2I2CA

Crystal structure of lmnadk1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
total genus 71
structure length 264
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 2i2cA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 2i2cA01
2QVLA 3VZBA 3V8PA 5EJHA 3PFNA 2AN1A 1Z0ZA 2Q5FA 3VZCA 5DHSA 1SUWA 1U0RA 5DHRA 3V8NA 3S40A 5EJGA 2JGRA 3AFOA 3V7UA 2I2BA 3V7YA 2P1RA 2I2DA 3VZDA 5EJIA 2QV7A 2I29A 1Y3IA 1U0TA 5EJFA 5DHQA 4L02A 3V80A 4HAOA 3V7WA 2I2CA 4DY6A 1Z0UA 2BONA 1YT5A 1Z0SA 4WRRA 3V8MA 5DHUA 3V8QA 2I2AA 2I1WA 4WERA 4V24A 3T5PA 2I2FA 5DHPA 5DHTA 3V8RA 1Y3HA
chains in the Genus database with same CATH superfamily
3P5SA 3TNFA 4EZIA 2QIPA 3IJ5A 4G89A 1TAUA 3GJZA 2DFKB 4RF4A 3PRHA 1CRZA 5A5DA 4UDNA 4BNVA 1QYDA 1DBIA 1U6IA 3W8RA 4MPDA 1UMBA 4DJFC 3ZCQA 2WWFA 3K0AA 3QEMA 2I2DA 1V5FA 1ZJJA 2H1VA 1YSCA 2QSUA 4JR0A 4NMXB 4X95A 5DHAA 1H42A 5I9NA 1IUPA 5ADWA 2JKZA 2LC1A 1XV5A 4I6GA 1Z0DA 1GL6A 2W2LA 3A70A 3H18A 1P4RA 4OM8A 1R6BX 1D4FA 4JC4A 3CHYA 3ZU2A 2Q45A 2DFLA 1TA4A 1DAPA 3BREA 3KFVA 3W9YA 3AHCA 1AUQA 5CLQA 3DO5A 2IU3A 4PGFA 3R20A 2O8DB 2J3KA 1PAUA 3DGFC 1J99A 3K1ZA 3WHPA 4LFAB 4L8GA 3EDQA 1CRWG 4BHTA 4PM4A 3DJFA 3BE5A 3HA3A 3HV2A 2IF0A 3E1SA 2CNOA 2R96A 3ANTA 3RRFA 4RORA 2HA2A 1Y1SA 2ODNA 4P83A 1JWLA 4I0WB 3FTCA 1GFIA 3E9RA 5IRCD 4LZLA 3BIWA 3OFVA 2QTTA 3TCXB 1TEXA 4RTNA 3ZGNA 3KZMA 2IIQA 1A8PA 1JJBA 1II8A 2PG3A 5E8JA 1LFAA 2H2WA 5FBLB 1B23P 5ES3A 2UUAB 1FHQA 2CXQA 3KSZO 4COOA 3MJHA 3IURA 1QE5A 1QQBA 4RF2A 1RQLA 5CBPA 1VP3A 4JA0A 3WLFA 2EKZA 3GFVA 3AVVA 4MR8B 1E1DA 3L8HA 4C4TA 4D97A 4NEQA 2R25B 2AN9A 3QKRA 4KAJA 4CKCB 3WRWA 1PTJC 1P4JA 2XIQA 4MGIR 2O5EA 1UK7A 4ZXPA 2VF7A 2OCKA 1A4RA 1MVNA 3WIOA 4BCDA 4IV0A 4YLEA 2QYOA 4TQGA 4CLRA 2BGUA 2W22A 2F67A 3QY0A 4QDJA 4HHEA 1N2SA 2H1WA 1UM9B 1BH2A 2BP7B 2HAEA 4J0KA 4PAOA 4ZYLA 4B5LA 1ZVVA 2VTVA 1WWKA 4AJ9A 1ESDA 3U7QB 3BXHA 5TSDA 1GYPA 4OXRA 1NYQA 1PGQA 3X1MA 2VTEA 2EFGA 2GN0A 4EFMA 1G7TA 3GJ8A 3QBTA 5DT9A 5BMVB 3GFPA 2ZW9A 2OAGA 1EM8B 2M9MA 5J4YA 3O1JC 3ZWOA 3QVWA 3IRUA 2HIHA 1KI7A 2DX7A 4MI3A 1G3RA 2XUQA 1SC6A 2XKBA 3RRJA 1E4EA 2X7JA 3O9VA 4YREA 2KBEA 3TCKA 4A1OA 2FWRA 4MRMB 1KFJB 5A9SB 1J39A 2XE7A 1W8DA 3OPNA 5DHRA 1MOPA 4TUYB 4JLOA 1JLHA 1P4AA 2FSIA 3I3OA 3BXPA 1Y4UA 1RI2A 1QOPB 2QU8A 3IQHX 2BMDA 1TX4B 2PYZA 2Q50A 2V98A 2WWRA 3A3NA 1HMYA 3OPVA 4IJ6A 4YRJA 2AG0A 4DLSA 1KHXA 4IEEA 4YNBA 4R2KA 3S27A 4DYDA 1FLDA 1ZIYA 3AF3A 2MSKA 1IN4A 5E2BA 4KLCA 5FR1A 5JSHA 2P2DA 2WD8A 1TVEA 1WCYA 1PTKA 1ZSYA 1SVSA 4FMDB 2B3DA 4NECA 2QLBA 1Z8FA 3HACA 4P4GA 4PZ9A 3B7GA 3EUAA 5IC4A 2BFOA 5G1OA 4HDKB 1CT9A 1DEXA 1F9AA 3FGNA 1Q11A 2OO3A 4RFLA 5JEMA 2BCGY 3MJDA 2NPIA 5EJGA 2O3TA 3CEAA 4FLEA 3WMXA 2GCEA 4NU6A 5DRTA 4GPBA 2IHBA 1RHRA 1RHUA 4P5PA 4UTZA 3ADDA 5C7YA 3TUZC 1E9RA 3LWDA 2NT4A 3DM9B 5DISB 3UJBA 3H2IA 1NR5A 4JYMA 4W9NA 1NRWA 2AUNA 1FDUA 1DE0A 4V0OA 3ESDA 3CS3A 4NU8X 4G67A 3R7NA 4GXTA 4GBGA 4E7PA 2JLUA 3T0IA 3IMGA 1NFFA 2CL6X 1WE2A 4MWTA 1T36A 3THSA 4WESB 1H6BA 3WX0A 4OX9B 3K6JA 4UD6A 3K9WA 4BCCA 2CDNA 4LHXA 1L8OA 1L5SA 2WU3A 4RMHA 2PE5A 2IS4A 4Z9BA 1VSUA 1XI2A 2W6CX 4WXMA 5BV8A 1Z7WA 1M2JA 1R6UA 1EUDB 2Z09A 1PJBA 1DQSA 5LYJA 3TX2A 3H1EA 3FFAA 4GNRA 4MQUA 4PLHA 1C3JA 2CZGA 3V7NA 2JLVA 1V8PA 4KJXA 3HBLA 4UMEA 3WWYA 3DAPA 2K6GA 3DEIA 1GJRA 4UULA 4JC5A 1IL0A 3KQLA 4NXNB 2GBFA 5JSZB 3W2GA 4LUCA 5FPHA 5DM60 4MA0A 1CR0A 3JARB 3R3YA 2G0NA 1VJRA 4E12A 3NT2A 4RJIA 2HV9A 3L8FA 3NONA 3NWBA 1IZYA 1YU6A 4MYRA 2W6ID 3Q1LA 3OE1A 3T4PA 2W6OA 1JLKA 2IGBA 4LV5B 3V4FA 4B4DA 3U13A 3CKMA 1KVUA 2DBVO 4PCUA 4PLTA 4JSRA 5JSUA 1H22A 4AC9A 4FWTA 2X0IA 5L3QA 3NBKA 5C53B 1UR5A 1AE1A 1D03A 1LRLA 2E49A 3ETNA 2KFUA 1G7CA 4FXOA 1G3QA 3VH3A 2I3GA 3DS8A 4B7AA 4DREA 1UQRA 1E1CA 1CDOA 1TMGE 3FGPA 4R16A 2ZS8A 4Y6OA 3RT7A 1L4MA 1GXSA 4TSFD 2B36A 3QX3A 4AUEA 1W52X 5F3DA 2WT9A 3A4IA 3DF7A 4UUOA 5BUCA 2B1RA 2C5LA 2HT6A 2TMGA 2WVJA 4OI2A 2OGUA 3E5RA 4ZZ2A 3UJ7A 1KK1A 1TUEA 4XIIA 4BO7A 4BE9A 2INGX 6Q21A 1BS9A 3HVKA 3JR7A 4NIMA 4DQDA 3RQIA 2XT9B 4DC9A 1TGVA 1BMFA 2EZ9A 3T1QA 4ENQA 1TFUA 3T5DA 5ICEA 1Z17A 4K87A 5ELMA 3WRVA 5CFZA 1I10A 2WJZB 2REXB 3GVCA 3PKZA 3WHLA 3U6KA 1M9NA 3ND5A 5CK4A 3ZHUA 2H2DA 1AKMA 5K3EA 1US8B 5E2AA 4CV3A 1V1JA 3GDWA 5ALGA 5BVGB 1DUSA 3DNPA 4UDYX 3RLFA 2AI3A 5A04A 5LSAA 2WEKA 4YMUA 1WV3A 1RCTE 3THYA 4R51A 1RYDA 3Q3IA 4FWIB 1PL7A 2FPUA 3FMIA 2R7MA 1T6ZA 1JG2A 1TLLA 2C1XA 3OJFA 5TQ0B 3ROFA 1ZN9A 4OY3A 4G2SA 2KHZA 3F7TA 1N57A 5GOTA 1NZDA 1NHGA 1OZ0A 1OVGA 4QM7A 1X7ZA 3R7DA 1E9SA 2PX8A 1GAWA 2FB9A 4JB0A 3SY8A 2RGWA 4GPD1 4U7TB 3HYLA 1Z82A 4OAOA 4KEAA 2LUOA 4ZREA 3HRKA 2D1TA 2PX2A 3OOEA 5J1TB 5FWNA 1KYWA 1OU4A 1QQ5A 2AZTA 2QRNA 2Y4NA 1LFDB 1VRVA 3ENNA 2YRWA 1N8KA 3ISVA 3O4HA 2VYFA 2IQIA 2YJTD 4G9EA 1DTWA 2AVDA 1SOMA 2PT9A 2VHXA 2H29A 4FX5A 4WNYA 5CLLA 3H9JA 2HBRA 3FRJA 2OFFA 1AUXA 2H5JA 1ZEJA 1U1EA 1L7MA 1ORTA 1N5MA 2XTNA 3KUXA 4MWOA 4KXNA 1G63A 1TJYA 3TGLA 3CNNA 3PQFA 1XHLA 2HC9A 2PIDA 1UANA 3RS7A 3HKDB 2Y93A 4KGZA 3CLRC 4MRSA 4XEHA 3WIBA 4E2FA 5AVWA 3L04A 4YRLA 2EJBA 1T4CA 2ES4A 