2I2CA

Crystal structure of lmnadk1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
total genus 71
structure length 264
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2cA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2cA01
3V80A 5EJIA 3VZDA 3V7UA 3V8RA 3V8NA 2JGRA 1Z0SA 2I2BA 5EJGA 5DHQA 1Z0UA 4DY6A 3S40A 5DHUA 3VZBA 4V24A 2Q5FA 2I2CA 5EJHA 3PFNA 3V8PA 2P1RA 4L02A 4WERA 4WRRA 1U0RA 5DHSA 2I2FA 2AN1A 2I1WA 2QV7A 3V8MA 1Y3IA 5DHTA 1YT5A 1Y3HA 3V8QA 2BONA 2QVLA 3VZCA 5EJFA 5DHPA 3V7YA 1SUWA 1U0TA 3AFOA 3V7WA 4HAOA 1Z0ZA 2I29A 2I2DA 5DHRA 3T5PA 2I2AA
chains in the Genus database with same CATH superfamily
2VXBA 3GN2A 4GZ5A 3TX6A 2Z2IA 5JJ5A 3CSDA 1UMCA 3FPCA 4CM9A 421PA 1PSZA 4I3HA 4HG2A 4M37A 4UDYX 4FXPA 1NBAA 5L53A 1ZVKA 1LLCA 3E15A 5DTIA 4BV3A 1EUQA 1X7WA 4GDFA 1AKQA 3FW1A 1DEOA 3AOEA 2FZWA 1O77A 4N8SA 4CLXA 4TL9A 3TI9A 4EYOA 1QKJA 2O8BA 2R11A 2RHWA 4Z99A 2FSFA 3OM0A 4AJJA 4P92A 5CDSA 4CM8B 3DA8A 4K81B 2HR1A 2ECPA 4RFSA 5JEJA 4C0WA 4J94A 1X8LA 1HE4A 3RTCA 4HNTA 4NATA 4I9HA 4D4IA 5JS7A 3CKMA 2HYDA 4MRNA 3PJEA 2Y1KA 1NMZA 4BVFA 5LQCA 4PCLA 3V48A 3ROTA 1IJFA 2BELA 1LRLA 3RIHA 4ZC1A 3VO1A 5FBWB 1N0HA 1RP7A 3N3AC 3IQEA 1V2GA 1E9VA 2G7MC 2FWMX 1H69A 2FX3A 1UP7A 3E9NA 4A16A 2V58A 3ET5A 1EYZA 2OZEA 5ECYA 1MW8X 2WUEA 4I4TB 2OO5A 3DZIA 2QL6A 1PFKA 1VHWA 4TWRA 5AUOB 4ZU1X 1KJQA 3HB7A 4C4PA 3QNWA 3IP5A 3TVYA 3WXMA 4BN0A 4HTAA 4DRXA 4N76A 4OKIA 1XMPA 1H3NA 3P0JA 4R8KA 1DO8A 5CH8A 5EI5A 3MB5A 4CM9D 1XLWA 1G3RA 1KGSA 4I55A 3NALA 2VHYA 3NZEA 4QXOA 5AKXA 3SKVA 4A0SA 1V9LA 5PNTA 5M5BA 2CMHA 3RSHA 2YV5A 3FTCA 3OZSA 4BPRA 4DV7B 3E22A 2HRRA 4DC1A 4RLFA 3JQGB 3E1KA 2ANBA 4EARA 3IERA 2RK4A 4C05A 1E3IA 1K7SN 1UOPA 2MYNA 3ILVA 4P5DA 4QUAA 1XD8A 1F6DA 2J85A 3Q7QA 4MB6A 1A9TA 1VJRA 1YQQA 2C2BA 1RW4A 2GSWA 1A9YA 2X6TA 4HY3A 5FLYA 3TSCA 3WX0A 1FEZA 1HF3A 1RPJA 1YONA 2W2TA 4FDVA 5K2OA 4C7XA 3GI1A 1KJJA 3ANTA 2XXBA 4Q48A 1YJCA 1UPCA 4XVQA 2AZ4A 3A6EA 1IRIA 4QDKA 3UM9A 5CYGA 1ZL0A 3BBLA 4WY8A 3VO9A 3KX2A 1QLHA 4PSCA 1A2KC 2JGKA 3K92A 1TJNA 4G5OA 1CZHA 5DX1A 4UJ3A 3H8JA 4G5XA 1HFJA 3LPMA 5A04A 3HEAA 3VSAA 1M1YB 3AZPA 2ATCA 3FCAA 1GTJ1 3LYHA 4MOWA 4FMDF 2BI4A 1D6JA 2JLRA 1SOVA 2CLMB 2GARA 3AB7A 3ZXIA 1DI0A 2AKAB 1GLVA 2HMSA 3HCNA 4B6RA 2PQ2A 2LR0A 1U0GA 5G4KA 3AOGA 2IPOA 1Y9ZA 4KTVE 1QH9A 2X2PA 5G1PA 5CLIA 1VHDA 5LP6A 2AZDA 2ZJ5A 3QPAA 4U9IS 4YCDA 5B2FA 1J1ZA 3V4VB 3MS7A 1I2ZA 2Y1FA 1QXSA 4LYJA 4P4LA 4RKWA 1UL1X 2G63A 2QTBA 1VG8A 1LQUA 5FUBA 2MYUA 4LOHA 5ALHA 2RD2A 4MKXA 2A1TS 3ZY2A 5JYEA 3JW8A 4YJHB 5EOVA 4XH9B 4ZAGA 3USCS 4YRBA 1JECA 1BDJA 1DUVG 1I3MA 3WWOA 2IEYA 1CJCA 1N3LA 3IAM6 5C1DA 1VRWA 1T13A 2ZSAA 4MV4A 1AKMA 3GJZA 3O8QB 4X6LA 3RRYA 4D80A 4F3RA 3EZFA 3GDOA 3VSDA 2BFCA 3AIMA 1Z2EA 4UM9D 5JQWA 3ND5A 4KR2A 2IOFK 4L9WA 1Z5ZA 3DFZA 3TJMA 2WIJA 4N49A 4CHTA 1NVAA 4DYHA 1OH8A 5JAIA 3M6FA 5J4LA 5EUCA 2JJYA 2IEBA 3N2EA 4N54A 3K70D 4X93A 5TF4A 4Z2AA 3C3CA 1JF8A 5HOEA 1XZHA 4N3CA 4OOFA 3ZDQA 5M2QA 1QH8B 5FPHA 1XC7A 5FWNA 4KH0A 4HDRA 3K6JA 3DMRA 4ZT5A 1L4BA 4TM7A 4XEUA 2PU7A 3KBBA 4V24A 1BXGA 1OZGA 4ICIA 1V6SA 4BXOA 1H4SA 1VRCA 3C3PA 2LIVA 4KN8A 2WU8A 3K2QA 4XW2A 3TW8B 5FOQA 3HJAA 1CVIA 1GZSA 3V4ZA 5K3BA 2BONA 5KPJA 2N47A 4UC0A 1S9HA 1WABA 4J75A 1Z7WA 2QTFA 4IHJB 4NPCA 3NWOA 1MRZA 4PS0A 4NJEA 4RADA 4AKTA 5IAJA 1DZ3A 4MUGA 4MWEA 4B2YA 4N5MA 4F5WA 1GTRA 3O8OB 3TAHA 2HN9A 2I6FA 1KDYA 2BH2A 2H5IA 1XZJA 4CTNA 1E2DA 3MYRA 4H4EA 2WE7A 2YWFA 3WBBA 5DLQC 3F7MA 3DV9A 4QPCA 3L41A 3CLHA 2OOKA 2XRZA 4OQPA 4R9VA 9ABPA 5IMSA 4O2AF 1N36B 4Y98A 4I4TF 5KAPA 4AUNA 1XMJA 1JSZA 3KKPA 1TCCA 2AN1A 3BMQB 1EWRA 3EZNA 3HWWA 2YNMA 4MQEA 1DKRA 1U7HA 5AM3A 4NCHA 5JAPA 4EWLA 2FMIA 4IAOA 1T8WA 4FS3A 1D4OA 5H5JA 5LP1A 2CF5A 2N1MA 2ZDQA 1Y48E 3M6AA 4YR9A 3JQBC 1KS9A 4YUWA 1VBNA 4IHQA 5HIKA 3M4YA 1U6JA 2PYIA 1TQ4A 4G1MB 1X14A 3OLWA 3NHKA 5AI9A 4AIIA 4EATA 5A3QA 1GGKA 2N46A 4P4UA 4ZXFA 3RANA 1EBUA 1WKVA 1LQ2A 3GJRA 3OG9A 5ALRA 1NC1A 1EE9A 5H4HA 4WCFA 2AA3A 4OXXA 4ENUA 3SIXA 3BK2A 1GOTA 2QORA 3HO6A 1P61B 4HYQA 3E61A 5AYVA 1QE0A 1EM6A 1EXMA 4H3KB 2RB5A 4RKEA 2Y05A 4EI8A 3NTRA 5HBRA 3IPYA 5KTSA 2HRBA 5CA1F 2Q62A 3RIEA 2HBYA 1D04A 3C6KA 4WK4B 1HTBA 1V8PA 3AUAA 2I6XA 3R0QA 3NHFA 5FBKA 2ABWA 1Y5IA 3T95A 2K7FA 2NLOA 3PK0A 1A50B 1UWKA 4IQ8A 4AVYA 1G9XA 2JI4A 2Q1XA 1BYIA 4NCKA 8AT1A 2VVTA 4N4AA 5G2OA 1EINA 4X41A 4YMTA 5LQJA 4NYMR 1DKUA 3FTFA 1Z62A 3WMEA 1IHPA 3CJTA 2BHRA 3GQVA 3KPVA 4TV9A 1L7MA 2P79A 2Q4RA 2YMQA 1RKUA 5CIQA 4IMIB 4OJNA 4M1SA 4X63A 3CZQA 3EPRA 1C9MA 1LPSA 1XROA 1ZIXA 5IAGA 3ZK9A 3PDIA 4LAFA 2FSVA 1VYTA 2IYWA 4Y6GB 2HU7A 5K8LA 4EY5A 2NVWA 1NMYA 2C3YA 1ZSVA 3NTVA 1CQJB 2RSLA 1XQ6A 3OQ6A 3PFWO 4RLSA 4XQGA 5IUKC 2PT6A 4JBXA 3VYRB 3HXTA 2ZG6A 4FHDA 4L22A 3L04A 3VX3A 3H7IA 2AFHA 2GEDA 1CDZA 1ODIA 2OCYC 4O08A 4L2IB 3RS7A 3JQFA 2VHEA 5EIEA 5KOIA 2DY0A 1WLYA 1WSBA 3RSFA 1LDNA 5KUTA 1UXJA 2BEUA 2WUFA 3PC4A 1XEFA 4X7BA 4IQFA 4H4CA 4HUQB 1NI3A 1BOFA 4G0MA 3BIWA 3OA0A 4Q4LA 5FUWA 3RWMB 4C4YA 2OP1A 3A9CA 1GM5A 4JI7B 4NXNB 4C7OB 3UT0A 1SD1A 2VTBB 1BCSA 