4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
b'MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
1SUWA 5EJIA 3T5PA 3V8RA 4HAOA 5DHSA 3S40A 2I2FA 5DHTA 1Z0ZA 2Q5FA 2I2DA 1Y3IA 3V80A 2I29A 1YT5A 2I2AA 3V8MA 3V7WA 3V8PA 3V7YA 1Y3HA 2QV7A 5DHUA 2JGRA 4DY6A 4V24A 3V8NA 2BONA 5EJHA 2I2CA 5DHRA 5EJFA 3PFNA 5EJGA 5DHQA 2QVLA 3AFOA 4WRRA 3VZCA 2I1WA 4WERA 3VZDA 3V7UA 1U0RA 1U0TA 2P1RA 2AN1A 2I2BA 4L02A 1Z0UA 5DHPA 3VZBA 3V8QA 1Z0SA
chains in the Genus database with same CATH superfamily
3ZU6A 1M6NA 1M0WA 2YJ5A 3O47A 3FGZA 4HAOA 2FA9A 2FUCA 1KHXA 3AR2A 4F5ZA 2AOUB 2CLIB 1QOZA 3NQ41 3BRWA 3RS5A 2E9SA 1EE2A 3KB6A 1PR2A 3DUWA 5EQJB 3LQQA 1HK7A 3DHNA 1T0IA 3X44A 2GS9A 1MVLA 5DEIA 2DJIA 2CUNA 2CD9A 1GUFA 1EFUA 4DCUA 1O5OA 1W0KD 1MCZA 4JP2A 5DWDA 2IJGX 1BU8A 3VZCA 2OCKA 1L5QA 3BSYA 2PM8A 1RM0A 3H5IA 4JB0A 5AH0A 1EINA 5DN6A 5MN4A 1I24A 3IDZA 3A6DA 3KXDA 4LVNA 1II0A 4D8XA 4RJ2A 3GFTA 5DBOA 2BZGA 3TCNA 4A0GA 4D1YA 5KJFA 1P39A 1KDZA 3UMVA 3IB6A 2B2XA 5JNRA 1NUPA 2Q5LA 5EP3A 4DJ5X 2ZB3A 4NCAA 4UD6A 2W5UA 4LIPD 1IPFA 5FAXA 3IMEA 4JV5B 5EHIA 4H0FA 2F9MA 4OH1A 4JP3A 5TRTA 1E5DA 1LZKA 3QTLA 4WN3A 1SXHA 3AETA 5GQSA 3CLHA 1XEXB 1K7SN 5FX2A 2HA7A 4G4JA 5B1SA 1EFLA 4J0HA 2RHOA 4LNHA 5KX5B 4ICIA 2Q0QA 5AW0A 3F90A 1B0PA 1KWKA 1F9EA 1UBGA 1W4AA 1AQYA 2Q3HA 4RXTA 2ORYA 1GTZA 4IHAA 1QGAA 4M83A 2PRKA 2NYRA 3QMPA 4ZPXA 4KXFB 1GP2A 1J23A 4HSEA 4UUNA 5IVDA 2BFBB 2Z2YA 3N53A 3WHKA 3AOEA 2V8BA 1Y5RA 3CNQS 3TS1A 4MGKR 2FY8A 1ORVA 2WYOA 2C77A 3O9ZA 5CT6A 2O05A 1R64A 4EA6A 4FC6A 1ESZA 1SY7A 2ZYSA 1PI3A 1I36A 2IELA 2Q1WA 4GOKA 4ZHQF 5EMLA 1WJGA 3H7AA 2FN7A 3PNMA 3C1OA 5A7GA 2PGAA 3N70A 5B12A 1T9GS 4CF4A 