5ER9A 3SSAA 2XAAA 2F9LA 4D74A 3TLGA 1EBUA 2G7MC 2VZ0A 4BQIA 1QPGA 3UBTA 2YJGA 3EHEA 3FYUC 5AIAA 1D4ZA 1Y3CE 2P0EA 2XDQA 1JE1A 4XQ9A 2DTXA 5H68A 3UMSA 3WRYA 4LHWA 4RMNA 5AXDA 5HKLA 3UYKA 5BWMA 5CA1F 3HDYA 2Q41A 4DYVA 1FTYA 4QRDA 5KQGA 4EEXA 3DC7A 4IHAA 4QDKA 3VFDA 3SZLA 3W2TA 3RWMB 3E84A 4DB2A 2BMWA 1F0KA 3GB9A 1NU6A 3ANSA 4AZTA 4GL2A 3UJ6A 1CUSA 1DO8A 4BEWA 2PMWB 3BHMA 4D8XA 3TG8A 1IMOA 4O2BB 4JXKA 4AECA 4DNXA 2CEKA 1JSXA 3KCNA 1CIVA 2V54A 2BW0A 2O7NA 3GZNB 4MQFB 5HRUA 2GXSA 3LNCA 1CE8A 5JS7A 3GCWA 4F4FA 2YIVX 2HHLA 1C0LA 3BC1A 4I9NA 3KJIA 3ZYCA 4E6PA 2CE2X 1OAAA 1YKSA 1C3XA 1KDZA 3TL3A 1F8YA 2NAPA 3KFXA 1U0SY 5EGNA 4M9UA 4O59O 3DG9A 3B2QA 4GBED 4E70A 1QV9A 1K8YB 3JQAA 2NG1A 2R3SA 4KI0A 5IJAA 2IYEA 4Z9YA 2BRFA 1MH1A 2C77A 4F1WA 3EW9A 2O9JA 4MR9B 4AAYA 4DWOA 1HWYA 4EW1A 1NWHA 1IUOA 1MR3F 1BVRA 1S01A 2C7BA 2ZSKA 1DIBA 2AL7A 2X7XA 3OWXA 4QE3A 5H70A 1SG6A 1AH2A 2X2PA 2GZMA 1DCTA 2FF5A 5TVKA 3G1WA 4NQRA 1Z7YA 1AO0A 5EIOA 4E2XA 1BDIA 3KE9A 1TRKA 4EZBA 4NAHA 1Y5RA 4YO8A 4JEUA 4FDUA 1MVOA 4R8SA 1ZHFA 4N7MA 2BSXA 1IB6A 3M4YA 4QOEA 3WK4A 1YD7A 4BUCA 1Q0RA 3G8BA 2YJNA 5CT6A 5AI9A 3RT9A 1JDTA 1M0EA 3G2LA 1XZMA 3T3OA 4Z3KA 3MOIA 1HL3A 3ZQ4A 3AZOA 1U3DA 3KVRA 3JQFC 1S2DA 4XWTA 3IXLA 4G97A 4WAUA 3UOTA 1TKCA 2GXQA 4Q3CA 5H59A 1C9KA 1ZK2A 2YYZA 3UAYA 1OV6A 4KIFA 4K88A 5KYNA 3N8KA 5GY7A 4ZRNA 1O95A 4QWWA 2ZAOA 3COVA 3GLSA 5HS4A 1M2WA 2LR0A 1NPTO 2XB6A 4FFMA 4QULA 5COAA 3RSZA 3F6SA 3EGDB 1PVOA 2J9GA 2I8LA 5AM0A 4CWAA 5D6NA 1ITZA 5A4KA 2VN8A 1YL7A 3B6KA 4IUDS 5SYMA 2C84A 4BO4A 4Q1AA 3TL6A 1JHXA 1HR0B 3ROEA 3AF5A 4R40A 2KKLA 3NV7A 4J76A 1VJCA 4BFYA 1L8XA 2UZ0A 2G09A 3DDHA 3IJRA 4JOSA 3H1FA 4OHCA 4EP1A 5JSYA 4YBRA 4BL5A 5FV4A 4EARA 3IL2A 3QOFA 2XF2A 5DTMA 4MYHA 5AFSA 2D6FA 4P31A 5KVCA 4MR8A 2OGSA 2ZBUA 3KKPA 4R1UA 3TE7A 3TQRA 4HZUA 4CKCA 1QMPA 4YRNA 5IXJA 2V6GA 4FCWA 2PWPA 3ZKAA 1JL3A 3FM8A 4IBOA 1EG2A 4QYWA 4TKUA 1E5VA 3RUPA 3VHLB 2B4KA 4O8CA 3ELVA 1LH0A 4C0WA 3M4ZA 2BKVA 1UBCA 1NXOA 1R2QA 5DWVA 3O91A 5IJZA 4FNMA 1ZFNA 2GAAA 2YWFA 3VPHA 4DQ0A 2BP7A 1ZX1A 1F38A 1SWWA 2NIPA 2X8LA 1QIFA 3GI1A 1VI2A 4N3AA 4B43A 3IMEA 1MXFA 4ZVRA 1E3DA 3E8SA 1WJGA 2CFRA 4CV0A 1E1NA 2J45A 2C0QA 2Q3JA 4BWYA 3P45A 3WQBA 1VQ1A 2DGDA 3ZWDA 3C3AA 2VXYA 4DR5B 1RXWA 1HX7A 4MJ7A 3KBOA 3U26A 4RVNA 2B98A 5G0TA 1P1KA 4BFXA 3FWNA 1J1IA 4Q02A 1G8AA 1RJGA 3OLQA 4H7FA 2HT1A 2FPMA 3EY9A 4I50B 3VR5D 3GJTA 3LDFA 3NYRA 4MRMA 3W1VA 2XCIA 4K0RA 3SPXA 3ELDA 2ZSJA 4TUYA 4XVHA 3UKOA 5BWLA 3IO5A 4I1RA 4R1SA 3GMDA 1P61B 3LGSA 5K3BA 1YR7A 3P2YA 4MV5A 4LGYA 1SJ9A 3JX9A 5C2JB 4WKCA 1FTQA 2VFAA 2C94A 2C5FA 3AOEA 3HE3A 5IVPA 4QPZA 3IXQA 4MWEA 3BRWA 5G4LA 3HFGA 3W2HA 1E1RA 2ZWAA 1E7YA 2VK1A 2X5OA 4GECA 4D6PA 5K01A 1CYEA 3TXYA 4NPCA 4IOKA 3PXGA 2O14A 1CX9B 1FRNA 1YBAA 3WE7A 1IY8A 3KVOA 3G5LA 5KX5F 2P6PA 4US0R 3NKFA 3V8PA 1L5KA 5C8YA 4NNOA 4P58A 2CLHB 3WIUA 4KXMA 1RWWA 3NTOA 1S7GA 3KD2A 2O2ZA 3ROKA 5IN4A 2OHJA 5CVJA 2EZTA 1WZNA 1NUSA 3UN1A 3TD2A 2GK4A 3TW0A 2JIOA 1PR5A 3HZRA 3RVLA 3V7WA 1ODIA 4Y18A 4ENSA 5F76A 1GQOA 3NHAA 1Z9BA 5A3RA 5ALNA 3ONDA 4RZSA 4JODA 3C85A 3TMKA 1DWQA 4KXUA 3EX7C 1ETUA 2FWJA 4FW9A 2LKDA 3G9QA 4FFVA 4Q1EA 1G1MA 4S12A 3IAAA 3SZ3A 3J81k 2R7LA 3WL3A 1P74A 3CR7A 2X13A 3KLNA 5H80A 1Y6ZA 4UASA 3JW8A 2IE8A 4GZ5A 2Q8NA 1K2VN 4UOEA 1XTZA 2VJDA 2C5AA 2ZYUX 3H11A 1YB5A 2R4QA 4CHGA 1SKUA 2PSJA 3OF2A 3I64A 2QGNA 3QYAA 1S4MA 3KHUA 3NBAA 3DDOA 4OQZA 4WKGA 4ATNA 5FAKA 2HMWA 1FTNA 3UF0A 1EUDA 4EUSA 4POAA 3QMMA 5CVVA 1K66A 3EXIA 4MI1A 1MO6A 4NR0A 2V6FA 4Z7JA 1FQJA 2R7NA 4N5IX 3D81A 3ENVA 1TTPB 1PWEA 1EK5A 3NCTA 1Z5ZA 3TRIA 1CJMA 3CUSA 2FX3A 1I0LA 3A58B 4U7PB 4G1UC 3TRFA 2D2EA 721PA 4LDPA 3Q9NA 4G3XA 2FQYA 4WKBA 1CNEA 2X7HA 4UM8B 3KUKA 3LY9A 4CQNA 1KERA 2WUVA 4QUBA 5CYFA 4ZO8A 5DX8A 5EMHA 3DV0B 2VH2A 3A3YA 5AVQA 1ONNA 4DV4B 1LI7A 1NJ6A 4I5IA 3AFNA 4AURA 3I1YA 5JWRA 3EIQA 3ABZA 3J81A 1NUQA 3I2FA 4NP6A 4GWKA 4NKRA 2O8EA 3K8ZA 3KOMA 3QG1A 5ALKA 1QIKA 4PZEA 4MUYA 2P9GA 3DWEX 4PW0A 5AW6A 1TCCA 3U4IA 3LBAA 1DOAA 1Z0KA 4LE1A 1PFGA 4CW7A 3P71T 1JFLA 2G9UA 4UHEA 1Z12A 1ZUHA 4E5PA 4PO1A 1E79A 4NZZA 2A57A 2P9TA 1JV2B 4TZTA 2XUKA 5G53C 2DERA 3BF8A 2XT9A 3LF1A 3BGVA 3IS3A 3UT5B 4HQOA 4TLBA 1GQQA 3MINA 4LYAA 4HQ0A 2PUBA 1PZNA 1T8YA 4GZ6A 4OBWA 1DAMA 4RY8A 4C21A 1DEAA 1HKHA 3L0BA 4Z7QB 4EKYA 2E89A 1NN3A 5HILA 5BN3B 3OCZA 2YY6A 3BMXA 4XSGA 3A0UA 4Q5IA 3SC2B 3UQZA 3FOBA 4PYQA 1US8A 3F6EX 1VLQA 3PGLA 2PXAA 1MD9A 4JC8A 4TVKA 4RH1A 1L4KA 5AM1A 5ESXA 1UKBA 2PL9A 3DLAA 4BBZA 4BP8A 1H2AS 1EFVB 2FI1A 3KJHA 3PNQA 4O5OA 4CKXA 4M2LA 4W4TA 4MUGA 1D6JA 1CD5A 3LUJA 4WH0A 2EL9A 2KI5A 5HZHA 3J7AC 1EDZA 1GUZA 3R09A 1T2DA 1BW9B 4OB8A 1NY6A 3SJCA 1UDBA 1N6KA 2VYCA 3ZLBA 3PGXA 1VGRA 3V2UA 1E6LA 2CLKB 5EP1A 3WA7A 2C0PA 2IDZA 2GXUA 2Y1CA 3UMVA 3GFRA 3R6GA 4C0KA 5JLJA 1JFRA 5D3ZA 2WUEA 1XMJA 3ORFA 2IXBA 4JS0A 4K03A 2IU0A 5M2QA 1WMAA 821PA 1FSFA 5H9WA 1P1CA 2QUZA 4MUAA 3SR0A 4GGMX 3I30X 1K2MA 4QELA 2PDAA 4ZQGA 4DDKA 1QQAA 2GPTA 1VG0B 2H9IA 4CCSA 4F04A 1H0KA 4S1PA 2CFTA 5FWXA 4HK4A 1M34E 2DQZA 5KINB 