4YP6A 3IYLW 3ZE1B 1A95A 2OK7A 4NQZA 4QARA 4R6XA 2PGJA 2A9FA 2PUGA 3CMMA 5H16A 1WTCA 1RKQA 4I3FA 5J2UF 4P6VF 2WYIA 4HTFB 1D2GA 4R3NA 3QWFA 4MPRA 3ZN2A 1W9MA 1N8NA 4RA9B 1O5IA 3V8MA 3LX6A 4MEJA 2H65A 4E08A 2NPIA 2QSZA 2VZEA 4RDHA 1KRWA 3NC0C 3EC7A 1GPH1 1T1IA 5K3CA 3IBFA 1TCVA 3R75A 1QVRA 3BAFA 1PWZA 1OJ7A 3SZUA 4A82A 4CG1A 1FP4A 1YNSA 3E3AA 5FCDA 2R48A 2ECQA 5E0OA 1QHNA 3LP6A 4L6AA 3SFVA 3BJMA 5ECWA 3N8IA 3ZDEA 2NYRA 3WK9A 4MCIA 2ZBGA 4F38A 5L6LB 1NQVA 1OLSB 4FX5A 2HHLA 1Z4QA 4N0QA 5BQPA 2J9RA 1KXZA 4H3HB 2PG3A 2HRDA 1I13A 4JBHA 3OJCA 4WI1A 3UGTA 3WB2A 4IF4A 1YE5A 1XMIA 4TXHA 2QL9A 4KB5A 3MW8A 5TEWA 2PUBA 1U7FA 2Z0MA 1J6UA 1NW6A 2JI9A 4M1QA 3S2EA 2QAGB 3WV4A 1KFBB 2FK8A 1XZDA 2CLLB 3PPWA 1GUZA 1ZKMA 2DFKB 4S0ZA 3KPWA 2OD2A 2CHGA 4PYIA 5HHTA 1S2IA 3H2GA 3O5AA 3QVSA 2G4LA 1A88A 4LDAA 4D8TA 4ZGBA 3G8AA 3WGQA 2Q4BA 4PZ9A 2ZIZA 1N7JA 4IJMA 1SXPA 4EBBA 1NWHA 2G77B 2VPQA 1H1DA 3LQKA 1WO8A 3CR8A 5EXEA 5BWOA 5CFZA 5JPDA 2O8CB 1M5TA 3VC2A 1H0SA 4UARA 4W5JA 4F5ZA 1VJGA 3A36A 1V8ZA 4GQAA 1WULS 2CJFA 2V98A 3DC2A 2G8LA 2L0XA 2QXTA 5DHSA 3QOXA 2FUKA 2I2FA 1W9HA 2H4XA 2NAFA 3KVNA 3P9SA 3VJKA 2QT0A 4I1UA 2XW6A 2OHVA 4M8SA 3RFCA 2VO1A 4NEGA 5JY1A 1QHEA 2BEVA 3SF8B 1FX0A 3I3OA 2WHPB 4IZOA 1QB7A 2JLSA 2H00A 4A8PA 1I1NA 1RXVA 3B9QA 1JILA 1I14A 2QK4A 4YUAA 5ECGC 2V3CC 1DC6A 1J2JA 3S2YA 3OZDA 1T4GA 5KNCA 3NIFB 1R8JA 1DFHA 1V8DA 2JAUA 3GP3A 3WIOA 4UCFA 4DV2B 1TFRA 5IHXA 2CLOB 4Y9RA 1N25A 1W59A 3HJCA 4ZT4A 5JCZA 4JXXA 4CMIB 1RHUA 3ZD8A 4BNUA 3VAAA 1K3JA 2C2WA 1UJ6A 1Y42X 1N6RA 2XWJI 2P2LA 4MS1B 3D8HA 5FQNA 3W2TA 2ZSHA 2GUWA 1I3NA 1TVKB 5J1SB 3SP1A 1TAHA 1Y4DE 2IEZA 2PUJA 3S2IA 1SCAA 1X94A 4J1QA 4UMEA 1Y4AE 3PRJA 1I0IA 1H93A 1L4NA 2GWHA 4JAVC 3HFSA 4F2HA 4R1SA 3VA1A 3LP5A 4JMLA 4C7KA 4FE4A 3U37A 4AKGA 3PXBA 3INTA 4IFTA 4IZHA 4Q02A 5KOYA 1E6UA 2V3VA 3FUUA 2HPVA 2WU1A 4MI6A 1CJBA 1G291 2PXCA 4B3CA 2PZLA 3CTPA 1OZAA 2GXUA 4YCSA 5LQUA 3BSFA 1EI9A 1RYNA 1WZNA 2W48A 3L5OA 1R6TA 2ZB8A 4PO3X 1MTZA 4RO0A 3RRFA 3RU9A 4CL2A 1VJDA 1GNVA 4F2WA 1DB3A 3KFVA 3PXEA 5EEGA 3Q8XB 2LW7A 4OB6A 5EJ2A 2RK6A 4Q3LA 1OAOC 1Y6JA 3Q7TA 4G1CA 4P0TA 3THWA 1QK3A 3T5DA 1OYWA 5U1PA 2B9EA 2DWCA 3BL6A 3GRZA 2C4UA 4V0SA 4N48A 2QBYB 3SAJA 3F0TA 2PV7A 1IXRC 1N6IA 3AV3A 1F20A 3SU8A 3PX2A 5KNBH 4KR0A 1QMGA 4RPCA 3I6IA 1LNQA 3KVOA 3FYCA 1ULHA 5KNCD 5JNUA 3GN1A 2QT1A 4MITA 1AB6A 4C5BA 1SOAA 4JHXA 1RAAA 1HV8A 3IXMA 2GLXA 4G2TA 4ND5A 1NYLA 4YJDA 1F2UB 1MXFA 4G5YA 4DJEC 1B14A 5KYWA 1LBTA 2EC5A 3O38A 4JLVA 5A4DA 2E9SA 2CXXA 5L40A 2ZYDA 4P31A 2PS1A 4FZ3A 2R9VA 3OZUA 1T5DX 2GR9A 5FPSA 4NTZA 4ZCLA 5ALTA 5G0VA 5CA0A 4DCTA 4GICA 1A4RA 5DSXA 2BEKA 3TVDA 2CUNA 3U48A 1IN7A 4EKEA 1NE7A 1ISIA 2CHVA 3GNLA 1OFVA 4BVJA 5IM4A 3FDIA 3EGDB 4G2NA 1BVRA 2P9ZA 2X3YA 1S89A 3D2BA 4P1ZA 1YIAA 1DADA 3ER6A 4AO8A 2QTZA 2XCIA 2PMKA 2ONYA 2IIVA 1V8BA 1KEPA 4EX7A 3W5CA 3G8YA 3EGXA 2PKXA 2G28A 4W8HA 3IVRA 3B2EA 2AFIE 4J0IA 1F3LA 5IJ9B 5HS4A 2FU5C 2ZRNA 2RGBA 2QM8A 3P9CA 1C0PA 2PO5A 3CONA 4QUGA 2V59A 1R15A 3SE7A 4URZR 4OHRA 1KPHA 1SBIA 2WKQA 1XAHA 4HRVA 1L4YA 1F60A 3KZ1E 4M1ZA 1U7XA 1Q7GA 3HYRA 3VR6A 2WOJA 3RBXA 2QX9A 4XJSA 4JIVD 2UAGA 3K2BA 1VIAA 2A9VA 1YR1A 2O07A 3TIXB 3MOIA 4V0OA 5DHFA 3U3RA 1L1RA 4B9EA 3OQHA 3DF9A 4HJRA 2IS1A 1SEVA 1TF5A 3PQEA 2HRCA 2NUTB 1UKBA 1MG5A 5IK2D 4KN5A 4JB8A 3RVMA 4D9KA 4JEHA 1Q77A 1YMQA 2ZUTA 1J56A 3CCCA 4X60A 4LV6A 4IIUA 4YJ2B 2F43A 1FQOA 2XTMA 1XTTA 2EDAA 1NQOA 4BWGA 4LE0A 4EOGA 1FDIA 3WWEA 5LZ9A 3S8EA 1GPWB 4E2WA 1W4BA 3TF5A 4MINA 3RYFB 4HGQA 2I54A 3BB3A 4GP6A 1JIVA 3BMXA 1Q1BA 3W7AA 3X1KA 2B82A 2VDRB 2XHZA 3E53A 4B4DA 1Y3IA 1L5OA 3KJXA 3AU8A 3LXXA 5F51A 3VHQA 5BSEA 2YRWA 1Z4NA 3O1LA 4W5QA 3UNNA 1P7WA 3R3YA 2R00A 4OM7A 5IKPA 1QR2A 3MHPA 3Q85A 5COAA 1GTL1 1P7YA 3P9PA 1N7IA 1M54A 1YACA 4MWZA 2YJGA 1KDZA 5ICGA 1TMKA 4OD0A 1W6RA 4JQZA 2ZE8A 2C2MA 2VJMA 1R4MB 3AIOA 3I23A 5JAQA 2I55A 1XCMA 3VJMA 5BXQC 3KZMA 3MS4A 1IHOA 1XWFA 4G0PA 4YRZA 2YDXA 4ZCIA 4YAGA 5C81A 3VR6D 4WXYB 4YRTA 3LWDA 4Z7JA 2GWRA 2P6OA 1QV7A 1MOZA 2YYSA 4LKOA 3PQ4A 5LXTF 3VXKA 4DABA 1QFYA 4I14A 4TQGA 1GD1O 4A8JC 1NT4A 1YZVA 4U8HA 2JD1A 2V96A 3TBHA 4OG2A 5DT9A 3CVUA 1GLGA 1SFRA 3OCZA 1FP6A 3QPUA 3GJSA 3RFXA 1KSGA 3MD0A 4MV8A 3MUEA 2AQKA 4B4VA 4B73A 4CM4B 2H06A 3HY4A 1NAIA 2C7VA 4ARAA 4I08A 4LEIA 3C70A 1QU3A 1XKTA 1EM8A 1O6GA 1NW8A 5CCDA 1G6OA 1T4DA 3DGFC 3DJFA 1WB5A 3CUTA 4NULA 4DMFA 3RH0A 2ZTVA 5AMXA 3L8DA 5H0IA 2VXCA 5CM8B 3D6MA 2AQIA 3U4GA 3T12A 5A71A 4L8FA 1YQ9A 1XL1A 4GECA 4OHMA 5HKLA 1G8FA 2NZ8A 5EVJA 5L4NA 1JHRA 1U8FO 1XK6A 3FM8A 2Y0CA 3OOSA 4RENA 5EHIA 1T2AA 4U7JA 1JDNA 1OUMA 1R9JA 4KXVA 3BOSA 4GDMA 1ORRA 3ZCVA 2ZAGA 4UXIA 5KNDH 2D1FA 2FTKE 1VCIA 4C89A 3AG6A 1TPZA 2JGAA 4G6ZA 3RIGA 1E7YA 3EZYA 3KAKA 3RU2A 3OOHA 4RF2A 5CPFA 3FWPA 3OIDA 2G1LA 1Y82A 2O3UA 3EIHA 4RFLA 1HDZA 3EF1A 1IB0A 4URHA 3TTXA 1RYBA 5HFNA 5JADA 1WZCA 1AQJA 3TPFA 3U4DA 4YVFA 1ZK4A 2ADFA 1R0RE 3ON5A 1X1EA 2FE4A 1U3WA 2X8JB 3I45A 3OLXA 4R01A 1BA3A 5C1IA 1ULSA 4ZVSA 4KXLA 2EX0A 2W2VA 3TPZA 1T0JB 3NANA 3SC3A 3DAGA 2DKOA 1NHGA 