4FWTA 2JANA 4RY9A 3ZJTA 2P0AA 5L51A 2OXFA 3HA5A 4GR4A 1D6NA 2RGDA 5ESXA 4H16A 4I9UA 1IN5A 2D2IA 3ILSA 1E3TA 1E1NA 3HO6A 4IDGA 3VTZA 1H2XA 2ZVDA 4BJ3A 2GXUA 3SJBA 1QHSA 5E2IA 1NU6A 4YXFA 1NMQA 1NYRA 3B5IA 1E77A 2JFOA 1FNSA 2AKYA 4DWJA 1DXQA 1R18A 2JI9A 2FCAA 1YZQA 1UPXA 1U9CA 4EHKA 5HWSA 1V9SA 4NEHB 2V6MA 1AGXA 4QEZA 3ZNOA 4LDZA 1Q15A 3GLTA 4QHYA 1INLA 4QVKA 4M76B 4I3HA 2DLCX 4YAWA 3RHZA 3VSBA 5ALTA 2CFOA 2PIDA 4FGWA 1GLNA 1PX0A 1T6BY 1XG5A 3I6IA 2WFLA 1L5OA 3JQBC 1YNSA 2W71A 2G67A 2XXJA 4YCJA 1K8RA 4M53A 5A3QA 1LQTA 5FPYA 3ITDA 4G01B 1E2LA 4QJ4A 1JIIA 1B74A 1RR6A 3FDXA 4JX8A 2HU2A 2IEIA 1I1NA 3JRXA 3KPYA 4H7KA 2A0FA 1Z68A 1BEEA 4INJA 1KZHA 3VU9B 4RA9A 2D7DA 2XZLA 1CHDA 2CDRA 5F2NA 3CFYA 4PAGA 2JFQA 3Q9LA 3NDJA 4Y6QA 2P6MA 5JYBA 1MB9A 3QY0A 4BBZA 3TB4A 2P9EA 4ZHSA 1GAQA 2YRFA 4LNUB 2IKQA 4IDNA 3UV6A 4E51A 3SHWA 2QV7A 1X77A 2ADFA 2GJ8A 3CUYA 4RORA 1NQ5A 1XWFA 3ZH9B 3JQAA 3KTDA 3PHCA 4EHHA 4HLQB 2QR3A 2ONZA 1HZZA 1KMNA 2XJ4A 1NKVA 4I2VA 5B53A 1V16B 4X45A 2J4DA 3AQ4A 2RG1A 3FOWA 2JCGA 3KE8A 2GMWA 2VDKB 3PEUA 1CB0A 1CZHA 3FPJA 1ODKA 2D5AA 4JU9A 4YYEA 4CCWA 2BCGY 2JAPA 2Q6VA 2TSYB 1NT2A 2QF7A 4U2BA 3PNQA 4KOEC 4ZHQA 2M6RA 3GDHA 1TM1E 4KAFA 2BZ0A 2ST1A 4MQEB 5AK6A 2Q3FA 5K3SA 3SC3A 4ZYLA 2HFKA 1OWPA 1DAOA 3L7MA 4CEJA 1BIFA 1ICEA 3W6OA 3MMXA 5E4FA 2FB9A 2O14A 2X2PA 1FSZA 3EA0A 2DWPA 1G0OA 2EL7A 4QBTA 2Y68A 4YRSA 4UJ3A 2O7SA 1N8SA 1VKOA 5AO9A 5HXAA 2WICA 2FWIA 2GETA 1MT3A 5IJZA 1YMVA 2NVBA 4UEWA 3TINA 2EV9A 5BVHB 2KB0A 4QYIB 5JXIA 2XV1A 4TUYF 5KKNB 1USWA 1N7IA 2FGJA 2HBZA 1PEAA 2EKDA 1O89A 2V0CA 2W2LD 3BFJA 1RI3A 2NO9A 2B4TO 4GC5A 3VDQA 3GRUA 1T35A 1E6EA 2ZYTX 1AA6A 1V96A 4KLZA 