4OLBA 1EMDA 4NVRA 4DDMA 4P33A 4A2PA 2W2KB 4NJOA 3ZCRA 5JARA 4L02A 1WNTA 1XAHA 3N2LA 4FJ1A 3B7WA 4MWGA 3STXA 3HKDA 3I2HA 5KYXB 3AIOA 5JJIA 5AHRA 2PKQP 1U7VB 3EXEB 4JHLA 4BY9E 3KKMA 1K3TA 4L4YA 2JANA 5JR3A 2PRYA 3Q2KA 1LWNA 1AGPA 4D57A 3FNEA 3HXQA 5EHIA 1Y42X 4OJYA 3MJTA 4C6TB 1OUMA 1LVUA 1LJLA 3N59A 2O3RA 4JL8A 4MS1A 4RNDB 5BWNA 1KETA 2G36A 5BP7A 1T10A 1FDWA 5T4BA 3IO3A 5G41A 2RHTA 4GP6A 5K0EA 1XRLA 2CVOA 3FDZB 3L49A 2R84A 3IJPA 2G82A 3WL6A 1JAIA 1IHDA 2GJ9A 4GKBA 3M6FA 5HX7A 3DE4X 1RHMA 3GZNA 3L84A 4MQFA 3VDNB 4I5DA 2Y92A 3Q1KA 1J9ZA 3NHBA 5DV9A 2ODPA 1N2JA 1VE3A 1QK5A 2PPVA 3Q0TA 3O8OA 5AK0A 3O7MA 3QTBA 3RC9A 2KSQA 3JVIA 1JKFA 4B3IA 4B4KA 2XMGA 1RTKA 2FX5A 4K9MA 3VYTB 3HO1A 2Q1YA 1EXWA 3GXOA 3DH0A 3IP1A 3AY7A 3C4QA 4WVLA 1Z7EA 3KV1A 1E8MA 1ADGA 1O8BA 1T9GS 2MSCB 2P5UA 2PAFA 2RK3A 2YW2A 3DMTA 4M1MA 7ABPA 2BDEA 3CYFA 4MR9A 3P9IA 1E3TA 1SVOA 4MW7A 2CLSA 3VV3A 4B82A 2Q4DA 1KQFA 2QPLA 3RIGA 1KYIA 4K8RB 1CP2A 2BGWA 3RU2A 1Q7TA 4R9RA 3WKBA 2SKCA 4PS1A 1I1NA 1F4LA 2GM3A 1T5IA 1WCXA 3S40A 1EZZA 2FE4A 1NDHA 4KTTE 3JD1A 1NF9A 3IMCA 3BCUA 4PFQA 4QBGB 3SCZA 4CIAA 3MTQA 2VF8A 3H5NA 3CH7A 4ZRDA 1J20A 1XQWA 4GI3A 1M3SA 1HT3A 1Z06A 1NASA 1KJNA 1OIWA 2XOKA 3H4MA 3QVKA 2I6UA 3ROZA 3VKHA 4P6VF 3OD1A 2O0LA 1R27A 1JG3A 4XUEA 2Z30A 3HA2A 3P9RA 3QUSA 5E6SB 2SCUB 1NM5A 2VHYA 3AW9A 5DLEA 3U0BA 3UGQA 3UKDA 1ZA2A 1M1YB 2KM1A 2HWXA 2ADMA 1FDSA 1ORIA 1LPMA 3C8MA 3KR2A 3AM5A 4G9BA 5LQAA 4D3XA 4OUKX 1VTKA 4NMWA 4KH0A 3WMRA 3FZYA 3DC2A 3F7MA 2R6JA 1D2MA 1KEVA 3AEKB 4NYJQ 1QVWA 4PX3A 2VUIB 4J75A 1TECE 1KYXA 5CM2Z 4DB4A 3GA5A 1I5RA 4HAUA 1EUZA 4LWZA 4IM7A 4OUDA 1CV2A 5B3JA 5L40A 3V33A 2X2FA 1E6UA 1EQAA 3NIBA 1QVVA 3EGDA 4E5MA 1WSAA 4GOXA 4QPCA 2VBFA 1KO7A 2JLBA 2GEJA 3CLUC 1WW2A 5A4IS 1H0RA 1Q1EA 2OKCA 2QTWB 5E7JA 3I5AA 3LCCA 1G291 3PR2B 3H8JA 5BT8A 2W6QA 1QB8A 3C6QA 3QNUA 2W2TA 3DAHA 3CPEA 4IDOA 2TMYA 3CBGA 2BTEA 1XMOB 4CJXA 3FF4A 3KVNA 1RXIA 2C31A 4O0MA 2OSBA 1M1NB 4FGSA 1J42A 4Q34A 1O94D 3QEBZ 3TJMA 4RH3A 4UM7A 1GILA 2C59A 4D4JA 3A06A 4Q9LA 1YB4A 2NAFA 1BC5A 3C98A 1SELA 1E60A 3ONWA 1VLZA 4KDRA 5IXYA 1J1UA 2LDBA 3L6RA 1C4XA 1RNLA 3C3CA 2YDYA 3CB4A 1JDPA 3MPUA 5K3CA 4PXAA 4LWPA 3FPJA 1SUBA 2OXIA 1CYDA 2XH8A 3HJBA 4DIOA 4BZXA 4QGGA 3D3QA 2GSWA 4IXMA 4IDBA 4NBWA 1I4DD 4ZT4A 1A9YA 3WYAA 1EVIA 1IM2A 1KDYA 1KP2A 3JWEA 2ZDHA 3MCVA 5A9RA 3NGMA 3PJEA 1YRQA 4MINA 1H69A 2AEFA 4YAWA 5DULA 1QR2A 1L4YA 4JB2A 3AU9A 3F6BX 1H1DA 2PMBA 4NK4A 3MA0A 2ZUBA 3GAZA 3QBEA 1LDMA 2QV0A 4MVJE 2E87A 3DQQA 4Y1RB 3FCCA 3ZV6A 4DM4A 5EE5B 3LT4A 4REMA 3ER8A 4NBKA 3KEOA 3MYRA 3MUNA 1YDFA 4H0FA 3PQCA 4YAKA 4I1UA 4JIGA 4L9RA 4LYDA 2R79A 1V7PC 4BN5A 3PE4A 1QCDA 1SBCA 2NWQA 4I3FA 5F33A 1KHHA 1FVXA 3BWMA 3MT9A 3IIKA 2ZU0C 3KT3A 4G23A 4GX1A 4LHSA 4RFVA 5IASA 2HGZA 1ZCJA 2R1UA 2IZOA 3A05A 4RGBA 2NSLA 1U2PA 1Y81A 3R3JA 3OM0A 4C1NA 2NZXA 2YZ2A 4QOIA 5GPBA 4RNCA 3G5TA 1GA6A 2P2SA 5DT2A 5EERA 5FOSA 3BL8A 3W78A 3A1NA 1FB5A 3U48A 4JU9A 4EVQA 1PHPA 2B92A 4FINA 4PGHA 3UMZA 4W9NC 1TUBA 5GJVC 4CNBA 1D2CA 2O7SA 3STHA 3A3PA 2I4MA 3M9XA 4XYEA 4DPKA 1JU3A 4OKNA 2MTBA 3K0FB 3WXBA 2QW0X 1DC3A 5JRDS 5AVUA 3CX6A 4AU1A 3VR6D 1YNSA 5CB4F 4MQBA 2DLCX 4M99A 1T2FA 2WT4A 2R8XA 4ZQHA 1IHPA 1KY4A 2BFFB 4F3KA 2H0AA 2DT8A 2BGIA 1VG9B 3ZVNA 3EVNA 1ZKDA 5JNUA 2CY0A 2FN7A 3FPCA 4MS4A 1TJNA 2DUWA 3DP7A 4ZV7A 1V3QE 4IIGA 4Q4HA 3VNQA 2PKWA 2BPOA 2YZ7A 1BZYA 3QLVC 4EIWA 3O95A 4B45A 4CQLB 1XO1A 2J9XB 2QZPA 2WT8A 3IAFA 2G80A 1LTQA 1UDWA 2D5BA 4MVJG 3GUUA 4LZOA 4EYSA 4DLYA 1K6IA 1ISRA 1ZGBA 2BISA 4WKOA 2ZXUA 3QVTA 3AHGA 3PQDA 2B7LA 1GR0A 4LV8B 4D9FA 3WTBA 4AYXA 4Q7JB 2GMWA 1JBEA 2XT6A 3GPCA 4WBSA 5K51A 4AKTA 3SQNA 5J2UA 2ZUCA 4KAAA 3REQA 1L6RA 4E2ZA 5AWFC 1FTSA 3ZBTA 4E09A 4LAFA 1PGNA 2Q3LA 1ZUWA 3D4LA 3IA2A 2RCYA 4MHTA 4X44A 2H7VA 5KJ6A 2NNWB 5AI6A 4P2GA 3G5AA 4DVGA 4CPDA 3QYJA 4F72A 5HR5A 3SHFA 4DA0A 1X9IA 1WM1A 3OQJA 4ZDKA 5EHZA 5DDIP 3QWFA 4LJ9A 1M0TA 1PCXA 1H9CA 4MI9A 1A96A 3GLFA 2PJDA 1WCIA 1GPDG 4Y9TA 3DV0A 2XV1A 2IYLD 3WKAA 3FUVA 4YFYA 1YGSA 3NC4A 3UNXA 1WZ2A 4C7OB 1XAJA 1HSZA 2Y6UA 1Y37A 4CM8B 4G0QA 1Q77A 2QE7A 4TRRA 1IG0A 1WOMA 2AOXA 5CA1B 4EVRA 5A4DA 4Q6WA 1M7BA 4CI9A 4IJ5A 2FEPA 1HUQA 2BHNA 5L3SA 3H0CA 3PTZA 4YRSA 4INZA 2ECOA 1F2TB 4DL9A 1UPBA 1ZRSA 3HR8A 2DWPA 3GJRA 4IJMA 3HS3A 4JJFA 2O54A 4JJEA 2GA8A 3TSOA 4MNTA 4KMMA 4NCHA 3QPAA 1L5QA 3KEQA 1U7TA 4OBBA 3A3OA 2XPCA 3OEYA 3GFSA 5BNWA 2OTCA 1TKBA 4LDJA 1YUNA 4K9KA 1F5SA 4ZU3A 3KHKA 3UT5A 4L4RA 2I3DA 4COKA 3OUNA 4DT1A 5DBEX 4F46A 2BFEA 3DBHB 3KLMX 3WLAA 4XM0A 1GAJA 1WMSA 1UKZA 1KARA 2WABA 5BN3A 5AVZA 4W8GA 6LDHA 2BGMA 4TRNA 3ZD6A 3SC2A 1N8SA 5EMJA 5ITWA 3ZN2A 7ADHA 1W2WB 4L6IA 5FYQA 2J07A 3ZE2B 4EMTA 3ZWPA 1O7JA 4HUJA 4MWZA 3EULA 2PVCA 4EBFA 1E2QA 3EZGA 1VIAA 5TXGA 1XTJA 5GZ6A 1TXGA 4CL3A 1V96A 4QIHA 4DSTA 2Q5FA 3K0EA 1BW9A 1UM8A 4PAMA 4H7KA 4LBWA 3E0XA 1R9NA 2EFEB 2PMDA 4P53A 3BL6A 3EDCA 1OFVA 3EPKA 3U7EB 1KKUA 1Z74A 3AEQB 1RACA 2VT2A 5GTDA 3AINA 1H8EA 4FE3A 2GCOB 3W5HA 2DSNA 1THTA 2YXNA 2OWEA 3OA2A 3TLCA 2RK4A 1S9HA 1U80A 3FIJA 3CLSC 3BWBA 