5DGHA 3OHSX 5J5VA 3SBXA 3EVFA 3O8DA 3JQAD 3INGA 1LJ8A 3T6KA 2HMTA 1Y80A 4BKMA 2CYAA 5JO0A 1IIRA 5JSZB 2CT8A 1GZDA 4C22A 1WEKA 1BXRB 4J0JA 2IV7A 4HUTA 5A4JA 1QHSA 3IJEB 4LWPA 3O91A 3WLNA 4D25A 2UXCB 4CMEA 4MLDA 4RQTA 4M6WA 2R2AA 5FBHA 5J2TB 2C59A 3HPRA 3T7AA 1JZQA 3AMVA 2ZRIA 3V5NA 3ZW9A 3IL2A 1N34B 3HRIA 5BXYA 3ZDYB 1Z4MA 1N7HA 4XIFA 5JPIA 4D0NA 1NU6A 4PS1A 5AJHA 1R88A 2QLBA 3WYCA 4DRYA 4OXQA 2OAQ1 5JZOA 1SQFA 2WY2D 4IEEA 1TZCA 2P1DA 5CJ2A 3SIPA 3FF1A 2F17A 1W36C 3WNVA 2IBMA 3PIDA 1YCGA 3IURA 3COVA 3R7SA 3W6ZA 1Q0SA 2I76A 3HYCA 1YOVB 4NENA 3WR5A 2PBFA 3KAQA 4EQ6B 3FTPA 3QVTA 3A9VA 5DX8A 3WTBA 4CQMA 4D8VA 1ZM4A 3C15C 3PNBA 1HYEA 1BX1A 2QN8A 1U7TA 3HCCA 3INRA 2ZWOA 3IS3A 4RZQA 4D8WA 4S04A 1A72A 2PXHA 4V0KA 4E32A 5ITSA 4NU5A 5I8WA 1H9BA 1LBIA 1I4OA 1NG1A 2JHGA 2WHEA 2A57A 3GLKA 5ARCA 2JBWA 5HILA 3SHFA 3RYHB 1YVRA 4D3ZA 4DZTA 3QEBZ 5E0KB 3AUYA 1X2EA 1L6RA 5EZQA 3SZLA 1AQYA 1CD5A 3LT1A 5DMXA 5H3HA 4BKUA 1RPNA 1Z7EA 2WWXA 5HDBB 4CGZA 1YO6A 4TXJA 3SR0A 1D4AA 1SUBA 1VFNA 3P9QA 4TTVA 4URVR 1M2VB 4BLQA 1I2AA 1QONA 3JSAA 3PHJA 3V97A 5IBCA 1GY8A 2GPBA 1GZVA 1YFZA 3M1YA 3LAWA 3SQOA 2ZI6A 5TLSA 5JLAA 3T38A 2IWHA 5C46F 2GNAA 2W0MA 3NGXA 2EF1A 2VOJA 4JLAA 2B1JA 4ND2A 4NHEA 1U28C 4X0EA 3K4QA 3FRHA 1NVDA 1TM2A 5EIWA 5FWDA 1A2OA 3H97A 3I5XA 4O02B 1TAUA 2H07A 1WHTB 2ZYIA 4KUGA 3ZE7A 3TUIC 3I61A 3ZLVA 2YXEA 4EW1A 4PLZA 4XWTA 5FJIA 4AB1A 5BW4A 1QRTA 1U99A 3PPIA 1ZG3A 3MWEB 3ESAA 2N0SA 5IKEA 1E6EA 5J5AA 3P1JA 2Q3HA 3GO4A 3H7AA 3LLVA 5AT1A 1Q12A 4PWZA 2OFFA 3Q7IA 2C29D 1CB0A 4OVKA 2J87A 2BGLA 3RUDA 2Z5LA 1US8A 3TGLA 4QEDA 4AO7A 5KCMA 4WK0B 3C4VA 4CI0B 2HLHA 1HO3A 1QUEA 2PT7A 4YRCA 1K6MA 5TS2A 4CMJA 4RTQA 2EHJA 4Q82A 3AVTA 2WFMA 3AUFA 4MS3B 2XAUA 5L3VA 3AKZA 2FMKA 4R2MA 4AWXA 3TCNA 1DPGA 1VSUA 1SVKA 2XD9A 5AP9A 3S2ZA 5K6TA 2WTUA 4MQ5A 4PSAA 1RM3A 1EBFA 2UXDB 1RQPA 3F46A 3U44A 1X80A 3QXXA 4Q5IA 4ARVA 1UFOA 4F9FA 1LX7A 1KTIA 3E18A 3W1WA 5D8DA 4EW2A 5FO0A 4HDCA 3LHDA 2QNIA 4S1VA 1OYOA 2JASA 1PJTA 5TRTA 3SSMA 3UAGA 3F9RA 2R47A 4F6LA 3QK7A 1ISHA 4KDCA 3TZEA 4UPDA 3UYLA 2NYAA 4DC9A 1JIQA 1RT9A 1GP2A 1RXSA 1NXPA 1ZUNB 3BXEA 4ZVTA 1IC6A 4UUPA 5K0LA 5FWYA 5KQGA 1RR6A 4O0MA 1DXQA 4GGOA 1XXHB 1M7BA 4AXXA 1R6UA 1SBNE 3SN6A 3IV7A 1LDGA 3TBKA 1NJSA 3THRA 1K5HA 1KETA 1ZH2A 2JARA 5F5LA 5JCPA 2YBDA 3VPDA 1N2BA 2E6UX 3DNPA 3ND8A 4OPMA 1J5EB 2D0IA 1Y3HA 1U1FA 3R5XA 4MAMA 1S2GA 3W5VA 1JAHA 2CLKB 4RHUA 1GDDA 2O1WA 3D6TB 2V7QA 2AVNA 3UMRA 3NAZA 3P2KA 4QL3A 5J2TF 2CVFA 3RC9A 1MOSA 1T43A 2J07A 1KYTA 3GFSA 4JT4A 2F64A 2BE9A 2NO7A 3FMIA 4YV2A 1XAIA 2RMKA 1DC4A 2Z95A 5JMTA 1GKLA 1O95A 3VDXA 2HPHA 2FN9A 3ZY3A 2MSKA 4DLTA 2QR5A 4I9FA 5HF6A 1RLTA 4OF4A 4H2DA 3JYPA 4G23A 2HIAA 2PR7A 3AR5A 4GMFA 3A06A 5FIUA 4DRZA 1R0LA 2PSHA 2YY6A 2A84A 5CJPA 4EF5A 3OX1A 4E5DA 3EAQA 3EW7A 3AI3A 3KJZA 1RKXA 4YX9A 2A86A 1MO3A 4QEKA 4CMCA 1W5FA 3K8ZA 5LQSA 2UKDA 1SA0B 2CFOA 4CV1A 2XMSA 3JD0A 1XPUA 3WLIA 5IJAA 3VU8A 4XPZA 4NBKA 4C01A 2HLDA 3U7EB 2A14A 3IT2A 4QLBA 1EIZA 2BGGA 3ANNA 4EPXA 1CDEA 3WLRA 3LBIA 3LC0A 3OO0A 3SX4A 4M0PA 4L6CA 1LLUA 4YYEA 2P27A 1EHYA 4O4JB 1CY8A 5JXWA 3V4OA 3OT1A 3MN1A 1YRHA 3BSWA 4P8RA 2HTEA 1A3CA 1T6ZA 2HBRA 2XITA 3H16A 1SXGA 3KEMA 4KREA 2A9QA 2PYZA 4GI3A 4IDDA 1G2QA 3RJ5A 3RKRA 4P84A 4C0JA 3LF2A 4NV1A 2R84A 3CW2A 5JDCA 3PR3A 5FFFA 3A70A 3BMCB 3RYTC 1D03A 2V7QD 2VAXA 3CCFA 2BVNA 1RAIA 4W7HA 4JR0A 4LG1A 1KEZA 1GYPA 1NF8A 2VDMB 4N9WA 5LDGA 3D5QA 1JI0A 2FN4A 4NV0A 3W2GA 3Q88A 4HNVA 5FI1B 3LCCA 4LF5B 1P5JA 1G5IA 1JG4A 2J3IA 2V9PA 4HDKA 1K6JA 1Q7BA 1IU9A 4ZU6X 3UWMA 4QXQA 3MSXA 1QC5A 4OHBA 4AP6A 4Z4FA 4MWDA 5KQMA 3PHIA 3QHAA 2PL9A 4GMHA 4YEDA 2MMGA 5CT8A 4XJTA 3LUBA 1ZD8A 3VVBA 3NM6B 4UNQA 4D43A 3TCXB 2TSYB 2H7XA 3A0UA 2HJSA 4PO9A 4PF1A 5AHWA 3IAHA 3NUGA 3IOMA 3NCTA 4Y6PA 5GGXA 3C1AA 2XWBF 1L1QA 3EG9A 4JVOA 3IE0A 4P33A 1FFBA 4KAFA 1UJ4A 2V0GA 1L7QA 1KK0A 1KWKA 1HZJA 3IIKA 1OFTA 5MFPA 2IEDA 1JEEA 1LRKA 2HDWA 2QN2A 3PBKA 4QO8A 5E9QA 2HLDD 2MU1A 2QWXA 4ZRMA 4ZOEA 3B20A 4G84A 5LYJA 1SN7A 1SHJA 3V6MA 4EJQA 2E85A 1KI9A 1P9NA 1FFDA 4YCBA 3VV2A 3MA0A 1HDOA 4MP6A 1H65A 4TV8A 3VISA 5K6AC 5AXCA 4Y9DA 2F8SA 2ET6A 2XJ4A 4OB8A 5DRYA 3UKJA 2XRYA 4HDSA 4GO1A 5GOZA 1Y7IA 1QH0A 1VJ1A 2YQ4A 2PX5A 3C6YA 3EFHA 5DOZA 5JV5A 4FVTA 1AHIA 1IXKA 2FN7A 3VR2A 3VKWA 1YJ5C 4ACBA 2O5EA 4HAUA 3H2HA 2ATVA 1CZRA 1ML3A 2O48X 3KHTA 2DHCA 5BSFA 5JIBA 2XNSA 1CK4A 4R41A 5L3QB 2QRMA 3KQNA 2OAEA 2GDJA 2Z2KA 4IRUB 3V7YA 2WHXA 1UEJA 4LXUA 3L0PA 4XWYA 2OLEA 3S2FA 2OY0A 3PIRA 3E82A 5EIBC 4AF8A 3J7AC 1J24A 3E5NA 1UMBA 5ADUS 4ANFA 3JWJA 3SHQA 1Q0PA 1YR8A 4GUAA 2MHCA 2A0YA 4F3CA 4MKRA 7YASA 1OIVA 1W7AA 3K72B 4BNDB 3O1JC 2ZANA 2QRZA 2VHUA 3A2NA 3M6LA 4AMUA 1ZRMA 1JV2B 5B3JA 4BIMA 5K05A 4MWOA 5DGCA 3N59A 1GSHA 2Z6QA 2UYOA 3WY9A 1O0CA 1LDYA 1A96A 2YC4C 4QOFA 5MDHA 2C84A 4IOJA 2UZ4A 1UT8A 2P6MA 3ICWA 1ZO8A 4NZPA 3VA7A 4JI2B 3RUEA 3JALA 1UCFA 3UNXA 1WDTA 1LBEA 2VCYA 5E7JA 1BMTA 1Y6GA 1QGAA 2OGZA 1G7CA 4ZT7A 4UAUA 3DPSA 1ZK3A 3BJRA 4KFTA 4Y2VA 4RKRA 5K4AA 3FOEC 3ZK8A 4P3OA 5HIAA 1YS7A 4Z1MD 1F7VA 