2QQFA 2IVFA 2ZBEA 3E15A 1IYZA 4FT2A 5IH7A 5I48A 4KPEC 1YC5A 3R41A 1HQKA 5TNXA 1ZA2A 3RGWS 5JAIA 2LRHA 3AR7A 1ZH6A 1WVIA 2UVPA 1XLTC 2C9DA 1A4RA 2FWJA 4ZP1A 4EG6A 1DGQA 2PJRA 3OZAA 3THSA 3IXMA 2H5IA 2QAIA 1FMJA 3CZ9A 1JHAA 4L0DA 2FPPA 2ZI5A 4NBSA 4RV4A 4C1NA 4KLCA 5C4GB 1T9ZA 3C3WA 1YOBA 3LRXA 4ZAFA 2Q7DA 1XCPA 1EIZA 5BRJA 4JI2B 3AEKB 3ZVRA 2C5LA 2B5OA 5JSKA 2WFMA 3OZCA 4J9VA 2F8MA 3VHXA 5DM0A 1CQPA 4DDKA 5J2UF 4DB2A 5JS1A 1T29A 2QLFA 3AK4A 3QMMA 4R3WA 1DIBA 5D2CA 3V1LA 4PO1A 3L4KA 3O3OB 3LCRA 4FOLA 5TB5A 4YCCA 3BCHA 3RB8A 4LF4B 4GGMX 3HV2A 3QUAA 1ZIPA 2IC5A 3C6QA 1AS0A 2VF4X 2VHUA 3P9IA 2FDCA 3ND9A 1OXSC 2CHGA 1D6JA 2C07A 3V3TA 2RD2A 5JRJA 2Z98A 4XGKA 3R9XB 4ND8B 2HUNA 4JQYA 4D56A 3QHQA 5JUWA 1SEVA 5KUTA 1Z0AA 3VHQA 2RHGB 3EASA 3IAS1 3E2MA 2YJTD 1EVLA 4UTZA 3A4YA 4OXYA 5G0SA 3TFWA 1T4DA 4E5YA 4RHFA 3ZD7A 1Y3BE 3MIZA 3P2KA 5CGZA 4RUKA 1BC5A 4FM9A 3FWPA 3CPEA 4PSKA 1CB7A 1GU0A 5G40A 3N2KB 3WHPA 3RYIB 1AKVA 2QPOA 3MVEA 2Z56A 2IEAA 4TUYA 4OHPA 1N2GA 1B26A 2AGVA 3OQHA 2JGNA 3FIUA 5BWOA 5B1HA 2JCVA 3LA6A 1KDRA 1IHYA 1L6RA 3DVRX 3B8HA 3FA2A 3QWFA 5TE9A 4D3FA 3OOEA 4PM4A 4EA9A 3ZCSA 1SIOA 2ZSJA 1MEOA 1JEYB 4EAAA 3KT9A 3MTBA 3W2TA 4YRRA 1SO8A 2NXEA 1RWOA 1SBZA 5JRZA 1DSSG 3WGJA 4URFA 5AFSA 3D4NA 4GXNA 3ZJ4A 2WM3A 2VT3A 2J9FB 4YAKA 1QP7A 4B43A 3EIOA 3P9PA 2QSJA 1MHTA 4JJ7A 2INGX 4O4IB 3I9KA 1SVWA 2WPDD 1JW9B 1ZGJA 3KSDO 4IKEA 1CUIA 1XWIA 4G0WA 3ESYA 3H1EA 3PPYA 3NNNA 3D0RA 4ZQBA 4J0GA 2AZXA 4LVCA 1C3OB 1D4OA 3E3NA 4FOTA 4TV8B 5D1NA 5BYBA 1MV8A 3GNSA 2WC1A 9MHTA 1PJ8A 1VHTA 4AKHA 2GZ2A 4TS4A 3QKSB 2IV3A 1SKAA 2BEUB 3R3UA 4Q1CA 3ZCTA 1HSZA 4O0LA 5HFJA 3GPBA 3D4PA 4DJTA 4G1BA 1V9CA 2HIGA 