1PLJA 1R6TA 2C07A 2CDRA 4GLBA 4R1TA 3V6LA 1LBSA 4S04A 1G4UR 3OAAA 4G56A 1Y1KE 2ORVA 1XQ6A 2MHCA 1L4GA 1IHXA 1XU4A 1ZCAA 2PZGA 2ZRFA 3FLBA 3P8ZA 4RSGA 3A1UA 4XVRA 2CBXA 4CU2A 1JR6A 2ID4A 3EGEA 5TNXA 3GPBA 4R84A 4OGLA 3THXB 2R1TB 3TZHA 3OIYA 2FMKA 3RS0A 3E35A 5KYXA 3L1HA 4ETIA 1GAEO 4DCVA 4BMDA 3RTCA 2W2PA 1U7VA 1ZNWA 2VPPA 1XP5A 2VNIA 2YUIA 3KTOA 4ZANA 4CUJA 2E4YA 4BGDA 4XEUA 1ML4A 1E2HA 3N8GA 4N12A 2AD1A 5DXAA 1AHHA 4FD2A 4J1SA 1GRRA 1YRAA 3MD9A 2QTVB 1ZESA 4ITUA 3VV2A 4EJ6A 1Z5WA 1PJ2A 1Q12A 2VUSA 2WJYA 5CR9A 3ITKA 2O8VA 5TVGA 5HW0A 4AP5A 1CRPA 3LM8A 1TYZA 4ILKA 3FI0A 3NZEA 3BGWA 5AK3A 4H77A 1GARA 2W0SA 1B6TA 5HF5A 4B2PA 5B7PA 5A1TA 1FEZA 1KJQA 1V11B 2Y67A 2YJ5A 2YTZA 1XKQA 3FDZA 1BOOA 5F5LA 1DRKA 2W4IA 1BDMA 1LPAB 3ZGZA 2LXNA 3QPUA 3B6IA 3H6HA 3QKIA 3UTCA 5IKEA 1IVYA 3P9PA 1PSWA 5LVAA 4PEVA 1LJ8A 2A88A 3KKLA 1U63A 5DEIA 2Y1DA 5M7EA 2DHQA 4BQPA 5BURA 3WNZA 3PXEA 1PFVA 2OK7A 5ALOA 3VA4A 1AHNA 1ULBA 1KC3A 1T9HA 3PQ5A 3HXOA 1XZQA 3NANA 5KMGA 1CP3A 3Q3JB 3Q7PA 3N86A 1QX4A 1I2DA 2DJIA 2FGJA 5JDIC 5G4KA 4OFWA 4BB9A 1QAQA 3ZU4A 1GNPA 5J3JA 4XD2A 1XAGA 5E6UA 3O8BA 2WF7A 3HU2A 5EIXA 2O8CA 3EC7A 3IAXA 3WWOA 4TS9A 4RA6B 3WLJA 3W1EA 4Y2GA 2Q3CA 4R1NA 1F2DA 2BAGA 1ILEA 4RZXA 4I2VA 2GZ3A 4ROTA 4Y1EA 1BX0A 3PNOA 3BTVA 1P2DA 3LKZA 4L6CA 4BJ3A 3U3ZA 1TK3A 2YVUA 1E5XA 4U4AA 1XTUA 1SCUB 1Q2XA 2XD9A 3BWYA 3B5IA 3RSQA 5AI5A 1W0JA 2PLFA 3OZUA 5LN1A 2D3TA 2Z2KA 1SURA 3DYVA 1MN6A 2NO7A 2RHOA 1ADCA 4RHCA 2FZVA 4ZAFA 2ZB3A 1ISMA 3DB2A 3RYCB 1CFJA 1LDYA 4OYYA 4Z9FA 1KJ8A 3TWOA 1E2DA 2FSUA 2P40A 2Q3MA 4WI1A 4B3XA 2UV8A 1YE5A 2DVMA 4MQMA 1M1YA 3L0PA 2P9YA 1KNQA 3CJQA 1E96A 3OFSA 4QUGA 1FJGB 1Q7CA 1KAGA 4GEGA 1Y8QA 2UVPA 2RGNC 2J4FA 5ITSA 3AEKA 3DO6A 2UUPA 3SKYA 3U60B 3VR5H 3L6DA 4JB8A 4BKOA 3VNUA 3EYWA 3OT5A 5H82A 2HK6A 3FBGA 2XRMA 3BTOA 4E5DA 2VHCA 4ABYA 1CB7A 3ZEAA 4C22A 3OX1A 3K70B 1E20A 5L3ZA 5L4LA 2LD4A 2XYGA 2QT9A 2J6CA 4W7SA 1E6CA 4OHZA 1RIIA 4EGQA 4HH1A 3M5PA 5DBHX 1AKNA 2I5PO 4KX3A 5EPOA 4I4IA 3KQKA 1ZMTA 2GTIA 3O3CA 2FEZA 3DUWA 1G5TA 4DLTA 2JL1A 3LA8A 3TDMA 1DSSG 1VPEA 3G2OA 2IEIA 5I4BA 5BYJA 3PVSA 1HDYA 2IY9A 4EI7A 1CBUA 2I6GA 1T6XA 3GT0A 1YR9A 1JKMA 2CZQA 3AJ8A 3IVMA 3LSYA 3N2IA 5GQSA 3EMBA 1XZEA 2P41A 1Q1AA 1SQ0A 1NMZA 1PV1A 2VR1A 4K9NA 5EQJB 2XJ4A 4JJ7A 5JISA 1X6VA 1P7CA 2WR8A 3K09C 3ASZA 3V46A 1JHDA 5BQ3A 1DAFA 1WQ4A 1SKMA 1K75A 1PT9A 3D7KA 1UBFA 3I05A 1DBWA 4XTCS 2PMCA 1QU5A 1N7IA 2HSEA 3VDMA 1G20B 2GCIA 2G9VA 3IUJA 4RHEA 1AKYA 1C7EA 2I1WA 3AR2A 4XOIA 4UDOA 1ZUD1 5BSFA 3C24A 4BP9A 3PJRA 2F1HA 2Z3WA 5EE9A 1A71A 1XRQA 1DDOA 1URPA 4MITA 4N01A 3VSCA 4P32A 5KNCD 4J8PA 2I2WA 1CUIA 5E7QA 2K2QB 4HJRA 2IVFA 7AT1A 3VHRA 3BXZA 4JBLA 1ZJZA 5H5JA 1PVDA 1RLJA 2CCJA 3COZA 1C81A 2VNKA 2OM6A 3PI7A 2IOFK 4MVXA 3RABA 2ONCA 3AETB 2WIGA 3H6GA 3I6ZA 2CUKA 3EGVA 4GHWA 1T6BY 2IOHA 4FGLA 4GICA 5FPKA 2GZ2A 3PUVA 2ZUWA 4OQYA 2I91A 1BH6A 2GEBA 1HNZB 2VKTA 5IJ9B 1CKEA 1ZKMA 1Z47A 2VT7A 3CZRA 4UUNA 3LUKA 4PNEA 2Y76A 2IJGX 3K70D 4WOBA 2GYWA 2ARKA 4HF7A 5LYYA 4ER5A 2Q0QA 5HQJA 3GARA 5ITZB 1Q57A 4KLAA 2RHMA 2JQJA 1G8KA 1NUUA 1T4GA 1YJXA 2H3EA 4XR4A 1BMQA 1NUTA 3L18A 2BFFA 1Z34A 4WV3A 3CWZA 3QE2A 4EI2A 2QLLA 2WWGA 3IUBA 4KDFA 5UKDA 5TE9A 4F5ZA 2GETA 3P9CA 3TXXA 2JI8A 3PTLA 1X7XB 4JCCA 3ZIUA 4B8WA 3G2PA 2I4TA 4G5XA 3NRCA 2XNJA 1AHIA 1FDRA 3M6AA 1BWQA 4IIDA 4PR3A 4EENA 4BNGA 4URVR 5C1IA 2F59A 5FOQA 4CM7A 4EK9A 5FQOA 4LF9B 4A0GA 4BRWA 4IS2A 5J47A 1PUJA 3MLEA 1VXOA 5A7HA 5KYTA 2E4AA 1U0RA 2C8VA 2IZ5A 1GG2A 4BLPA 2FFQA 4A8HA 4ESHA 2YWBA 1WP9A 5JELA 3C3EA 3FNHA 1CR6A 3HB1A 2I2BA 1VL5A 1HEYA 4YP6A 1RYYA 2P67A 2OO5A 2GTPA 1GDHA 1NBHA 2NU7A 3UOGA 1N4DA 3NS7A 4PC7A 2HR1A 3RJTA 2GO7A 4GG1A 3H2BA 4TPKA 2J9RA 3JQEA 4P35A 1GSOA 2P9BA 5IC5A 1KH2A 5GINE 4HP8A 4FT2A 4Y0AA 1KYTA 3SXJA 5JSKA 2C9MA 4QAQA 3DE3X 2A35A 5LIRA 1XUOA 2CJWA 3E5MA 2YBEA 4Z2AA 4QDTA 1DJLA 1MR1A 3HLTA 1TW3A 4FGZA 3OIFA 1I32A 4TXJA 3V4LA 4HEA1 1HQKA 1MC1A 4MZXA 5BSMA 5GIPE 1MJ5A 3B6MA 2CMKA 1E2MA 3L0OA 4F9EA 5FHQA 3S44A 3EXFA 4NULA 2HUNA 2WINI 3U7FB 2WKSA 5SZKB 5CT9A 1BSVA 1OGIA 3BHNA 4II7A 4IGEA 5KSOA 4C0JA 4W1QA 2NV6A 3PWZA 1Y9DA 3U3XA 3PO8A 1P1IA 5ALHA 1WLNA 5ALVA 2RBKA 1HORA 2X8BA 3A77A 4W7HA 5EHNA 4BFWA 1D0SA 4N3BA 3DYIA 4XJVA 5DHPA 1F2TA 3T9DA 1XKXA 2EIXA 4I9GA 3H1TA 1XVAA 3L4BC 1GAQA 4RZHA 1OXMA 2FN8A 3FH0A 1NNSA 4PLYA 4B6JA 3H9BA 4JBHA 3ZVLA 1K5HA 1ZPDA 2YXPX 2IYNA 4UAUA 3RWOA 5K0SA 2WJ3A 1A72A 5AQ1A 4LJ5A 3I6WA 1GV0A 2ZULA 2VNHA 2GN6A 5DM2A 3TLKA 4N41A 1N2BA 5DXJA 4B2LA 3KZVA 3AEZA 2HU5A 5A62A 5LR6A 1XROA 3N2EA 4X41A 3KL4A 3G82C 3PENA 3FCOA 5E0OA 3PUZA 2XUZA 3S7ZA 2GRAA 3A7DA 1N0HA 1EB8A 3BMQA 1ZC4A 3PC8A 5AKGA 5LP6B 1UOOA 1V35A 1U7OA 2C3PA 2Q4RA 4WBNB 4LDNA 2R6DA 1U7HA 1T0JB 4KDCA 4I99A 4PX9A 5DCLA 1T9DA 4EHJA 3O74A 1OPXA 2PD4A 4HQFA 5TQ2A 3N70A 3ZWNA 5FL3A 4YUZA 3A1CA 4QEDA 2AFIE 3E9MA 3QELB 3GFQA 5D1HA 5AW9A 5BN4B 1TQ2A 5GGYA 4RELA 1GU1A 3AVUA 2RHHA 3EIEA 3GJ3A 2B8JA 1UWKA 3L7BA 3C3MA 3GMTA 3PDHA 4KO1S 1SOVA 3L4EA 1IY9A 2A5LA 3MELA 3WLNA 4DLBA 1K7SN 3EHDA 2JAQA 1A2OA 