2HCBA 3FYUC 5ALOA 3U80A 1FUEA 2VBGA 4L5BA 4LY6A 2MTBA 1EJ6A 2XBUA 4LXHA 3MWDA 5LL6P 3IT3A 4YAUA 1JEOA 1BXZA 1J7KA 2IYSA 3L1HA 3RVPA 1G98A 3VR2D 1ADYA 2B1RA 1NL3A 3SC6A 3ZLBA 4BVKA 1TW3A 3OUUA 4QJIA 2DJ5A 2X9VA 5FEMA 4C5AA 3SLGA 3AK4A 4MEBA 4PFSA 1HC7A 3DFKA 4RPJA 4Y9TA 4R8SA 2FDRA 3L7JA 4FEAA 1LI5A 2WTBA 2AMLA 5LDDC 1SUFA 2MR5A 1N6NA 2X0RA 5HK9A 3VOBA 4YH1A 1MMFB 1YZKA 3ECSA 3FPKA 3F9IA 4AQDA 4CXMA 1G2OA 4F92B 2E82A 2J3LA 3ONNA 1BW9A 4KBYA 1V95A 1I10A 3V7NA 2QJFA 1GPLA 3OJEA 2ZUBA 1P0MA 2KW5A 3P9ZA 1B8PA 4O4JF 4OHPA 4QBIA 1I2CA 5LBTA 4X6UA 3DB1A 4AI6A 5TB5A 1C9NA 1KY4A 2J9GA 4E3WA 4BASA 1GQ2A 1MJGA 5EWMA 3LQQA 3CUYA 3L0DA 4XOUA 4YRIA 1JKFA 3WGVA 1I4DD 4V02A 3ETJA 1FPQA 1G5RA 4MW9A 3LKBA 4WXEA 4CEHA 1G0NA 3FKJA 3HVKA 3O47A 3SX2A 2BAGA 3CUSA 1SIBE 3O73A 3TOSA 1P7CA 3EJ6A 3ZTWA 4NPHA 5DEIA 1SVLA 1ZJ5A 2XUPA 3WGGA 2AX4A 1M2EA 4BNHA 3DDCA 4DG8A 3VU9A 5BSVA 4I1VA 3VTFA 3RC7A 1D9ZA 5AVWA 5ILOA 4QC2A 3L18A 1RRGA 3R7DA 2Q3EA 2W2KB 1P2GA 1NW7A 4RH0A 2FDCA 1HFKA 1YCDA 2CB9A 4FD2A 3JVEA 2JLCA 1T6NA 2Z4RA 2F1IA 4Z7OB 3VKFA 3UJ7A 1T10A 2PRJA 4CCWA 3IQHX 1F8YA 2XQGA 3UOGA 3A2KA 5JJLA 4J0DA 2NU8B 3ZY6A 4TXLA 2X1MA 2W70A 4MXDA 3JWGA 4J8PA 5ALQA 1LFAA 2XZTA 5L45A 3MQ2A 4PZCA 2TS1A 3PP8A 1DTWA 2XEDA 1GUYA 3KCQA 3L8YA 4Z7QB 1GCOA 1NBEA 1VP3A 4DMUB 1ZQ9A 4H35A 5GONA 4KPEC 3QBTA 1ONSA 4DA7A 4M1KA 3G7SA 5KNCH 1A71A 1HZZC 4F6CA 2XCRB 3K2IA 4PZZA 1PBNA 1ZGHA 4RORA 2R6R1 2UUPA 4ABYA 3FIJA 3E6AA 1NW3A 2ZR9A 4FJ2A 4FSDA 2E87A 3JAKB 2FP3A 3LBFA 3D2AA 3OE7A 4F3NA 1UAYA 2LKDA 1DV1A 4MV9A 1SBZA 1KP9A 2I3ZA 3C3JA 4PLTA 5JZSA 3AHHA 4A6EA 5IZCA 1BJKA 1UWCA 2MYTA 2A30A 2QJRA 3KZKA 3TXXA 5IJ0B 4LRUA 2Z3WA 3NGLA 121PA 4HS9A 2ZB4A 1PV1A 1RC0A 1Q6YA 3M1LA 2F55A 2JIMA 1JFFB 1T9AA 3MCTA 4FJ1A 1M5RA 2Y9MB 5TT0A 4UTZA 3ZWKA 1Z13A 3V4PB 4RY2A 2FCRA 1V4BA 2OBLA 2WZDA 2AW3A 4ZQIA 2Y1DA 4AURA 5I9NA 2P9QA 1GRVA 4QSMA 1OJLA 5DBGA 1AU9A 2B5OA 2P6PA 3B6ZA 1PGNA 1O2DA 1PT6A 3RHSA 4YY3B 2ZJOA 5DP2A 1XMXA 3EWIA 3FBWA 1V1JA 3OA2A 3UBTA 4INJA 1Y89A 5DB4A 2IYLD 1J4LA 4J2TA 4POAA 2V5AA 5LQMA 3VYWA 3OI7A 1HQYE 1JL3A 1W35A 3OURA 3MBIA 4II7A 1VL0A 5DXJA 2VIIA 5EYPB 1ZGZA 4IIFA 2O5CA 4LQDA 4KACA 4NBSA 4MVXA 3EPPA 4CKXA 5COQA 4JCCA 4AAYA 2B21A 3J81k 5LD2B 1T9GR 3I1JA 4PV7A 3V9PA 2FPLA 5J9FA 1KKUA 2RC6A 2YCBA 4M4SA 5GP1A 3RO7A 5TT1A 1WZ2A 1E0KA 1RXYA 4JONA 5FOXA 3OTQA 3NXSA 4WDRA 1ISRA 1UXGA 3DR5A 1JIKA 2HCRA 3OTWA 3HVRA 2PJDA 2RH5A 4DR6B 3HJFA 4RWEA 2FPGA 1QQ7A 3KS9A 3OE7D 1KMCA 2ZWVA 2F4VB 3FB1A 1NPTO 2JIRA 2BFDA 2REQB 1YKGA 3GXOA 1CTQA 1U4OA 3L6UA 3NC4A 3OIWA 5G1OA 3ZHOA 3ROGA 4B34A 1F6WA 5JERA 4HP8A 3ZXXA 4G0XA 2OQRA 1SBQA 2WJ3A 4RA6A 2DUMA 4X90A 1VHJA 3E5MA 2AMYA 5TGTA 3TL6A 1CCWA 3AY7A 1Z73A 2OBYA 4R16A 1I01A 4G81A 4ZAYA 5A05A 5DISB 1USWA 4NU8X 1W4RA 4XAQA 1N1GA 1E96A 2BFMA 4RIEA 1UBCA 4OXRA 4FINA 4KGZA 3DT8A 1D4ZA 4RIFA 1KZ7B 2FB9A 1ZIPA 2BFBA 3GPBA 5G0SA 2JFZA 2Q9UA 4WY2A 3ORFA 4KP7A 5BSKA 5EJ7A 4B48A 3GMTA 4GLJA 1BAPA 1RYFA 4GXTA 3UFXA 1RLIA 2NV0A 1TFUA 4RESA 1WD5A 5D5PA 4RQUA 4ZAZA 4F5EA 4LOJA 2FA9A 3AFMA 3U81A 4YCNA 1NMXA 2JCVA 4OQ4A 4OP3A 3R0VA 4PSUA 1NVTA 1O94C 4WDQA 4XGKA 4B84A 2ZXFA 5ED0A 3HVIA 4ZTZB 3D8NA 1B1AA 4BNFA 4CFSA 5CFPA 4N1AA 1WETA 3DDNA 1E79A 3DVRX 1W1WA 1Z5NA 2HA5A 3E5HA 1Z25A 4MP3A 3RU7A 4OXIA 4AK9A 2UU9B 4XVRA 2OZVA 3PC3A 3QQPA 3OP4A 2EJWA 3LZCA 3COPA 2XNCA 3VNRA 3ZWCA 4YV1A 4XARA 3Q2OA 4WBNB 2AI2A 4RUKA 3UATA 1ABFA 1UEXC 3W9YA 2DBYA 3CXUA 1CY2A 4CQNA 2IDKA 1F4LA 5EVCA 3LO5A 1LDBA 3CZAA 4MQFA 4J4TA 1P8JA 1UBTS 4UHEA 1FUIA 2VDVE 2X23A 3LSTA 2XWPA 1OA1A 1G6Q1 2P65A 4RGVA 3LUPA 1H2EA 4KMRA 1RC8A 3OOYA 2JGNA 2F2TA 1OHHA 1XL0A 3L1KA 1TO6A 1U9IC 2OHIA 2BFFA 2H2DA 3ISJA 3NEAA 3G7UA 3QVUA 2JKVA 1PGPA 4ID9A 4KYTA 3WMXA 4MVJG 1XNHA 1W0CA 2VNJA 4PLYA 4UHCA 3RRBA 4NMMA 3Q6IA 2J5KA 1NVWQ 1ZR4A 2Z3VA 4Q00A 1N6KA 5CG1A 2B4KA 2DE0X 5IDWA 4IIEA 1LW7A 2RJNA 3WKDA 3TFOA 4I4LA 4B4WA 1GZ7A 1ND6A 4E5SA 7REQB 3W4JA 4PPNA 4YJGA 4BN5A 4RF5A 1ISPA 1P1CA 1F8UA 1LLFA 2AX3A 2FEOA 1NMEA 2MSWA 3C3EA 3CF4G 3DM9B 2HMVA 3ND9A 4NF2A 5AOBA 3BHIA 1E79D 2GDZA 2PZEA 4DLWA 1C0LA 1YD7A 2NWQA 3LOUA 3CNOA 1T91A 3N2KA 4FLFA 4PVDA 5K0BA 2AYXA 2GJKA 4Y9SA 4ZO6A 5H7XA 1XI2A 4BMDA 1GXCA 4C0BA 2XUJA 4I1IA 4Q4AB 1CRPA 3KDPA 4FEGA 3QVLA 1EWVA 4J7XA 1IRXA 2P9JA 4JITA 5JEKA 5IVKA 2G82A 4CHGA 5CH5A 4DJTA 3JYLA 3N05A 5F3RA 2IELA 1S2OA 4RW0A 1QVWA 5EMMA 2PSDA 3U6BA 5SY9A 1G8HA 4C6TA 3M6VA 1FS6A 3NATA 2G5CA 3EC1A 1TYCA 4H31A 1OHHD 3WO1A 3KPUA 4F2PA 1P4AA 2HJVA 1ZOIA 3LBAA 1HA3A 3ZHVA 3G1UA 1HLGA 3VSEA 5CITA 5HVNA 4C0KA 1MPTA 3ENQA 2DFDA 3WGOA 4FIDA 4Q9DA 4R7GA 3D6VA 4ZT2A 4YRAA 1EAMA 1YHYA 2PZ8A 1UPFA 3KYBA 2W93A 4BZZA 1USKA 4IMPA 3ANXA 3OKFA 3JZFA 1KVRA 3GMSA 3KD3A 4MVJA 3KE9A 4NWIA 5FT9A 5JELA 1MEOA 2A88A 3OPYI 4QICA 3BFPA 1JSXA 1RHRA 2BCGY 5E3IA 3U3DA 2EW1A 5JE8A 5AW6A 2W42A 3QW2A 3FVTA 3NHSA 4H0NA 3HZZA 1L4LA 3S5UA 1V71A 3E8MA 4YXWA 1Z2OX 3RK1A 1AT1A 1JJVA 1K88A 3BDIA 4EITA 4D4GA 3LF1A 5I7VA 2UZ0A 4PAGA 4PX2A 1KO5A 4MW5A 4KR9A 5C8YB 1CEQA 1MNQA 1VP9A 4UCXA 4CEJA 3FZNA 2O8FA 1MR1A 