2O4CA 1MC5A 2I33A 1WAMA 2Q2VA 4JR0A 4TXMA 3RT1A 3IDFA 1DC7A 2E5WA 3EIQA 2RONA 4GT1A 2H3EA 2C59A 3ELWA 4LF9B 2B37A 5HW0A 3HUUA 1CRPA 2AG1A 3D2LA 4JL8A 5AM4A 5EJIA 2CE7A 1KOFA 4AJJA 3ELUA 5JCPA 1LX6A 1SPBS 3BZWA 4NNOA 1AUQA 1IZ8A 1NHGA 1FSSA 1LSJA 2RK4A 1OXXK 3EQ9A 3CF4A 3G8AA 4U9HS 2IYQA 4R83A 4RKYA 4OAOA 1YULA 2XD4A 4WKBA 1QOQB 2VKQA 2ZDQA 4RBNA 3OU2A 1J9EA 2C3OA 1NQVA 3BWBA 3KDAA 4J2HA 3GDWA 2YXBA 1JNYA 3PQ8A 4Q1BA 2I2XB 1CUEA 1TTPB 2QUKA 4JITA 4JCCA 1CWUA 1E0KA 1V11A 4KNVA 4QFBA 1WLNA 3GGGA 2FNAA 4CU5A 4TLBA 4FC7A 4EW6A 4G0ZA 4K46A 4QUBA 1JHZA 5AKEA 4LY3A 3VR5A 4FFPA 1ZGBA 4PHTA 1CLUA 3I9JA 2QTNA 4UHEA 3EWIA 5LYJB 1AMUA 2NO1A 3LKZA 1L5HA 3ONDA 5FXMA 5ELMA 2BSAA 1JBKA 2QXUA 2Q5IA 1H1DA 3WAKA 3NDPA 4JK3A 1N36B 1I8TA 5L3VA 1BEUB 3ZZMA 1GFWA 2GBGA 5CLIA 1DWUA 1YB7A 2UZ1B 1DJOA 3HU3A 5HRCA 5H81A 4HB0A 3U1TA 4ZRDA 2I76A 4FIDA 3UNXA 4B3RB 3OEWA 1CQZA 4W7SA 2H4ZA 4NENB 3M9WA 4KKVA 4DMMA 3AFOA 1P7CA 4RTPA 4CKWB 3DSRA 4P4GA 1PWZA 1THZA 3FWNA 3O8OA 4NATA 2GPSA 4L3WA 4JOBA 3NH6A 1J42A 4I19A 3K20A 1RHUA 1IE3A 1YK1A 4PLPA 3FGNA 3H1TA 1E1RD 3AESA 3HCEA 2H31A 2DWCA 2D2EA 3ZW9A 4BLOA 3HI4A 2PH7A 2IL1A 3ZCQA 2ZQYA 4TMTA 5DXAA 4QNMA 1U63A 2R5WA 4JYZA 2OO5A 3O7MA 4RMHA 5ICSA 1ZHOA 2W4IA 3GA5A 5EVCA 4GOXA 3ZHRA 1YSCA 1PJSA 1O8CA 4FWBA 4FGUA 3Q10A 4ECAA 4V1CI 1B2RA 1RYHA 2IW1A 1EVJA 4OBXA 5AR1A 2AUMA 2JBWA 4WNCA 1KJ8A 3BG5A 4NHEA 4E32A 2J9ZB 1W2HA 4CMJA 3NATA 4XVRA 4QSHA 3AF1A 5AUOB 1RWPA 3NBXX 4GVPA 4HDMB 1U28A 5CH8A 3WZ2A 3WADA 4HNUA 4JIVD 3S29A 2B8WA 2PKXA 1T5LA 3ZDYB 5JZVA 2E4AA 1CUAA 1Q50A 3AV3A 4MDHA 2C31A 2NPFA 3VZBA 1F51E 1UK8A 2VF7A 4K9SA 1ZD1A 4X20A 1JT2A 5DM1A 3H1GA 1W49A 2D8MA 