2Y1KA 4XVCA 3AF0A 2VDUE 4CL8A 4QPPA 3PFIA 2REQA 2GNAA 4I55F 2PBLA 1S5PA 3FVTA 5TPWA 2H3HA 2NO5A 3D7MA 4IO1A 2ZE7A 3IV9A 2UUOA 1FMTA 4AZ3B 4JUBA 5T7BA 4JBWA 1XMPA 4JKOA 3QQ5A 3WLPA 1RRGA 1POXA 3DZBA 3G89A 1CRQA 3RANA 3ZHYA 4Z4IA 4J7XA 3ZE9A 1F9EA 3M5CA 2IEGA 2M6SA 1EGMB 3NDJA 1NJSA 1O58A 1QIJA 1C0KA 2JHCA 1T0IA 3UOAB 5ITVA 3EF1A 3WLKX 1NAIA 2R1TA 4OH1A 3VGJA 3GVXA 3OZSA 2HLNA 2WYOA 3ILXA 1E3EA 2D5AA 1GNRA 2COEA 1O3YA 5KQLA 1P8AA 1RPTA 2FG5A 2AR7A 4LWQA 1UEXC 2HSZA 2QAGB 1V9LA 4LBZA 4X8OA 3O8RA 1FPMA 4ZCIA 3UENA 2LRHA 1FFWA 3AHDA 4V2IA 1PW7A 2X0FA 2GA9A 2QTVA 4W8OA 3SN6A 1VSTA 2CHVA 3AFGA 3GT4A 2YXBA 1PUXA 3PE3A 4FR5A 2YV1A 3Q2IA 4KNWA 1KKMA 3BD9A 5DM4A 3M1AA 2J8ZA 3ESXA 1E2FA 2IHUA 1C8LA 4K7JA 1HDXA 3C3WA 4OFBA 1PR2A 1E32A 3NYIA 1Z26A 4GNKA 1MORA 3FAKA 4JLMA 1MC5A 4YMSA 4RTJA 1V11A 1FVOA 2VK8A 4DR4B 2EIHA 3Q3EA 2PKQO 1FXWF 1VLLA 3VYRB 1TQ8A 1POWA 4FHDA 2C5BA 3EA0A 3JPWA 1ZQ1A 4GI5A 4WASA 1OREA 4XASA 1R15A 1SGWA 2GYUA 2ZB8A 4L6AA 2IL1A 3CM0A 4ZVQA 3O38A 4FYYA 1W30A 4H1VA 2X9GA 1IHUA 4JYCA 4XYBA 4Y6RA 3ZHOA 1JH9A 5SYNA 3LO5A 1KSGA 1C14A 4IDPA 2H7XA 1C9DB 3OU7A 1ZM9A 5E1MA 1OTYA 1NRXA 1SWVA 4AMVA 4NE7A 4W5OA 1D1PA 1E3MA 3GGGA 4OHPA 3DMPA 4RKRA 2FXIA 4BLUA 3W6NA 1ZM7A 1E0KA 2LZ0A 3QJYA 4KAXA 4RA6A 3ZWVA 4B2IA 1PG2A 4Y2RA 1GGJA 1Z4QA 1TYEB 5IC6A 1V1MA 3H5OA 3ZWBA 2QI9F 1AHPA 1GTRA 4BMSA 3R9WA 5IT4A 3C41J 5IT9A 3AKYA 2VYVD 1DRVA 1SCUA 1W44A 3AB3A 4GO1A 2CCGA 1SKYE 4QODA 1AN9A 1FRZA 4HWRA 5DOVA 3TL2A 1YRYE 2PV7A 2QPOA 3C6ZA 4CN8A 5CEFA 2CVQA 3EGWA 3RYCA 2GJ4A 1AGYA 2J4DA 1SIUA 2V6BA 2BGJA 2Y1EA 4ID3A 4Q3BA 5BV0A 2D00A 2PM8A 1BDHA 3I76A 2A0WA 2PSEA 1ID1A 5LDDC 2B3TA 2PGJA 1JT9A 5KX5A 1M2VB 5SZHB 5B6PA 3HCDA 2ONJA 5BV7A 1HC7A 1RZUA 5JVDB 1F7VA 4PTZA 4K9SA 2XBMA 2PTGA 4JR2A 4S1TA 1DX6A 1CUYA 4QARA 2ZJ8A 2F9FA 3IGFA 4DANA 5HBRA 3HYTA 1CJBA 2VHUA 3V34A 2ZZNA 5E4YA 1LC3A 1FX0B 2XADA 4F91B 1GN9A 4DY6A 3HRHA 1ZW6A 3OEWA 4N5NA 2PH3A 4RIEA 2V96A 3Q7RA 4UEWA 4BX0A 1LBHA 3PUXA 2GHRA 121PA 1SVIA 4EA9A 3MAAC 3GFGA 3RYTC 3M6IA 1ZJYA 2G8LA 2VA8A 1M1ZA 4GL4A 2CLLB 3HM9A 3TB4A 2V8BA 1Q0HA 2MMGA 3VNSA 2IDJA 5AM4A 1HI9A 1TU0A 3BAFA 3OD5A 4O2RA 1A98A 1LPNA 4OEHA 1KI3A 3EDRA 1RRCA 3NFYA 5E4TA 4RDHA 5TPZA 4QEZA 2BEUB 4PG5A 4A0QA 2IDKA 4PY2A 2H2HA 4GAEA 2ZT8A 1C5KA 3NTXA 2XEXA 4HB4A 3T7SA 3OO0A 3ZW8A 5BR4A 5IT0A 5EJ7A 1R9JA 1YC2A 2PFGA 3IP5A 4V3BA 4EJMA 2IP4A 5DNUA 2HK9A 4X0EA 2ZI7A 3JQ9A 3FOWA 1E9DA 2C88A 5JPIA 3FSGA 4EGCB 4OLAA 1G20A 1RAFA 4H6XA 1HLPA 2QLFA 3QWIA 2AD5A 3MLBA 4LOIA 2IXFA 4ZYZA 3X2SA 4R0VA 3QFFA 1M54A 4ME6A 5HOQA 4BO3A 5C3UA 4UBKA 1SXIA 2GTHA 3BF7A 1GKIA 2AN1A 1PL0A 3SZUA 1RM0A 3GAAA 2AOWA 3R76A 4KHPB 3I04M 3A9SA 4LQLA 2D74A 4ZAYA 1UODA 3SHWA 4PU0A 5HKKA 3NXSA 4EG0A 3O2SB 2AKAB 3GLQA 2CWWA 3A4NA 3BWVA 3GRPA 3OQPA 1KJIA 4PG7A 4GOJA 1JDBB 2KJQA 3B1XA 4K86A 4ER6A 1QSGA 1AKQA 3B6EA 4X1IB 3C14C 3VO2A 3E2MA 2WV7A 4XB2A 2NQ2C 3I3SR 4CETA 4UNPA 3AETA 1XMQB 1U9IA 1NA5A 1IAVA 3RRNA 2HOQA 4UZEA 3H3FA 2WFLB 2F9MA 4MEBA 2IV7A 2GARA 2ZDQA 3FPAA 1Y9EA 2ZAYA 1EFDN 4TTJA 5IJ9A 1J25A 4RVOA 2AI1A 2EEPA 1I4TD 1QHXA 1DQYA 2WQZA 1N2CA 2IYTA 4MLDA 5AJWA 3WKDA 2Y1XA 4J9UE 3NWEA 3DJYA 2BUBA 2QMYA 5CX1B 1BXGB 1XEFA 1NJFA 5ITZA 3QXCA 3AZPA 1F60A 5EOVA 5CXQA 5J63A 2F48A 3SBEA 2IZ1A 1I7NA 1UJBA 4HTFA 3JZAA 2YVKA 4H08A 2C8LA 4RA9B 4PYRA 5EFZA 2O1WA 3R7SA 4CV1A 1DFGA 3P2MA 4MW9A 3PUHA 2G4CA 4Z2YA 2AXPA 3TOCA 1C1DB 2WNHA 5IDXA 3ZXIA 1ZLYA 5TV2A 3F6RA 1U0OC 2F1IA 3W5BA 1IRXA 4DDWA 1Q91A 3M4XA 2QD1A 1C8KA 3W1WA 3WJ1A 1X7XA 5L7WA 3H0KA 3KM0A 4CM4B 3GLUA 2WUGA 5IDVA 4OB7A 4ND8B 4RM2A 4TTVA 3DAFA 5F78A 2JLSA 4O1IA 3F46A 4FK8A 1RYEA 4UAGA 3LQKA 1NLMA 1ATZA 3LTEA 2XWJI 1TZJA 1JAYA 1T1GA 4RSMA 3KJQA 1ISJA 4UKDA 2DPHA 3O0TA 1J06A 1W4BA 4KFSA 1BMDA 2NUAB 2XITA 3I0MA 1I6LA 2B1QA 2EP5A 3JYPA 4QJBA 3W5JA 2O8EB 4X85A 3K0BA 1KEPA 3UG6A 2IW3A 3X1YA 5JYCA 3FOZA 3WQHA 4W1RA 1JAXA 2JGKA 4FUTA 4JVSB 1G5QA 2G4LA 4KC0A 3MSCA 4P3OA 5I7WA 1XDDA 5F4ZA 4KFCA 3PCTA 3CY6A 4OHMA 5AK6A 3I58A 1XEWY 1U28C 1PV4A 1BGXT 1DRWA 2VZ8A 3OT1B 5K5EA 1YBMA 1DO0A 2GKGA 2OHOA 2GZDA 2FK7A 2E37A 1OFGA 3UO8B 3MTEA 2WILA 4ZEVA 3NHUA 4X71A 4MRAA 1GNQA 1UJCA 1T29A 1JFVA 2R8BA 4PIVA 1P2VA 1JLMA 2LWIA 4KWIA 4A6DA 1PU2A 3L9XA 1YGPA 4OG2A 2ACWA 2B61A 1A3CA 2G1AA 2JLQA 1HXHA 1F3OA 1OFTA 5A6SB 4AG5A 1ACMA 2AVNA 3JQ8B 4BMNA 2PL3A 4LE2A 2Q4BA 1LK0A 4YP7A 4GXRA 4KPGA 5DNYB 2PXCA 1GT91 1OD6A 2C20A 4X7BA 2C92A 1TC1A 1L4FA 2N47A 4I6EA 3EMVA 4F4UA 3NC1C 1PEYA 5DW0A 3EAGA 2W6JA 3I2YX 3VR2D 1CS0B 1EWRA 2H4XA 4LS3A 3FROA 2Y0BA 2FSVC 3QA3E 4MB6A 4DLVA 1NZJA 4L5CA 1L7VC 2CNWD 3BX1A 3U17A 1BS2A 5CAEB 4KNVA 4ACBA 1MDBA 4MUJA 1HDCA 1YDHA 3MWEB 5HJ2A 2ODWA 4NQZA 3PF8A 5CBKA 1QBGA 4QNNA 3KVYA 4JDUA 1AUVA 4ALKA 2QKYA 2F2TA 4GU5A 5EPEA 4ZO4A 2ILTA 1K27A 1NKSA 1R6VA 3UICA 3P9SA 1P7VA 1XX6A 3AM1A 3P7MA 4A2CA 2EZ8A 4JP5A 3Q9SA 4YUVA 3WXMA 2D8MA 2RB5A 4DWVA 3TE6A 5BUZA 2H85A 5I8WA 1TW2A 1VIDA 3KQPA 4RQUA 3D7LA 3AGQA 2PH7A 1O9GA 4QREA 3BRSA 5IUKC 1KR5A 3V8EA 1Z18A 2ZRLA 2WP0A 1T8TA 2JA1A 4GW3A 1E7MA 3RNLA 1K5DA 1YONA 