4PLPA 3WBJA 3ZQUA 5JEOA 2PAAA 2FWRA 4IWYA 2YN0A 3CV3A 3I8OA 1Z6QA 5DWDA 3ZIAD 4CEIA 2NT4A 3GJ5A 1AH2A 3NHWA 4D6XA 3STHA 4KQGA 1P3JA 1JTFA 2FZLA 2VZLA 1Z17A 2QZJA 1DQZA 3SF0A 3GRCA 1SVMA 3VPFA 1OQAA 1C80A 3HKDA 1CUUA 2GFIA 5EKDA 2Z6UA 3R4CA 1CZLA 2XHEA 4KQIA 4GZLA 3S2SA 5K3EA 3CX3A 2CXTA 4PYNA 3CIFA 3HUDA 3MJRA 4RV5A 4DLZA 2VT7A 4ZVKA 4TYMA 2YIMA 3TI7A 1ZN9A 3FHCB 4RSGA 4TROA 5EHQA 3N8NA 1OAKA 3TYXA 5FUQA 5HRUA 1ESZA 1YULA 2Y1CA 3D3NA 4AZVA 1SC1A 1NXTA 2OEPA 3D4PA 4FLEA 3SXUA 3TG2A 1EG7A 5E6UA 1DAOA 4FS8A 5BYKA 1S2LA 4TTAA 1D2CA 1XZGA 2XOXA 5MN4A 1UBLS 1WXIA 3RSQA 1ZU5A 4GKBA 4MVJD 4F5YA 5J3JA 2YCLA 5ALKA 4L72A 4DARA 3G7NA 4IG9A 4QQ8A 3CH7A 1NSYA 1PF7E 1U02A 2WF8A 5ELLA 4E15A 3AGQA 3O7MA 1C9EA 4TVOA 1Q5PA 3GLVA 4MQBA 1G41A 3JATB 3P52A 1K2NA 4PYMA 3I2GA 4U2EA 4YJ3F 1KP2A 2VJBA 2DFPA 3H5NA 1H3EA 1DKOA 5DGXA 4N39A 4OH7A 5IDYA 2NUBA 1JXQA 3CWCA 2PVSA 4BUJA 4YXWD 4CE6A 5AKKA 1NQWA 5TQ0A 2P7HA 3VTZA 4D9FA 3H5WA 1VLMA 3ZLUA 2C2XA 1COWD 3F6PA 1JEQA 4B47A 2UZ1A 4GLLA 4BNJA 5B6JA 3TMAA 5HCIA 3ADKA 3G88A 1DIAA 4LGCA 4DWOA 1JYEA 2BM0A 4KI7A 1CJVC 2DY1A 1JHDA 2JGRA 1VB5A 2ADOA 2YICA 1MKYA 1DAEA 4UTXA 4O4HF 5HMLA 4M0CA 5M04A 4QPJC 5DNVA 3WL3A 3P0HA 4C43A 1HYBA 2PNFA 1BHSA 3AP2A 4GM4A 4S12A 3ZU3A 3GRFA 3RC3A 1ISFA 1KI2A 5ECDA 1GT6A 1KIFA 1SO8A 3W5UA 1F48A 2Q1WA 3VNAA 4NJMB 4PC3A 2ERXA 4X54A 5ALLA 2EZ9A 3DWGA 3FUWA 3NXKA 4TQ9A 1PGJA 1Z38A 2DQZA 2ZT6A 4IXWA 4MLPA 4C0QC 1C30A 1HSZA 2C2GA 2C3UA 2R1UA 2V54A 4LJLA 4ZDIA 3CNQS 4Z4QA 5FLEX 3FBGA 5JMOA 4MSUA 3KJNA 2PSSA 5I3CA 3FWHA 2OPBA 2J9ZB 3HJGA 3OEWA 3PTZA 4S0XA 5BQOA 1OFGA 1DXYA 2WPDA 2PYDA 5BWMA 2G5TA 2HO5A 2XYGA 4AX8A 1CZUA 3TD6A 3KC2A 1J4PA 5A0FA 3M5CA 5CYOA 2QLLA 4BQFA 5IEBA 3HDHA 3PT5A 4Q19A 3OZIA 4RV4A 4UEOA 5AFSA 1KSJA 3BD9A 1TZ2A 4F45A 1SZJG 1N2JA 3OU6A 2O2CA 3JQBA 4RYLA 3AHGA 4MCJA 1P7PA 1ZMBA 4IDQA 4Z86A 3ZJ5A 1UC5B 3PE3A 5E8JA 1J1UA 1MCZA 4EA6A 5DW3A 2XADA 3N2ZB 4GOOD 3R7NA 4R98A 3D6JA 3K05A 1N7GA 1U2GC 2IYNA 3DE1X 3JQCA 1X19A 2AOTB 2IU4A 1JG2A 1JE0A 3WV5A 4MUBA 5WRFA 2BR3A 3VNBA 5CLLA 3AJAA 2GM4A 4R1LA 3LXUX 1X3SA 3P19A 4FKMA 2FZEA 2R62A 4F72A 1NUSA 2YKGA 1PP4A 1VQ1A 3L6RA 3OU2A 2C4MA 1YXMA 4Q9JA 1L5FA 4NU0A 4BNMA 4ES6A 3FZGA 4IDGA 2I2WA 4IBOA 3OQPA 5KSYA 5CMLA 2XQVA 2J0UA 4K8RB 2Z2YA 1JDBC 4OB7A 3MGGA 4M0FA 5G40A 4B8WA 3W8FA 1EVZA 2XNDA 3BWVA 4OQQA 2CE2X 3HK2A 3V33A 5AW7A 4TYYA 3EF3A 2HIGA 1A04A 2Q2QA 3DDHA 1F17A 2PY6A 4R2XA 2Z2JA 2ZI5A 3TECE 3IUJA 1T9DA 1BHO1 3FM9A 3IBGA 5BYJA 4X1KA 5FI5A 2XECA 1L5NA 1XXLA 1TIBA 2JQIA 1KK3A 1Y1SA 5AJYA 1HE2A 2OD9A 3TLJA 3F98A 5KVQA 5KMGB 2HWUA 1MW9X 3CE6A 3KZCA 4LTMA 5TV2A 1KK1A 3WZMA 3H9EO 3F78A 5C7OO 2NTJA 1S3SA 1AK2A 1KARA 2CXOA 4ZTBA 3T9CA 1ORTA 1V4NA 4COKA 1O6BA 3GLHE 4RY9A 4HWOA 3EQ2A 4QUIA 3KCNA 1FP2A 3KDAA 1U5BA 1VPVA 2EFEB 1IDN1 4N3BA 3Q8KA 1VYUA 1JBEA 2AD5A 2CGEA 3ZJTA 5A4FS 1JT9A 5EHGA 1VSQA 1X7WB 3U3XA 1MVOA 4BNZA 3DLPX 1UINA 1ZS9A 1I2BA 2OLKA 3KT0A 2WLTA 2D8AA 3MXOA 4PYKA 2HF8A 3CRVA 4LBVA 2ZIXA 3WJ1A 1FDSA 3RC2A 2O8BB 1PJ2A 1ZN8A 4OMUA 3JVUA 4DJFC 5K2MA 1RAHA 2RHHA 3G2JA 3RIMA 3TLGA 2Q4OA 1LFDB 3A1WA 2IXFA 1QYVA 4QDXA 4J0HA 4WOKA 1SB8A 4G0WA 3HB5X 4RFSB 1EVEA 4LE2A 3DZ8A 3LY9A 4Q01A 2REBA 1JYFA 1UDXA 4OBWA 1Q7CA 3OQBA 3GZNA 3T54A 4G2SA 2QQEA 1LLQA 2ZRJA 3GGPA 1E5TA 4GXNA 4F9TA 3SDBA 4ZCMA 4BRSA 2XNDD 1ZGBA 5FORA 2HYIC 1CX9B 1I4TD 4G5FA 4ZI7A 3FE2A 1D0SA 1T9KA 3A9UA 4ETIA 3EMDA 4QGGA 1G63A 1KR2A 4UUOA 5FPYA 1YRQA 2FW8A 2Q9AA 2WIBA 3WYDA 3VGPA 1IJEA 1JLLB 1W0JD 2C1ZA 3BB4A 4PC6A 5EJ9A 3PQ6A 2EBFX 1LPPA 4W5RA 3FCSB 2AI1A 1F4PA 2J3QA 4TZTA 4UCQA 5C0OE 4Z51A 1OGIA 3M2PA 4DRXB 5I9LA 4Q1CA 2QTHA 3B9RA 2K87A 4OJQA 4RY8A 4ZOBA 1Y4SA 1PTJC 3WGIA 3PWZA 3CN9A 1YBVA 2H31A 4ZIRA 3CEPB 4IXNA 2XRMA 4YRQA 1E20A 4I55B 2ZYSA 3HACA 1YB1A 3ZHZA 3VZPA 1A5TA 2DFNA 1G8JA 3FFXA 1E1NA 3IE2A 1SU8A 3L4EA 3E22B 5CEFA 4KKXB 2FXIA 4PX3A 2PMEA 4D6PA 3H4MA 3EOZA 1F1BA 1JPJA 5EKSA 1DP4A 2MYPA 3GJ7A 3JWPA 4RCYA 3TK1A 3FNBA 3QFRA 1VMKA 2I4RA 1KA9H 1TIKA 4XIGS 5DTQA 1Z0ZA 4TVSA 5GINE 1OXTA 4UM9B 3OETA 1RHMA 3PUKA 5ES3A 5F2OA 2Y2UA 4D96A 1XNQB 3R20A 1J22A 2C3OA 4HVAA 3RVOA 2OQVA 3VVLA 4D8YA 3MD9A 1OVGA 4UZSA 5KX5F 3IJ5A 3K70B 1XTRA 2QG9A 4JYPA 2XE7A 4FBGA 3LTNC 3DDZX 3RS8A 2QUHA 4EI2A 1RSZA 1XDUA 3ESCA 4JA2A 4D4LA 3CTMA 1R27A 2HJ9A 2ZBEA 1Y34E 2H4FA 4J91A 4RTPA 1P4GA 2CK3A 2OZLA 5EP4A 3FOZA 3L0CA 4U0JA 4WJKB 5ALMA 3DZKA 3KBOA 4MA0A 1G59A 1ZD9A 4RSMA 3KL2A 5G4KB 4BMCA 2AOWA 1A7KA 3IPXA 1UZLA 2CLDX 2HWKA 5LP6B 4MMXB 3HFGA 1FY2A 3F47A 5A9TA 4NOMA 1BO6A 5F73A 3CEJA 1B6RA 4MIKA 4MYSA 4E14A 4Z4CA 2QIPA 5LUAA 5EJ6A 3IKJA 1TYAE 1GCUA 4BX8A 4WXMA 9LDBA 1TCAA 4OHVA 3FFTA 3U0VA 4NE2A 2YW2A 2EZ4A 1XHLA 3PXUA 1UZUA 3L6OO 3MERA 4ZCTA 1EA5A 1P19A 2ZU0C 4CZ2A 1NBOA 4HDOB 3GA7A 5D6NA 3G0BA 3I9LA 4UM7A 4D44A 1U0OC 5L7TA 2YYAA 3H83A 2WWHA 4QVKA 2B30A 4BEJA 3E35A 3G23A 1ZNXA 2BFCB 3GUZA 3I9V1 4NZNA 4B45A 3L06A 4DIEA 5A4IS 3MJVA 1P31A 1ZEMA 3FNGA 4JUCA 4LN1A 3STVA 3I32A 4NS1A 2DT8A 5BQFA 4ZFNA 3W9SA 1N6HA 4NAHA 1YS1X 1VCHA 3GLTA 5EXSA 3TZLA 1LU9A 3ZC3A 