3VZCA 2YVLA 2P5TB 4CR8A 1FP7A 3CT6A 3DOEA 4XDHA 3RU9A 1B8PA 3HK2A 4H7JA 1XQVA 1K3NA 1AM4D 4AO7A 2HN9A 2GZHA 2FWAA 3B53X 3KB8A 2I78A 2PGLA 2QG9A 2FPXA 1UPTA 2I54A 4BLRA 4BTEA 2EQAA 2GFHA 3THOA 4YJ2A 3N0XA 2I62A 3AG6A 3GD5A 1KGDA 3GMSA 3I1JA 3N3BC 4US1R 4FDTA 4CFSA 1YIDA 2DUMA 2V1XA 3FPSA 4WW0A 1VYHA 1W75A 3GFTA 5C4GB 4B6GA 1WDMA 2JIDA 4REQB 4R8KA 1E92A 4RSRA 3FPFA 3KWLA 5CXXA 1AKVA 4N3NA 2H2AA 3WNBA 4NK5A 4AZ3A 1X0VA 4QGFA 5JAQA 2PQ6A 3H7IA 1GZ7A 2DPXA 1SUAA 1UBKS 3A4YA 4QATA 4DEVA 1F48A 1V1RB 3TRJA 5D5PA 4AMGA 4U2DA 1JE0A 3AZQA 3X1ZA 2C8JA 3EBLA 5D3QA 3J80A 4MO9A 3HEMA 1QTIA 3NTQA 4C7BA 4OHYA 3JWIA 4DJEC 2VHEA 3D59A 2QAGA 2WJ6A 4XUGB 3OQNA 2BBSA 3IOYA 3HB7A 5ES4B 2CN1A 1R00A 3GJQA 3N07A 1AQ6A 1P0FA 2VO1A 5EZSA 5FHRA 1I01A 3WYDA 3KDSE 1KF0A 1ENPA 3BICA 5JANA 2GEVA 4FW8A 5BNTA 5F9MA 4GC5A 3OZ7A 5KHLB 3KQWA 1I7DA 3HXKA 2PX5A 3OY2A 4MUMA 3ZX5A 4DV6B 1YHYA 3RYFB 1EUCA 1OCEA 5IW8A 5TF0A 5E3IA 3S5UA 1H6AA 4RVHA 3WGMA 5BMOA 1CY1A 4JQOA 2P6OA 4IY1A 4GE0A 2HEIA 4J7CA 8AT1A 2ZXEA 2VJOA 1T5TA 4ZI7F 1BE6A 5EJAA 4AJPA 1FFCA 1PZMA 3BSWA 3BSFA 2I33A 3KKQA 2C2OA 1UAGA 2PX0A 3MIIA 1RTTA 1JP7A 3I34X 4NOKA 2IYZA 3DL0A 1Z88A 4ND7A 3T7EA 3V2HA 1C3VA 1H0SA 1WXGA 2D0IA 1FMCA 2GM4A 3D3NA 2IH4A 4YRKA 4EW6A 2QG4A 2L82A 2PTHA 3DLPX 5J9FA 1USGA 3JQDA 1VE9A 4XM1A 3ND7A 5D3KA 1YHNA 1ORDA 4I19A 3HFRA 4ZVNA 1PI3A 3WWEA 1T1RA 4LC0A 1P81A 4A0FA 5AW3A 2QS9A 4P4UA 1ECBA 2GUGA 1CFZA 3BH0A 5BRJA 4HDSB 4HNRA 1LRJA 4X84A 3GG9A 4HX2A 4ZC1A 2FPIB 2CDAA 2I2CA 4S0ZA 1NTRA 4N5LA 2XZTA 2ZJBA 3LC7O 4Q9NA 1A9RA 1TM2A 1U6KA 4Q4AB 3MUFA 5HOEA 1DDGA 3DLIA 1Z2AA 5IYZF 4NBUA 3QPCA 1V8ZA 4WK4B 5LB2A 3ZU3A 4EO4A 2EP7A 4Y0NA 3COYA 1CZNA 1WXWA 5FNZA 5C3MA 3CVVA 4YRDA 1GG8A 1EE9A 2EVWX 1DMRA 2VQDA 1VYUA 5L3VA 5TMPA 4QKQA 3HO6A 1A7KA 1A7UA 4XJXA 1G6GA 1Z0JA 2OKGA 3E2IA 1E3LA 2IHJA 3NWOA 5DJ5A 4XX0B 5CB4A 2KS6A 3F8WA 4MVJP 2UXCB 3HXMA 1U9CA 2O05A 3A1FA 3LDGA 4YV1A 2XNHA 4Z49A 2O59A 1J2YA 1YTLA 3IQFA 4B75A 4D0NA 5KYYA 5DIFA 1CUBA 3TNLA 4YT2A 3F8SA 3IPCA 4QYSA 4E2YA 1XLVA 3SEFA 4EABA 2C8KA 2FH5B 1EBFA 5E1OA 3BK1A 3HYRA 4NZMA 4U6NA 3MMZA 3UCEA 1I1QB 1AJEA 1MIOA 4QYMA 4U2BA 4U5XA 4IXNA 2JAUA 2YZGA 4ZTUB 4IXDA 1ZK4A 3D0OA 3GOHA 5T3UA 5AW4A 5DPMA 1NBMD 3N0WA 1JG7A 3TKYA 1W5BA 4RMGA 5DX0A 2ZI4A 3K94A 5L53A 1VL1A 4ID9A 3NEJA 4OV6B 2JJ1D 1AXEA 1TM4E 2RHJA 4HUQB 4II2A 3RRYA 3WDLA 4YMLA 5HJEA 2ZWPA 1JQLB 5AI8A 1QAOA 2IPXA 1YFLA 5HUJA 3K0SA 2EBUA 4HADA 4BUJA 5JADA 2FUG1 2X5KO 5LLTA 1RQGA 4BV3A 3SICE 2QROA 4G1EB 3UJ8A 4OBEA 4JUCA 3AONB 2BONA 4X63A 1DIOB 1CCWA 4ARZB 2ZM5A 1CZHA 4G0ZA 1CR2A 3MWKA 4GMKA 4EDHA 3M8KA 2ICAA 4MQEA 4HH3C 4OA5A 5IEBA 5KQMA 3I9LA 1S4QA 1Z4IA 2BGNA 3JZMA 5JTUA 1GA4A 3SBXA 3QBJA 4F97A 3ZPXA 1XN4A 4D9JA 4NU0A 3ZD9A 2YX1A 2IX3A 2B8NA 5ENDA 2XGOA 3OX2A 1Z6AA 4UEJA 3SK0A 4FYHA 3VTZA 5PGMA 3UGJA 1A04A 2UUBB 5DN6A 2JAHA 2DTEA 1U9JA 1MC4A 1UBLS 1WB5A 3UWKA 3VR3A 4D6XA 5AKHA 3LRTA 2ZTLA 3ESRA 1XN1A 5KNBA 4Z8YA 4ERXA 1PTJA 2XVMA 5ALQA 4C87A 1RWPA 2VC2B 1IPEA 1HKUA 1QRRA 1WZCA 2VDWB 2VNJA 3HZZA 3Q3VA 4YECA 2OCDA 5KHAA 2HLDD 3T1NA 1ZUIA 1UPUA 1VIYA 4K5QA 1VDMA 2GWRA 1YFZA 2QRMA 1UKYA 3O21A 5F3WB 2ZRKA 3H86A 2AMLA 1Z36A 3JATB 2MCFA 1LW7A 1DS6A 2I3BA 4HG2A 4DPLA 5J2TF 4Z86A 4LW8A 4ZVMA 4NICA 2XQKA 3S2GA 4U02A 1YQXA 1COWD 3A11A 4GXNA 1BXGA 1V39A 2YYYA 4GRAA 1CJKC 3A8TA 4DSAA 3G79A 1H1LB 4W6QA 3H1BA 4ONEA 3GLIE 5K0GA 1Q0PA 3LY5A 3UPUA 3TR0A 4UEOA 1XRSB 4Q00A 4EHLA 3ILSA 2YYSA 1KZ9A 1X7WB 5D51S 1NNLA 3FKQA 2J0UB 3I28A 3GLGE 3S2YA 1C1DA 2H8KA 5E7MA 1KWGA 3IVXA 4Q05A 4H7HA 1I4EB 2FN9A 3KTAB 4FFLA 4LIPD 1NI4B 2Z5FA 4RPJA 5BSTA 1QM5A 3MOGA 4CLOA 4AX4A 3K9LA 1ODJA 2X0DA 3JASB 4K46A 4X60A 5T4HA 3SFTA 2BFWA 5KYUB 2V7TA 1E4YA 1PJAA 1IMJA 2ATXA 2ZK7A 3CLTD 3STVA 1GKKA 4KI7A 1TF2A 3CSSA 4D4MA 2BDUA 2Q7XA 4KE7A 3I42A 4W8HA 1WBBA 1P77A 4K05A 4BGIA 4MW4A 4Q15A 3H9EO 1GUBA 1NJ8A 1ZMOA 3N6VA 4DIFA 1UC5B 1KO4A 1T2NA 2XBUA 4ZOBA 3BXFA 5HKAA 4EPVA 1GYQA 1DC7A 4X93A 3HP1A 2BEKA 4B3TB 1HOXA 3HLKA 1UWCA 2R48A 4KN5A 3A6PC 1SXJB 2OR3A 1RXVA 2NP7A 3KKOA 3AY6A 4GPIB 1JIJA 3A9UA 1D6NA 5EXEA 1G42A 1YQWA 2QT1A 3EA4A 3HKEB 5CNJA 5KKAA 4PLPA 5JQWA 4UQPA 2RB4A 3TUIC 1NULA 4EGSA 1XMSA 3BEDA 2QTGA 2BKXA 5CDFE 3IAUA 3NNDA 4CQMB 3LKVA 1UJ5A 4H7IA 3K7EA 1LY1A 3MPOA 1USKA 4ZEWA 1NVUQ 4UUMA 2WKPA 1XL0A 2QJFA 4D98A 5EYPA 4LF4B 1KI2A 1YK0A 3OBBA 4L0DA 4R5HA 4NG5A 4RAQA 1WO8A 3MQFA 3S3TA 3RRBA 4M46A 4K6OA 1BWSA 3IRVA 2EP8A 2ZI5A 4CM9A 5THXA 4RD0A 2DKOA 3CH4B 4IKPA 5CNMA 5U1PA 2ZJAA 4P81A 5ED4A 2X41A 3B1JA 1QH1B 2QQFA 3AEUA 3AL3A 3L7MA 4IV5A 3MIZA 2B20A 4J94A 3L0ZA 3MWJA 5CH8A 1CS0A 1YRHA 1X7DA 1NP6A 4RLFA 5JAUA 3VJMA 4YYZA 1ODKA 3E5HA 3JVUA 5CA0B 1XCPA 1MT3A 2H92A 2GNOA 2JDIA 2QVBA 2UZ3A 3MWEA 4B33A 2DBYA 2JGNA 3GIWA 4GGOA 4N5HX 3ZGYA 4Z4CA 4CKYA 4UU8A 5DO9A 3ITEA 1AC5A 4BGEA 3SAJA 2O6LA 3GX1A 3O1IC 3WYEA 1U0LA 3OZWA 2XOXA 4B83A 5IZCC 4DDTA 1PZFA 3WL4A 2PWZA 4BJHB 4O4JF 4WN9A 5U4XA 3MWDB 4EPXA 4OL9A 3ESYA 4X20B 2AN5A 1G6HA 4AKHA 2V58A 4C14A 2WTEA 4Z9XA 3TQSA 1WMFA 1ZH8A 1P1BA 1XD2A 1PRYA 3O4RA 