3LOQA 1OAOA 1S3GA 1XRQA 4EL5A 1SVWA 1OX6A 4RD3A 3KQKA 1L5MA 3T7RA 3IHTA 2WD8A 4HDRB 2CK3D 3KD2A 1NPDA 2PEZA 4PBRA 2JFYA 1AKRA 3IV9A 3RC1A 1T0HB 5HJ5A 1NP3A 1U3TA 1VIDA 4TMWA 2I4TA 2C1EA 3CVJA 5J4HA 5JI2E 1GPKA 3GOHA 1BXGB 2QRPA 3D6FA 2JI7A 3K30A 4JJ7A 4BQSA 4YLYA 3P0IA 3P71T 2FOLA 4BVAA 4M46A 3LHSA 3ZCTA 4F7DA 1WMDA 3K6SA 1NSFA 1M0SA 1JA9A 1RYYA 1VJCA 2ZS9A 2G06A 2WYOA 3V8RA 5L4LA 2XGMA 3GJ3A 3DF7A 4X3OA 3F7TA 5HQJA 5F76A 3PXCX 3E2PA 4J0FA 5LLTA 1M34A 2V9CA 1ES9A 3DP9A 2RDMA 1DXHA 1YDEA 3K94A 1P29A 1SAYA 1QV9A 3OHPA 3O0TA 4BPBA 1LDEA 1OLOA 1T5IA 4CKBB 1MB2A 3AI1A 1P39A 2CW5A 2EP7A 2JI6A 2OCPA 1XNJA 4YRJA 4A0RA 1EVJA 1BKYA 2WLSA 4UHFA 2EKLA 3KK0A 4NBWA 4V0RA 5ER6A 3TNDA 1TRHA 2PCJA 4MQEB 4DA0A 2H5LA 3NYWA 2X0KA 2X8BA 2XA2A 3I6BA 3T3HA 1XZAA 1Z6AA 3QXJA 1FMLA 3H3FA 2C98A 2MT9A 3P2JA 4K88A 5L6MB 1W5TA 1Y1PA 1UZNA 2DBVO 2F3UA 2GEJA 2OVBA 3PWTA 4I55F 4WZBE 4OMDA 3C3KA 2IYEA 1IULA 5EQTA 2JCGA 2XMRA 2AB0A 4WCFB 3PFNA 4GBJA 1YQGA 1BMDA 3IPLA 1UFKA 2XT0A 2X0EA 3KT3A 1KYYA 1CDOA 1WTAA 1QZ3A 1CQXA 1RQLA 1SQ0A 4OLHA 1J2UA 1R50A 1D9XA 3THOA 1EDEA 10MHA 3L77A 2YYYA 4D9NA 3V1MA 2HA2A 5LM3A 1KSHA 4BLRA 4NECA 3A1SA 2PBZA 4C5CA 4X44A 3FROA 3Q3JB 4NOKA 1JAXA 2BR5A 1TA4A 2HJWA 1VIYA 2ZT8A 4LDNA 4KPGA 1L5HB 1FUKA 1HDYA 3W5BA 5EWJA 3UBMA 1DRJA 2FAXA 2QVCA 3MFYA 4JNKA 3RVBA 3WWZA 2BY4A 4QLAA 4HZUA 5D5HA 4ZMBA 1VA4A 4OQFA 2NU9B 2OV2A 2XAAA 3FPHA 4TV9B 2E7ZA 4G8CA 5DHAA 3ILYA 1DX4A 4Q18A 4IKPA 3ZKAA 5K45A 3QTTA 4HS4A 2OBFA 5I9TA 3CG4A 5M3BA 1TMGE 4JVSB 5DCWA 1HL3A 3PUIA 3SXJA 3UCXA 2DCMA 4H18A 3K9QO 4PFQA 1W5SA 3WHPA 2X40A 1B3BA 1Z6PA 4EF4A 2X58A 1A27A 2YDYA 2GI4A 1HLPA 3H2YA 1PT7A 3F74A 1SXQA 1TDJA 2AFHB 3ZD7A 3Q3VA 4PN7A 3V32A 1YCHA 1G60A 2XB9A 1OB5A 1SZCA 2BEUB 2HFJA 3FVVA 5IULC 1KDOA 1JA0A 1ZY2A 2FGJA 2VYCA 5ITZA 4DV1B 3H8VA 2VA9A 1L4EA 2Q5FA 5JNWA 1BCSB 2FG5A 3NHAA 3CINA 4A8JA 4FQ8A 3HQ4O 2JGMA 3G8BA 5ILQA 3R40A 4AZTA 3O4HA 4BNYA 3TDMA 2X6QA 1MZVA 4ZEWA 4G0VA 3LJKA 2HA3A 4MDEA 7AT1A 4M21A 2PX8A 1CLEA 1IVYA 1CUBA 3GG9A 1G64A 1RPAA 1XRJA 4XDGA 3RG8A 3SSNA 4HSEA 4HAZA 2GZSA 3ZDXB 4IX1A 4IMRA 5DTEA 1NONA 4EGFA 1QIHA 5P21A 4Q21A 1MAWA 4O29A 3L05A 2Q9BA 2KPOA 2JFVA 4IHAA 5ESXA 2WMOB 1MVNA 5D3MA 1FP4B 2C4HA 3OJLA 4ZANA 4J6FA 4CMBA 5CFLA 2A4KA 1SG9A 2FQ1A 3CRRA 1B93A 5EEHA 4Q3AA 4R54A 3GYBA 1GTSA 3D3JA 1LC0A 4F91B 1KJZA 1WZEA 2W58A 2GK4A 1WXWA 1L9XA 4GYYA 3GGDA 1U0BB 3KJQA 1VBMA 3LT2A 2EJTA 4AS3A 2ONCA 4FYMA 1U7FB 3D4IA 4PZYA 3BMNA 4Q3DA 1TLFA 3F4LA 1XLVA 3H42B 3DFIA 1YNOA 4Y0VA 3P20A 2G04A 3NBFA 4HXYA 2FZKA 2X8AA 4TUYB 5A0TA 3U4IA 3AESA 1AUQA 2PKQO 4CKWA 1M1XB 2EGUA 2FSGA 2ZJ1A 1ZBDA 1AB5A 1XNGA 4HN4B 3REQA 3UK1A 4BKRA 2QRJA 5BWLA 2ZCJA 4HC4A 2FEPA 1LPNA 2QM7A 3MPUA 5L7YA 5IT4A 2G0NA 4P36A 4P82A 1UM8A 3E0XA 3IILA 4ZPJA 3UK6A 3MHTA 2EL9A 3SXPA 1ZGJA 3O4VA 4MUAA 1GR0A 2XUIA 4PZ0A 2I3BA 1WPGA 4LXQA 3T7TA 1NJGA 5KVSA 4RHTA 3A4LA 2FP4A 2YWHA 5F9HA 1J49A 3IEPA 4O3MA 3QX3A 2V6FA 3K1AA 2OUIA 1PJSA 3G0DA 1YVDA 3DC7A 1VLLA 3UMGA 3T1QA 1CY7A 3BFKA 1J0BA 1OGYA 3M34A 5B1HA 2BEVB 1FX0B 2C58A 2VWGA 4Q6WA 4U5XA 4KV9A 5DE3A 9ATCA 2XYHA 3AF3A 1QHXA 3P2EA 1N5OX 1VE1A 4F96A 3CG0A 5G1NA 5AUNB 4WNCA 4D0GA 1I5EA 3IOEA 3LQFA 5EP3A 5DHUA 2QGZA 1PDWA 3O93A 3SK0A 1U7VA 3JRXA 2PEYA 3QSYA 5DGIA 2GBFA 1XCOA 4PGMA 4GR5A 3T3MB 3KU1A 1Y1RA 2FSHA 1AA6A 1EVQA 4XUEA 5FOUA 2PO7A 3B7WA 3DZDA 1FLNA 3VR4A 3WMFA 1E5DA 2EH0A 1GUBA 4YECA 1ISSA 4J3JA 3SJBA 1S0UA 5EHNA 1H4VB 2QZ4A 4RZSA 3LQ2A 3FRJA 4QFMA 3C1OA 3IDZA 3PCXA 2J6BA 3IT0A 1FC0A 1E0DA 1JALA 2BOVA 4R0NA 4AD8A 1W1IA 4DPKA 2E1PA 4PRKA 2JQJA 2GK3A 2AZTA 2WNHA 1KZ1A 3EVDA 1VKRA 1KRXA 1WWKA 5GJWC 4D99A 1H6BA 1Z4IA 1JKIA 1EUDA 1XCLA 1MC4A 3K0CC 4OMCA 2FETA 4WLUA 1UAGA 1AQIA 2IHUA 2DZDA 2EYQA 2OFOA 3DW3X 1N4DA 3EEBA 5DZSA 4Z0PA 4M98A 3WGHA 1BS1A 4FWBA 4F7WA 3MAGA 1UXKA 5KC9A 2XZDA 1MK2A 1NJ2A 3DE6X 3F6EX 1SKYB 5JANA 1LGPA 4UQPA 5CNIA 1YFKA 3BBPA 3DE2X 1T2VA 3IKMB 4MQ4A 5AM2A 3THWB 5IC5A 1TF7A 3UUGA 3G2HA 3OCWA 1G5TA 4LW8A 1RRCA 3CZMA 4RHYA 1FVOA 3AQ4A 4K28A 3T34A 4Q7MB 3EJWA 4AT1A 2QGFA 3I30X 5K0GA 1L0BA 1KI1A 4KE9A 3TTVA 4AO6A 2XMPA 2PMWB 5FWAA 4C06A 2PH3A 4EKNB 2P0AA 3QHPA 1XR3A 4RX1A 2W4MA 1JLMA 1RJWA 3W5IA 2Q3JA 2JGLA 4MYDA 1C7IA 1Q1AA 3H4VA 4BRWA 2ZW9A 4LMPA 5KYWB 5E1BA 5DNEA 4I5GA 4N41A 4CCSA 1FW6A 3UIEA 1F4VA 1TAQA 4ZQBA 1RZRA 2XODA 3VSBA 3D8BA 4HJXA 4LFCB 2A5YB 1B8UA 2JAWA 3WGNA 5LNK1 5CA0B 4J76A 1NLYA 1VMDA 1WLSA 1R6XA 3GJYA 1V1RA 4P3YA 5DLDA 3UZUA 4TQAA 2BGRA 4YRFA 3U9LA 2VDNB 4BV8A 5K99A 4W1QA 4RS3A 1Z06A 4KSYA 1XJWA 2BT4A 1AS3A 2ZS8A 5EMLA 3SY8A 3UCFA 2KB0A 2H08A 4MGYR 1Q0QA 3REOA 5BWCA 1FNMA 1QZUA 3U2QA 1R64A 3KEFA 5LIRA 5IUJC 3EGXB 1LKZA 3MWGA 1OTXA 3TEMA 1MZPA 2J3MA 5CB8A 1QYCA 3NAGA 4WGFA 4YV7A 1C1XA 1A8UA 1PNQA 3JZMA 4EHHA 4JBLA 2JLYA 1UEIA 2Q41A 2IPLA 5C3MA 3FWZA 3T7EA 4MQ6A 4IQ4A 2A4MA 3ITNA 1SKAA 5ICCA 1E18A 1CETA 3KB6A 4LF6B 1JFSA 1GG9A 2VS1A 3CZCA 4BFWA 1JHXA 4BMSA 1USGA 1J2FA 3G68A 3HABA 3O03A 1RYDA 2EIHA 7ADHA 5DKFA 5IFLA 1M6EX 4HAYA 1ITZA 2Y27A 2D0OB 4BMOB 1QHHA 1V45E 1ZH0A 4IHKA 