3C3DA 3JVVA 3VC3A 5JYDA 4HB0A 1V7ZA 5ALUA 3ELBA 4EFNA 1FSZA 2ZWIA 3GQBB 2GS9A 5TT1A 5LUAA 4XWOA 3VBEA 3BGOS 3D5QA 3LL4A 2FPPA 4FEYA 5CLFA 2QAIA 3GUYA 2P3LA 3C6XA 4FHCA 4K9LA 2QTBA 4QFMA 3QMPA 2PUEA 1IOWA 4KLNA 3UOWA 3RSOA 1SXJD 2WFZA 3KEGA 5IZ4A 3T5AA 1SG0A 4KITB 3FOEC 2VA9A 4KK3A 2F43B 4EUNA 1OWOA 1QH9A 4WFKA 2AG6A 2WJIA 1F51E 4ROSA 2FOXA 1W46A 3HCBA 3EEFA 5B57C 3RAFC 4CV2A 2AKYA 3DE6X 4FYWA 3T5PA 4LFCB 2QSZA 5I3CA 1VLJA 3AF1A 3AHFA 5HP4A 2ZUEA 5FTJA 1MIHA 3HR4A 3LPMA 3UMGA 3WYCA 2GBLC 2Z0MA 1QRSA 2IA5A 3FGOA 4H27A 1V3VA 3VOSA 4XLLA 3TIIA 3GRKA 2FXVA 1V0JA 1G60A 4DOMA 1E0DA 1U02A 2CHEA 5DYNA 1PNTA 3S1AA 1X1BA 3OZXA 3SS7X 3AR6A 5KNDH 3DP9A 2X2EA 3E27A 1V1RA 4F7WA 3DSHA 2H4WA 2PMKA 1HGXA 4L9AA 4LZNA 1WVGA 1OXUA 4G09A 4FNGA 3GLHA 2IUTA 4M0PA 3QKWA 4TMXA 4LA4A 5EIHA 3ZUPA 3Q7TA 1EHCA 4D8YA 1IUNA 1EGQA 2RK6A 4L22A 3KFLA 2PUJA 5I9SA 2GLUA 3TS1A 4YT5A 4BU0A 1K5GA 3LDHA 3PEWA 3CUKA 3N8NA 3ZYZA 2AR9A 1I24A 1PK8A 1Y63A 2WIJA 3ENKA 4X54A 4ZPXA 2SNIE 4LDQA 2FR1A 3L7IA 4M21A 4OMCA 5T8KC 3U1VA 4H6WA 5ALSA 5KWIA 1A9SA 2MU1A 3LP8A 2XUOA 4FMBB 1GUAA 4G2TA 1G3IA 1J8MF 4QQKA 2IY8A 2G07A 1XKLA 1U8ZA 3AR4A 4TT3A 1HZZC 1ODLA 5AJXA 1W36C 2R97A 1TKRA 3FI9A 4KRXA 2Z8YM 1OTHA 2N1BA 4HGYA 3FYCA 1WB9A 4JU8A 4EMUA 4OU4A 3PU6A 2J08A 4CGYA 2XZPA 1MO5A 3FPGA 5EMMA 4DIUA 4FZ5A 5LL6P 3R7LA 1Z8DA 1QIEA 1K2NA 1B74A 1X3LA 1N6NA 2CYBA 2UZ1B 4U2KA 2B6NA 2MSEB 3ZW7A 2OLEA 4KO2S 2CMFA 2GN9A 2PZEA 1A0OA 3SFZA 4YPFA 1RBMA 3FJ1A 2J3LA 3FVQA 1PDVA 3L6CA 4L4SA 4DA7A 1NVBA 3D8HA 3FYUA 3ORSA 4DR1B 2PT5A 2H2GA 4MROA 2NSJA 4TMWA 1NVVR 4DNOA 1UPXA 1RRKA 2PSDA 2QMEA 5HK8A 5FUMA 5JC8A 1SCDA 4HQNA 5D01A 1M67A 3RE1A 2QM8A 1X77A 2QNIA 3MCTA 3DZJA 3LC2O 3ORHA 4AUNA 1XF9A 3F67A 1I9GA 2M1ZA 3M7IA 1WDTA 1PR1A 5DHFA 4JLUA 4OJQA 3E9EA 5IVDA 4NTZA 2CLFB 5G40A 5IS2A 1VLMA 3BGSA 3DFKA 4WECA 5K0JA 2IOQA 2OORC 3R44A 3FTQA 3NJ8A 2HHAA 4G5FA 3AIIA 4FKBA 3ZXUB 3P5BA 5DP1A 4CCAA 1AN0A 1IY2A 2C2YA 1J2EA 4EECA 5HPYB 4MS3B 2FPSA 1YU9A 5CTAA 5DE3A 4RZQA 2UYOA 3S8EA 1I2BA 4DGQA 4F6RB 2CD7A 4LXYA 5JQGF 3IDAA 4LZZA 5ESRA 1UIRA 1N7JA 1KMIY 4U7HA 1NPDA 3DOJA 2ODAA 4JT2A 4BNJA 2YNMC 3LLMA 5FD8A 4H4CA 1O0CA 2ECKA 1GZVA 5KPDA 1DV2A 1WKBA 2C58A 2CXXA 2IC5A 2IUEA 3HJGA 3MYYA 4K81B 4XX0A 1ZJWA 1DVRA 1PIWA 3KOUA 4YMTA 1GZSA 3MVEA 3U81A 5KJ1A 4KR2A 2PNFA 2Q6LA 4OLHA 1CZUA 1DX4A 2X1LA 3FKSA 4IGAA 4O4LF 4RJJA 4BZPA 4B2YA 3QMVA 4N0MA 1G6KA 2FU5C 3MRTA 1WHSB 4A6XA 1M6EX 2HK8A 1JPVA 4C0AC 3AF6A 4KIUA 2ZR9A 4ZKEA 2V7EA 2QL9A 2UKDA 3MMXA 4HJXA 2ESRA 3FJYA 4P3XA 1OY1A 1GP2A 1KEZA 3ROPA 1OAOC 2LKCA 4AN1A 3PXXA 4KVZA 1C30B 1I6MA 3WK9A 5BVIA 4GLJA 2IBTA 4E4YA 4GE3A 3JQFA 2IVZA 4KQ9A 3QJ5A 5DW3A 4ENTA 2R4UA 3UXHA 4EPWA 5FNVF 3HDGA 2CKDA 3GMJA 1JT2A 2Q5EA 4KPFC 3NIGB 4C89A 1WETA 5HF8A 4ITRC 4BKRA 4R8MA 1MZPA 3AESA 1JHRA 1NVAA 3CIOA 4KAFA 4M7RA 3VSEA 3VPAA 4LXIA 4KR3A 3SVZA 1I2CA 1V8OA 3LVRE 2HLPA 1WCV1 5F73A 2KQUA 3UK1A 4YAGA 4G63A 4HDMB 2Q07A 3HL4A 5EIAA 2OG1A 5BQPA 1TIPA 1J4PA 1N92A 1V4VA 2H57A 2O0MA 4BTLA 1O5IA 3LT5A 3WI7A 3V7YA 1VL6A 5ICMA 1XXHB 3QPBA 1P5HA 3IEKA 4M1YA 1W88B 2H9AA 2E82A 2JJ8A 3QENA 1KE2A 4Z4GA 1PKXA 1GVHA 1QG4A 1A2QA 1UBRS 1UJ2A 4S3MA 4GGPA 4RJLA 3VHXB 4EFDA 4PRZA 1PWZA 2AW3A 2Z6AA 1W5SA 1BRTA 1T1EA 3HCOA 1QIMA 4V0SA 5HIJA 2PUFA 1APBA 4O4HF 4NOLA 3OLYA 4CM1A 4PONA 2AMFA 1FIUA 3A2MA 3CZ4A 1PR4A 4RVDA 5J1SB 5M04A 2TYSB 4BNDA 1ZLXA 2R1VA 3QIAA 3RVOA 3JATA 4JJ4A 5AJTA 2NNLD 2ZYGA 2JIZD 3KPWA 1MRSA 1P1JA 2RAUA 4M86A 5A3JA 1BS1A 1U7FA 3Q8LA 2QG6A 2FP4A 1QYWA 3F9IA 3NASA 2C78A 2FSHA 3HB4X 3UXMA 4R01A 3WL7A 4R1QA 4EFLA 3JXEA 3OZCA 1H1LA 3GRVA 3RF6A 4D3DA 5F7JA 5K7SA 5LUBA 1ZMBA 1M2HA 1BGWA 5J5AA 3ISJA 2R00C 4CE6A 4YP0A 4IIVA 2D4AA 1G6Q1 3LCRA 2J5BA 4LRYA 3UWPA 2HDNB 3RUEA 1Z4OA 1F7UA 1B0PA 2X42A 1KYZA 1L4NA 1Q3TA 2IGTA 4INPA 4L4ZA 5DSTA 3ZJYA 5KSYA 1KHUA 1HEUA 3JD2A 3KZOA 1G66A 5CPBA 1EWVA 1AURA 2BT4A 3ZUGA 5EIBD 3KTAA 3KETA 4W82A 1NI4A 3COWA 4ALNA 1RYFA 3ET5A 3ETEA 4WCFB 3DDUA 1EXVA 2HJGA 4FBLA 3NQ41 5DI9A 3JASA 2RI6A 5KYUA 3TVDA 5KYGA 5I8ZA 1JR3A 3DV2A 1X2BA 2W43A 4TMYA 3I01A 4TKVA 3I1IA 1J4QA 2G4VA 4OKIA 1KI4A 3BH6A 5LZ7A 3SZMA 4P4NA 4U2FA 3CVUA 1G16A 5JZBA 4I55A 1L5LA 4G41A 5FR2A 4CIBA 4LRSB 1GUFA 1WXQA 2NM0A 2VBGA 2VYND 4FQ7A 4HTAA 5LB4A 4HNUA 1NQUA 5AK4A 3STTA 5KDDA 3B48A 4PZAA 1TVKB 5LJLA 2X4LA 3OHSX 3QKTA 4LY6A 4NARA 3HYNA 3FNQA 4B7CA 4B6PA 2W4MA 3TOZA 4F1JA 1ST3A 1TMOA 5EJHA 1QB7A 2PLAA 2C7QA 1VHJA 2PUTA 2ZRCA 2OHXA 3H4VA 4DHEA 4HS4A 1YQTA 2J7KA 2OCAA 3HKEA 1U0NA 2A1UB 3OCWA 1XJCA 4RK6A 1NX9A 2XE6A 4AICA 2XRFA 1ZN2A 1VB3A 2PBZA 1WV0A 3BXXA 3NTUA 4JEHA 1RRMA 3WYBA 4CQMA 3KXPA 1I5EA 3WS7A 2IYAA 3D2AA 1BJRE 1PJQA 1SVNA 3D43A 3EVCA 4I8DA 3OZRA 2GKSA 4BFTA 4KREA 1NQVA 3I2GA 4XDYA 1BFKA 2DFTA 2HMYB 4EA8A 1JG6A 4DSUA 1V25A 3O1HB 2GN4A 1MZKA 2G25A 2PU5A 2YXLA 3LW7A 2F00A 3FFWA 4FS3A 2C95A 2CFIA 5G3ZA 3T99A 1BXRA 2W71A 2FUG6 4K2AA 2GH1A 2PKRA 4TXHA 1Q7BA 3M1IA 3PFBA 1ZRMA 4ZT5A 4LI0A 4YMIA 2P65A 1KAOA 4D25A 1QVRA 1VL2A 1Z2PX 4DG9A 3ZI7A 4Q1BA 2P9EA 1HYEA 3DDWA 2E4UA 4QQRA 