4O2AA 2IZ0A 5I51A 1XELA 3WAJA 1QCCA 1L8XA 3SHVA 1T5SA 4OK3A 4ZI5A 4EG7A 2F43B 3FCOA 2CZGA 3P97A 3G1TA 5DFAA 4DIUA 3U6KA 1RZRD 3RKSA 3FGOA 3HFJA 1W581 2ZWIA 1N6LA 4JUDX 3HE3A 4FYPA 1LBSA 1W47A 2XF8A 4BQOA 2VJKA 2WP8J 5GZ3A 1T3ZA 4C20A 1JSCA 3HUFA 3ORYA 1UMKA 2WK1A 3IJRA 3QOWA 1SH7A 1BSVA 1GNQA 2D7JA 2P8SA 2ACWA 3F8SA 3MGAA 2FFBA 3A1NA 4WKGA 3UA4A 3X43A 2ZR7A 2XTNA 1FDRA 3WQQA 4TKMA 4N03A 1TZKA 2XRFA 1U0JA 4LDRA 3PD1A 1KI3A 1L8OA 1OASA 4CM3A 4CBVA 3N2IA 4RKQA 1QQAA 1LTKA 3CUVA 4RELA 5CA1A 4GM0A 2VJMB 1E8MA 2REXB 3EQ6A 1E7RA 3AFNA 1G5PA 2FPWA 4Q1BA 1WBBA 3OZXA 3KWJA 4R0VA 1Z4OA 1HL7A 3TRKA 5DT2A 3NT4A 1JFVA 4ZODA 4BRUA 5DM1A 2ZT5A 4TSKA 3DM5A 3A77A 3GGOA 1T2UA 3EIUA 5SYMA 8MHTA 1YJAA 4Y1RA 4DJJA 1NXOA 3C6BA 2IYQA 3KHUA 4U7PB 4XJVA 5EERA 4IWXA 2QL5A 1K89A 4P32A 4E13A 1ZPDA 1FMJA 4ZVQA 2VP9A 1Z22A 5KJEA 3LCMA 3ENKA 4RD2A 1A7JA 1X42A 1B00A 4MP8A 4XJXA 4AZ0A 1KBQA 4KR7A 2V9ZA 3VZBA 2H5EA 4G97A 5BOVA 2Q5HA 2FY8A 4PRYA 4RGQA 5CU7A 4D02A 2IHVA 1T5BA 2WTXA 1BWRA 4AKEA 4QYIA 4ZAFA 1ST2A 3LUKA 3G02A 4F56A 3ILXA 1DRVA 3O2SB 4RAQA 5JRDS 3GVCA 1OKKA 2X3FA 3DO5A 4RIGA 1QP8A 4G9EA 1ZJZA 3HO1A 1NATA 3TJRA 4CPDA 2FFHA 5EIHA 4QGSA 1EFAA 5AVUA 3EC2A 3O75A 5AM4A 4FNGA 2C42A 4Y9UA 3ND7A 2NO9A 5AI6A 1DIRA 4L3VA 1MJ5A 1UZAA 4HMOA 1RCFA 3EHEA 1Z63A 5L3ZA 3NUQA 3SR4A 3DO8A 3B5EA 3I39X 2WVJA 4MTLA 3IRUA 5J2UA 1FUUA 2H1OA 4PHCA 4GMKA 2AUMA 3QA9A 1CS0A 4IFIA 5JWRA 1XTZA 3D7LA 2D1YA 2SBTA 3B7PA 1FNCA 3PGJA 3ADCA 3HL0A 1NXVA 1P1IA 3KDSE 3USES 4F2GA 2NZUG 1XMQB 4DW8A 4EYKA 1IWOA 2G4VA 4GKAA 3EEIA 2ECKA 1Z8NA 1J07A 4IGAA 3RBAA 4KXXA 4OQMA 1E6KA 2HEGA 4ML3A 4EUFA 4CJXA 2CNWA 4LZZA 3AT1A 4LVCA 4R51A 4QFCA 3E03A 1P72A 1YZTA 1JT2A 1K7YA 3H86A 1T2FA 5JZMA 5B1SA 1Z2CA 1BFUA 4QWMA 2E4AA 1QTNA 2RHLA 1XQ1A 1NXXA 3FUTA 5K6AA 1IG0A 2KBEA 2IOQA 3SEFA 1LJLA 2TECE 4QHTA 5T4HA 1YS2X 5B58C 2R8YA 2CDAA 3PUHA 1ACMA 1BGXT 2VH2A 5D1NA 5A0VA 4BMPB 1YJ5A 1ACJA 1XD9A 1MAUA 1NF9A 2JFGA 4ARUA 2YHAA 3TGPA 4M6WB 1G38A 1OKKD 1NV8A 1X7YA 2NUPA 4NFSA 3UPTA 4LRSB 4LNUA 3TTUA 2ZVQX 5KYNA 4FYHA 4IJUA 4L0MA 1VECA 4K6HA 4W1RA 1PR3A 2GN6A 3CUKA 4PSKA 4ZD6A 3UXEA 3KQQA 1YUNA 4TLMB 1DG3A 2G09A 4CIBA 1CQWA 1RJDA 4NENB 3ZCSA 5ALXA 3L7DA 3B70A 4E5NA 4CQMB 4JYBA 3TZHA 2JLVA 4JJ6A 4JLWA 3HNRA 4IIJF 3BB1A 3GMDA 5KYUA 2P6NA 3B6IA 4BFTA 1FMFA 1GYRA 5BYBA 4AROA 4B0OA 7GPBA 1SBCA 3D64A 1DIHA 1N1EA 4L7QA 4KPFC 1EUZA 1XD2A 4RANA 1II0A 2MWMA 4II2A 4NKRA 5BR8B 1B43A 4D3FA 4D45A 2CNWD 2V45A 4PZEA 1EXDA 1GV0A 1RM0A 4M0MA 4NMHA 2YINC 4LC1A 3QE9Y 1U90A 4DA6A 1R5OA 4FR2A 2PGXA 3CO0S 1ZISA 2QX8A 1FJXA 4JY7A 1JQJC 4E3ZA 3TKAA 2HHAA 1DEHA 1ORIA 2QD2A 3C8MA 3N5CA 5E2BA 2IPXA 3COYA 1NZFA 2PLRA 2WIGA 1BN6A 2HRQA 1IUNA 3FYHA 3HS3A 4EJ6A 5AQEA 4G4SO 4I8IA 2ANCA 1B7GO 2Z9CA 4HX2A 1E1QD 3WMWA 5BRNA 3AEXA 5JXGA 3GLGE 3A6ZA 4JXZA 2QP4A 3EQ9A 3NHZA 3TIFA 2ESRA 1LGQA 5K0ZA 4AKHA 2DPGA 4PM4A 2V6JA 2GPTA 1XDGA 4DYVA 1ZVQA 1ZM3A 2JJ2A 1IM8A 3QNUA 4OGWA 2PFKA 5P8WA 4TZ0A 1SVUA 4B9AA 5LOVF 3NDBB 3FR7A 4G5GA 4HEQA 1N78A 4IUCS 2ISQA 1TUEA 3ABZA 3OX2A 4K6CA 5EFOA 3I04M 5B2ZA 2X0FA 3ZHUA 4XB2A 1G1AA 2BKEA 5C5IA 1Y5MA 3F67A 4EKYA 1RBZA 4WX2B 3HRHA 2HSWA 5DN6A 4MIYA 2VDJA 3DLAA 1GAJA 1L4HA 1US8B 1A5BB 1WHSB 4QX6A 1V35A 1FTWA 1ADGA 4C0HA 4HDMB 4UVGA 4F93B 4R8VA 2WYUA 1UPTA 3EXAA 3HXKA 4X6XA 1EFLA 3R8CA 2OOSA 2I7DA 4X66B 2MSLA 1RRFA 1OWMA 1A2BA 3KR0A 5FBQB 4AJNA 3Q12A 2GF0A 4GR4A 5K4HA 1TOAA 3X1JA 1JLSA 3Q40A 4TSFA 1KYIA 1X80B 1YR9A 5CVVA 5AO9A 5SY4A 3URKA 2F8TA 2AMFA 1FTGA 1I80A 3PEVA 4CTOA 4ZICA 1O4WA 4CTKA 4Q3BA 1Y81A 2AN4A 3LYAA 4ZK2A 3O0DA 3JPYA 1MAVA 2WTEA 3W3ZB 2JPDA 4Z9YA 4O8ZA 3USZA 3TLZA 4UQLA 5FUVA 1WNTA 4D5GA 2I4IA 6AT1A 4BEBA 4E1VA 1B1CA 5DTMA 4OQEA 2RGDA 3TDNA 3KL4A 2PIAA 1UDBA 4FJ0A 2WWWA 4W8OA 5FWYB 4BWVA 4C76A 2I9KA 4WZ6A 4RLHA 3HU5A 2HLNA 3NR2A 1FSZA 3TEJA 1Q6ZA 3FTQA 4QXAA 1FL9A 2RHRA 4FQ5A 1QHGA 1UZMA 5EGNA 1ZJ4A 4A2WA 1BDBA 1KNQA 1QTIA 2JJ2D 2LDXA 3CRW1 3LNCA 3ZHBA 3FSJX 3K31A 4UBNA 1DQNA 5AK4A 4ER0A 4M3NA 3VPGA 2CLHB 2D4HA 3T5BA 4FWIB 3ENWA 1KZ9A 1XP8A 1HZZA 2F9MA 2G9VA 3M6WA 3AONB 1O7JA 4CKZA 4QASA 4U2CA 5H81A 5DN6D 1T9ZA 1H2ZA 2CSUA 2F3RA 3ELUA 2WV7A 3GDHA 3SJAA 3ZDFA 1RCTE 2KB3A 1FRQA 3A04A 3D4OA 2OUKA 2CHFA 1PJZA 3QP9A 4JJIA 2C77A 3QE0A 4U2FA 1JQEA 4EVQA 3PS9A 2QVGA 3LG2A 2A3NA 1Q3HA 3L01A 4UHBA 5EUMA 3BILA 5E9AA 4CR7A 2CDNA 1IBMB 4JT8A 7MHTA 2VSNA 1RMQA 4IDBA 1P9LA 4TKVA 2H59A 3QKRA 3WHLA 4BO4A 3R0XA 1EUYA 3OF3A 3SEAA 4L16A 4TSFD 1E3JA 4IOKA 4BLSA 4U6SA 1TM4E 2AW5A 5AR1A 5K0CA 3QY0A 4N0PA 3X44A 4L50A 2I29A 3MTDA 1NVXQ 5TMBA 3DXYA 4G0ZA 3PVZA 4IQGA 3GVHA 3AJDA 4R2HA 4UTVA 1OXBB 2DXIA 3TS1A 4ROSA 1G4HA 3G5MA 4B7UA 5BURA 4OQDA 3EDOA 2VJCA 2WKWA 4JLPA 3PTAA 1KDPA 1XEXA 4HEA1 3TXAA 4MMYB 2VYNA 4XE5A 1W46A 4PLHA 2ZULA 3G1WA 4WUTA 3WYBA 5DGDA 3KXIA 1LK7A 5H70A 3H19A 1QOPB 4LY0A 2ORYA 1RJFA 2CJWA 4G41A 2B4YA 2E4ZA 3LFHA 4XQ9A 3U4MA 1S96A 1J8FA 4J07A 5D00A 1ECCA 4YDRA 3QKSA 3UJ9A 3D0OA 3EUWA 5CR9A 1T8SA 2FUNB 3B60A 4G36A 4UBMA 1ZNZA 2NG1A 2OHFA 2WJPA 3UMVA 4ATNA 3QEMA 5KQSA 2PX0A 4MGKR 4OFBA 3SFTA 2K2QB 4FNOA 3B1YA 3SQWA 4XVHA 4X1OA 3EDRA 1JR6A 2AG6A 4AJPA 3OMWA 5C3UA 1DV2A 4MPJA 4GG1A 4ZDJA 4L15A 1GPDG 1RXIA 3UF0A 2AF4C 1SELA 1Z0UA 2NTEA 2ZIAA 3ROXA 4NZOA 3MT9A 3OIVA 4UPEA 3BFXA 5LXTA 5LA6B 2YV2A 1KIMA 1ZJJA 3IKVA 3MEQA 4HDKB 4FZRA 1Z33A 2IIQA 2VCEA 2A6PA 4RIHA 5DI3A 1EQ2A 1QC5B 3W8DA 1M10A 3ZI4A 1ACLA 4TMXA 3WIUA 4BN4A 3NLLA 2QMHA 4URYR 5A1TA 3X1XA 3NP7A 4EJSB 4EYSA 3OPQA 2M98A 4GPTA 1Q7RA 3EIFA 3STTA 3GMJA 1ST3A 3U09A 1LQTA 2E5WA 1EFCA 3H1BA 3IP7A 2HU2A 4XRRA 4ARZA 1RHKA 3BQNB 1RYZA 4AMYA 3EG9B 2CUKA 4Z9AA 1V7CA 2J8ZA 4V03A 3ZDAA 5E1OA 1OXSC 4YFVA 3SC4A 2VYND 4S24A 3WWPA 3QTBA 3JQQA 4KODA 2HPZA 4N18A 5KQLA 3R77A 5CX1A 1LF5A 3N2LA 4M36A 4V1CI 5LYJB 3MAAC 4HFNA 1W6UA 1KI8A 4NESA 1JVSA 4MV0A 2O06A 3F5DA 4TV8B 4ZZ3A 1Y9AA 3KWFA 1DCMA 5GVRA 2XWSA 4CUJA 1OVMA 3FWYA 1CR0A 4HDSB 4GPBA 3ANYB 5F2KA 3AILA 3FNFA 4IP0A 5KIAA 1FRVA 1TTQB 4KU0D 1P3DA 4QYSA 3H99A 1XRSB 3G59A 5H3LA 3GJ0A 1DC5A 3SZRA 2XXSA 4JFRA 3J81A 3ZGYA 2I6TA 4MKGA 3LT5A 2GA8A 1IVNA 3MC1A 1TX4B 3TG8A 4B4OA 2X8WA 2A35A 2R8RA 3C6ZA 1KDTA 1LX6A 2XUGA 2H4HA 4OHUA 2NZYA 3TZCA 3X3HA 1FDOA 2CMDA 3P0RA 4HNUA 1UMBB 3IC5A 2PNJA 3EDYA 1HQCA 1X0VA 2IXDA 3JD1A 2XB8A 2PT9A 3SJCA 3OOEA 3UMCA 3JD3A 2VDQB 3H8WA 5DYTA 4FGJA 1U9IA 1SK8A 4XR9A 5SY6A 2KX7A 5EKXA 1U7UA 2XVYA 3QXGA 3AQIA 4JUIA 4XB6B 5DCLA 2QM0A 1NQUA 2VYFA 2P2ZA 4HAOA 1G20E 2G9UA 1M8PA 3C6MA 2QQGA 3DZHA 3EVCA 4K05A 2AC4A 5J58A 2ZSIA 3MOSA 3JALB 4HFMA 4U2DA 4KE7A 1WNFA 4BLVA 3UJNA 2C7PA 4D92A 4LWQA 4R05A 5K3SA 2DQSA 4RZXA 1QGZA 4XD2A 3VKUA 3B2NA 1MO5A 2F1JA 1F2TA 1JHQA 2KQUA 2XDWA 5EJ4A 3ZWQA 2XCUA 3K5PA 3ZEIA 3KKOA 3DE0X 3H2SA 4K03A 4F9EA 3DG9A 3AHIA 2ZR0A 2FMHA 2H1FA 4R1QA 4E4RA 3RGWS 3CHYA 4EHDA 1W49A 4DCPA 5G41A 3MWDB 1ISJA 4RL6A 1XDWA 2B1GA 4JLNA 4YRLA 2QP3A 1YBAA 4DHWA 3LQ1A 3I12A 4QBTA 4ZOLB 2DLNA 3ZI0A 2LGJA 1DQYA 1QOQB 4X91A 3U1BA 5AKIA 4JA0A 3MTQA 1JJBA 5BNZA 4JGBA 1GZHB 1NYQA 2Q99A 1IZ8A 3O3CA 4JJZA 3T3IA 3U9TA 1JG7A 4B85A 1CNEA 4KC0A 2PKWA 1ISGA 4NYIR 3DDWA 1CRWG 2XCSB 4PO8A 3HSKA 3I28A 2HHCA 3ZS8A 5KJ1A 1X7DA 2JFPA 1X70A 1KHUA 1BW9B 2FSVC 2QGNA 1U2RA 2QLMA 3C3MA 1MG0A 4Q9LA 3GT0A 1B2LA 2COEA 4D7AA 4F8EA 2UYCA 3O1HB 4GWLA 1F6BA 1NT2A 3B48A 3QENA 1UAAA 1KMQA 2DWUA 2PMBA 4P7BA 4ISCA 2E4WA 5EWMB 2C83A 5IXJA 3T4EA 4MLCA 1DFGA 1GQQA 3OCCA 3O8NA 4I4CA 5EE0A 3GFRA 1Y8ZA 2HX1A 1NKSA 3FPBA 1RTTA 3IIJA 2WZCA 3KKLA 4JXJA 4Q9AA 2D2VA 3UJPA 4QODA 4CEHB 4A92A 1QYIA 3PPVA 4TTPA 3PITA 4WMLA 2PGDA 4Z9FA 3L9XA 3RBZA 4PANA 4AKIA 2JI8A 3I01A 3NBMA 3QYAA 4I5IA 1SHZA 3R41A 3T5TA 3AH8A 4BMZA 1WPRA 3C5CA 5HZMA 1UXIA 4ETNA 5K8JB 2Z3ZA 4G0OA 1ONNA 5A9SA 1G55A 3VU9B 3OZWA 3B8HA 4KXFB 1T5LA 4K9RA 4TLAA 2WSIA 4FILA 1H2YA 1OWLA 2ASEA 1Y3FE 4DF3A 3DLTA 4E1AA 6Q21A 2I6QA 1EGQA 3VU1A 1MFPA 4AICA 1JXMA 4KV7A 2W6QA 3M5WA 4HH4A 4JOBA 2EERA 1FE8A 4N5HX 4X5OA 3ZJUA 1TTTA 2QUZA 4R71A 4B3DA 1Z16A 4Z4IA 4M49A 3SCZA 3KKQA 2II6A 2PKRA 4MKIA 1VLZA 2R5WA 2WWVD 1XZIA 3WADA 2GMWA 1Y1QA 2JIOA 2CLSA 3DTTA 4JBWA 4TWAA 5EMJA 4DBZA 3I72A 3E0QA 1Z0AA 4DLPA 2JFHA 1EFRA 1CNMA 1DTWB 4XFJA 5LYJF 1R0CA 5LMUB 3VH2A 4ID3A 1C3EA 1GXSA 5ALNA 5GONB 1NQXA 1QV6A 5LB4A 3ZZ1A 5A5GA 3RYCA 1BG6A 1GGFA 2RGEA 3MFQA 4XIYA 1V7PC 2CUZA 2PH5A 3HCOA 1IEWA 2OCAA 2GF2A 2ZK7A 1N3BA 2WDZA 4CTMA 2OC9A 1NRJB 3N0XA 3MUOA 3BXZA 2GXSA 5THKA 1KKLA 1JSRA 2KFUA 3ADPA 5DBOA 3VR4H 1ABBA 3ZJ4A 2RHOA 3GQBA 4NC9A 4XLTA 2AI3A 3CT4A 4EZIA 1AUOA 4LVUA 4MS4A 2R97A 2XCQA 3KQHA 3EPKA 4PQFA 5DNCA 5JALA 4GL4A 3CH5A 4Z3DA 2G71A 3KOWA 1YE8A 2ZRBA 4O1IA 1ENZA 1FU7A 1CFZA 4GEKA 3NEYA 3C2QA 2BGIA 2J6IA 1N32B 2P2CA 4RVOA 1C7JA 3TSOA 2BGWA 4OMFG 1U98A 4X00A 3IODA 2QTNA 3UEOA 1QP0A 4OX9B 4QU9A 1MD9A 4YN3A 1CUWA 4BP8A 1D5CA 2NN3C 2JD2A 4LTNA 4X71A 4ZREA 3EH1A 4EUSA 1GJRA 1SHKA 1U11A 2V7PA 3CRQA 3M49A 5I7HA 4Z53A 3BGOS 3GX1A 4F6RA 3U7QB 4XWAA 4FYXA 4XXHA 4XTCS 3W8RA 2F1KA 3WGYA 3WK5A 1CJSA 5JC8A 1D4FA 4Q1EA 5JG7A 4QXMA 1KVTA 2DH6A 2I2AA 4EHJA 3JD4A 4LV8B 4AJIA 4WY5A 1WUHS 5B7GA 1UXOA 1EFRD 3O4JA 1C7ZA 1QDLB 1Z39A 2Q29A 3H2IA 4RCZA 4TTIA 4KXMA 4DBVO 2DHQA 3G85A 1DJNA 5DM2A 4BZQA 1VFPA 5EG5A 5H83A 3UHOA 4D97A 2YJNA 4DCVA 2GETA 2R8PA 4BO7A 5C4MA 2BBTA 3I52A 1DUSA 3AG5A 2IVFA 1IG3A 2W7TA 4UZFA 5FHRA 1RWBA 5DWVA 4ECAA 3PD7A 4FNAA 1NN3A 2JQLA 1MGPA 2ODTX 3C5WP 2VHCA 2J08A 2NACA 4Y2HA 2O19A 2FPGB 1GL9B 1V9CA 2BFDB 3IB6A 1A8QA 2P69A 3MQFA 5DNDA 5ENVA 4E2YA 5GQSA 1GZ6A 1QX3A 4B71A 4Z4EA 1M2NA 1RWOA 2O3SA 2O52A 3K1ZA 1N2CE 3KOOA 4RA6B 3R9WA 2EFYA 4RJKA 1MB9A 2YVUA 4UHJA 3UHFA 2ZJYA 2JLAA 3EEFA 5JMWA 2JH3A 4YGYA 3TNYA 4OJKA 4PAOA 2FI1A 1PJAA 3UG7A 5K4GA 5KWEA 5JTUA 1EUCA 1NOIA 4O5AA 1CEXA 2BFBB 2AV6A 3VRHA 3ZHCA 1RZVA 1UOEA 5C2JB 1YDFA 1N0VC 3H9BA 2Y3IA 3CX4A 3GGGA 3E48A 1PRYA 3L7NA 1V5GA 1E2EA 2GM3A 3UFXB 3PO8A 3L79A 3M6UA 1UJXA 3W79A 2LCIA 1U2GA 3FNQA 2O4UX 3IQZA 4KLZA 4TT3D 2OC4A 3AFOA 2P8JA 1IXZA 4K9NA 3TZBA 2ZWAA 5E6SB 4BX3A 3DOCA 1T36A 3JYOA 1BE8A 3MG9A 3QA3E 4KEAA 4UQOA 1BROA 2SICE 3X1WA 2IEGA 4M38A 1CVLA 4RVFA 3WLEA 1Y8AA 1TJYA 2NV2B 3H9CA 4MRMA 1L3CA 4YDHB 5AW4A 2WHYA 4N65A