2Q5JA 4DS3A 1FXWA 4H87A 3WJ7A 1KXJA 4ZI7B 2D1QA 3CH5A 4AIIA 1HDZA 4G5QA 1Y7IA 3K1AB 1ZI6A 1UXGA 4G81A 4JSTA 3GYGA 1L7NA 4LXXA 1TE2A 4M1KA 4R3UC 2V0NA 4RIFA 5ARDA 5F2OA 4N1AA 4WY2A 2Q6VA 2XLBA 3ZDRA 2XMBA 2NU8A 3SYNA 3B52X 4X20A 3SS9X 3FNRA 3E7XA 1TIKA 4Z4EA 4MTLA 1TIBA 4UNNA 4M88A 1IOLA 3KWMA 2DAPA 4KWHA 2HGSA 4IIJF 4YCBA 3E22B 2VLBA 3G3EA 4FVTA 1VKRA 4P38A 1RKVA 1XXLA 2AZMA 4MI6A 4RVCA 4KGVA 1JX6A 3NHMA 2BLLA 1OHHD 4MVJH 4KSCA 3G2HA 3HLYA 4B6FA 2DYKA 3A36A 3BTUA 5DKFA 1VLVA 4HYYA 1JTEA 1S7CA 2QJRA 4IW3B 4OQ4A 2QD2A 4AT1A 2IPMA 4HGOA 4QYIA 5F4BA 1UKCA 3DZDA 5FJIA 4HBGA 1FU7A 4IR7A 4UUQA 4E6EA 1JHMA 1B6RA 1JXQA 2C2XA 2FPKA 2F43A 3BORA 1BD4A 1X1EA 2GHIA 2QPTA 2VJMA 3CG0A 3WLQA 4A3SA 4BKQA 4BFUA 3SHOA 1JNYA 5JV5A 2OZLA 3E05A 4B3SB 4XYMA 2WKQA 1QYIA 1DXOA 3B78A 4JNKA 1L5VA 4MVJF 3LZDA 1MAWA 5BT9A 3PC4A 3T3PB 1IXYA 4KR6A 4Q24A 2ZIZA 5IAKA 4B6EA 4J43A 2AA3A 3LQRA 2DPGA 4IRMA 4KUGA 1CJSA 4MWBA 4DUPA 1FSPA 1MKYA 2PKYX 3CR3C 4H4DA 2VPXA 1C9EA 1F6WA 2CB0A 3NETA 3OEEA 5JC1A 1IBMB 2JG3A 1DAGA 2YBDA 5JW6A 1XLTC 3UUFA 1D9XA 2YMMA 1C9NA 1U2QA 3KTDA 1J5XA 3MUEA 4J0DA 4UARA 5DEOA 2ZDGA 2HX1A 4DQXA 1V2HE 1KKLA 2AOTB 3EMDA 1ZNZA 4HWGA 5D2CA 5FX2A 5I9BA 2O8BB 3HGQA 4TV8F 4CEIA 1L8QA 1XZGA 1YR1A 4ZU6X 1IWOA 2W42A 4M55A 3UJHA 2H1IA 2YRXA 4CMCA 1G8HA 3KKZA 4KQHA 4MKGA 4EHBA 1U3GA 3C1OA 2I71A 4GR9A 4BCBA 5CFOA 4PZPA 4H16A 1L0BA 5EQFA 1MJFA 5G02A 2HSGA 1SNYA 3AJDA 4I4TF 4YEDA 1K1EA 2CLOB 5AMXA 2X5XA 4DZTA 4F56A 1KP3A 1SRQA 1VGVA 3QRWA 5JG7A 4AULA 5AUNB 1MV5A 4IYRA 1BN6A 2G40A 2FEKA 3L3BA 1YKGA 3OX3A 6YASA 5JZMA 1VPWA 1J09A 1V5IA 1YQGA 3ENWA 4XJSA 2ZJFA 4UMDA 3G2NA 1SCIA 2H0RA 1TT5A 2H54A 3LZ6A 4PYKA 1X86B 1W4ZA 3OQ6A 4QJIA 4UBJA 3TNYA 1P2UA 4J4TA 1KZ4A 5FADA 5ALTA 3I5XA 2PCLA 1NQTA 2C00A 4C7MA 2CNNA 4QTXA 5JHGB 4D2IA 2X8JB 3I6IA 5E4JA 1FFSA 1X42A 4KMSA 2HM7A 3HCWA 4BQQA 5K6AC 1QF7A 2PL5A 2D1SA 2VP0A 2VHQA 2F7SA 2P1RA 2QTRA 2DY0A 3GMIA 2HZ7A 1C8BA 3CW8X 1FDIA 4J1TC 5HS6A 5SY4A 3ZZUA 3PQ3A 1KH3A 2JFZA 4NONA 3BFXA 3K35A 4KPUB 4MDYA 3IOBA 5J23A 3DE1X 4TWZA 1PF7E 3GEPA 2ZYWX 3L41A 1PWHA 5ECGC 1OH7A 4P4SB 3ZHXA 3U3JA 1TCBA 4FN4A 4I9FA 3RSCA 4DM7A 3I12A 4CI0B 2YOFA 3BCSA 3DTVD 2B1JA 5J2TB 4M7OA 1YAHA 1WY7A 4OQMA 3B51X 3RFVA 1ZONA 3H19A 2B21A 4F6RA 4AJLA 1QUFA 2J9ZB 3CF4G 4RMJA 3T12A 3VPCA 5CG1A 4HMPA 1P60A 3G9TA 1IN7A 1DG1G 4H1TA 3TQOA 3OQOA 4NDAA 1GPH1 1J33A 3ZKWB 4N8EA 2PRZA 2WMDA 3FGZA 2OMKA 4GI2A 2XUIA 2HJWA 4WNAA 1SU7A 2Y8EA 4U3JB 5BN5A 5B53A 1YT5A 4PZ0A 5IPFA 2BFBB 3L05A 4B40A 1ZAYA 1FTGA 1FQKA 2DH5A 1NYRA 2IZ6A 2OESA 3L8EA 4BFZA 3ZV4A 1OVMA 3DD1A 1QFZA 1W96A 3A27A 1D5WA 1WHSA 3D1VA 4IO0A 4ZPJA 2WZDA 8ATCA 1N2HA 1XZKA 4J29A 4A2WA 1XZBA 3CISA 1CQIA 3W8FA 1V26A 3TLMA 2JJYA 4F84A 3NORA 4E1AA 7REQB 3KSBC 2H1FA 2L69A 2RH5A 2ZQYA 4JP3A 4Z51A 1U4NA 2PXHA 3IQEA 1FLVA 1XVVA 1U8AA 1QK4A 3R77A 4PINA 2CHUA 1G21B 4UHCA 2DUUA 2ZJ1A 4WK6A 4DWWA 2ODEA 2Y4OA 5AVSA 5IDYA 1Y8CA 3PR3A 4GYWA 1L1FA 5AD1A 1K97A 1SHLA 3TW8A 4GOOD 4UAVA 4YK7A 5FO0A 1P2SA 4W9RA 1F6DA 2FMUA 3G88A 2YKGA 1NMSA 3LQ4A 3CG4A 3RFFA 4S1OA 2OBLA 1XYVA 1GNLA 4A15A 2AHRA 1U5CA 4O5AA 4NJMA 10MHA 5EXDA 5JRZA 1HT2E 4RBNA 1XTRA 4C5AA 2WM3A 2IOFA 4EVSA 4QEKA 5KI6A 2VF4X 2IOYA 2ZVDA 4D26A 1Z6ZA 1FJHA 3MUOA 2OC9A 3VX3A 2FWBA 3BE8A 1QZUA 1FS4A 3E70C 2IYOA 3OZFA 5DBOA 4CEJB 3DITA 4PYOA 3H3JA 3V8BA 3U16A 1TQ4A 4HVTA 2AUTA 2FWNA 3DCYA 3LKDA 3N3AC 3CKYA 4EF6A 1H1TA 1YZHA 4G5GA 4HH4A 1XXHA 4IJVA 3LMKA 4HDRB 4J91A 1DC5A 4N9QA 3TPFA 3VPDA 2BYTA 1W88A 2KX7A 4GZMA 4YWJA 4UAJA 4C06A 1BWRA 3VOAA 2YWJA 2QRUA 3VHXA 3LHDA 1OH5A 3RVNA 4MDEA 3ER6A 4TOIA 4Q66C 1QHFA 5BR7A 4FDLA 3EVFA 1VJ5A 4RV9A 4QQNA 1RAGA 4ETWA 2ZYHA 4GM1A 4K2HA 1EVQA 3FFBA 4KVAA 4D0LB 5REQB 5JMOA 1QQ7A 1LBTA 1S1CA 2O2DA 2VLIA 2FOIA 2WA1A 1LV8A 3MWFA 2JBAB 3OC6A 2DBZA 1CS4C 2BR3A 1J70A 2X3YA 5J59A 4DBVO 4JI8B 2V4UA 4FC6A 1B2RA 2O7VA 3IPAA 1DXQA 3ZY5A 2PV0A 5J58A 4G1BA 4LHEA 3Q7QA 2HIMA 2RGGA 3QNMA 4AZ0B 5B30A 4F92B 1AZTA 3MGBA 2C2HA 4G1VA 4XPIA 1QOZA 1L5NA 3EVBA 1GLGA 1KXZA 1MK2A 3IVAA 3MCZA 4H35A 4EA6A 1WULS 2CJYA 5EUQB 3CX3A 2A0UA 3PGMA 5TC4A 1R8SA 3SNKA 4MX8A 4LK2A 3SYRA 2J0QA 5BSWA 2GYYA 4RTRA 1NOJA 4TQ9A 4P86A 4F5DA 4XX1A 1L5HB 3DEYX 4X97A 1JSRA 3U2QA 4KQIA 4AIRA 3KQSA 1EBBA 1M7GA 4W7IA 3RIXA 5EE0A 1JQDA 3GCDA 2CT8A 1L4HA 3BWDD 1NJ2A 1U3TA 3FSEA 3HH8A 3OOJA 4O1HA 4Z7NB 4OK3A 4JHXA 1OV4A 4FC7A 2YV2A 1O97C 3ESQA 4DNFA 1D0IA 3RKRA 3EGOA 4C0BA 1MHTA 2BSQA 1NW9B 4OSPA 1LSOA 5EVCA 2IPOA 1CUJA 5MN4A 4KQCA 4M0FA 2R7AA 3PDIA 4YMGA 2C54A 3WLLA 2C9OA 4NHEA 2JAWA 3AXTA 4OXYA 1ZGCA 3ZI0A 4C3OB 2E1PA 3EIHA 1E0SA 4ND1A 3OTHA 4QBKA 1ZD3A 5JDCC 3OSZA 3BQNB 1ZGHA 2VUTA 3TZLA 1BTOA 4Y2TA 4EF5A 3P9KA 2XTAA 1TVKA 1NXVA 2OBBA 1FRFS 3LOQA 4I14A 4XVQA 2H2FA 1DBQA 1ABFA 3JYQA 2V7GA 1TU3A 4RS3A 1FS5A 1UDRA 1HDIA 2QF7A 4IINA 1UOQA 3ZDYB 5LA6F 4BGUA 4OSOA 4XLZA 4BV9A 2F3TA 4PNPA 4HATA 2BWJA 2DWOA 1M2NA 3V97A 3C1AA 1PT7A 3PQEA 3QLVA 1NJGA 2WPDA 4KXYA 4P3KA 3GHYA 4RKFA 5BQOA 2OYRA 2JZCA 3LWZA 2JBWA 3E3OA 4C4XA 4Z1OA 5DTIA 1SCNE 4Q9JA 4FEAA 4XM2A 3AUKA