5E6UA 5JISA 3P2MA 4QGGA 4ZWNA 1IY1A 2H17A 3C3MA 3HCCA 3ZZUA 4CIDA 3EVBA 3QG5A 5TARA 3U62A 5FFNA 4PG7A 4IOJA 4D4MA 1RABA 4JXXA 2H4YA 1JA0A 3K2IA 3VQTA 4OATA 1WDLA 2QG6A 2OP1A 1T43A 1ZK0A 1HEUA 1U4NA 1WOYA 2RAUA 4YK7A 2ZB4A 3QF7A 4MWDA 4M22A 3JQ9C 2QJFA 1GO2A 4EAQA 2CLFB 4DRZA 3DKIA 4QUAA 4RQUA 1Y5IA 3G5AA 4ALIA 1XYVA 4EJQA 3A1FA 1ECBA 4OXQA 4BJ5A 5LQDA 4EELA 1EXMA 2C8JA 2CBGA 3LUBA 3C8MA 4OQYA 1E1MA 5E9QA 4JI0B 1FFXB 3OOHA 4R9SA 4PN7A 2GYYA 5K8UA 1VECA 1J9GA 2JDIA 2I66A 3R6WA 4Q12A 2JLSA 4YH1A 3AFHA 2RC5A 2CT8A 2BGTA 3EZFA 3HDJA 4MHSA 2CNBA 5GOTA 1YCHA 4BQFA 1JXAA 2QN9A 4PC2A 5EWLB 4CFYA 4TMZA 3UN0A 2HF9A 1PTJC 1UK7A 2XKBA 4QX6A 5DNWA 4JC0A 4YQEA 3K6KA 5BT8A 4JLSA 1OIVA 2FUEA 1BFKA 1SD5A 3HJCA 2ES4A 4KN8A 1NW3A 1N3BA 2HA5A 3KSZO 5CG1A 4BXOB 4UUMA 2I6XA 1BDMA 2V8OA 3K0EA 1V1JA 1MX1A 3PFIA 5LBUA 3VZDA 2O3UA 4TMFA 3H0CA 3OTOB 4OQNA 2J5KA 2FG7C 1SOUA 5E9AA 1VBFA 4BKUA 2XMZA 3NHMA 3ND8A 3WP0A 4HGNA 2CMGA 1R4NA 3ICCA 5KOYA 1SCBA 2EEZA 5A4IS 2GJKA 2HLDD 4QPCA 5IMSA 3QE0A 3ASUA 3KQTA 4OA5A 3ZWPA 4RTRA 1EVYA 2MU1A 1KKLA 4B71A 4GOLD 3ZDBA 2A9PA 4MYUA 1WKBA 1IPEA 1U3UA 1ZI9A 2FW9A 3NBAA 5HQTA 3UICA 1C0LA 2CL5A 1DBQA 2WM9B 3IL2A 4ZXFA 5GJVC 5E4JA 2UUAB 1S8OA 2JLCA 1CT9A 2B3TA 4R1MA 3T52A 3L4EA 4IZ6A 4DQVA 4U2EA 2W6IA 4UTXA 2YHBA 4BIMA 2CHUA 1JQ5A 3GBVA 4GSLA 3NBMA 4XWTA 1MFPA 3OQBA 5JI2E 1BGXT 2QRVB 1R0LA 1M8FA 1S2OA 4IQFA 2D5CA 3AY3A 4X97A 1RC8A 1RKUA 4KR7A 3A10A 3KNZA 1J97A 1XQXA 3ILYA 2GN4A 5DO9A 3LC7O 4E6EA 2Q5CA 4FX5A 1V5GA 3N2GB 2Q4OA 1OLSA 4YRPA 2WIGA 3GU3A 1Q3KA 3GFVA 5J4HA 5DM70 4DUPA 3PUXA 1O96B 2I3GA 4PIPA 1U7VA 3I52A 1Z4QA 5IM5A 4R2IA 1KU6A 1H2EA 1ICIA 1XDDA 2JGMA 1ID1A 1RAGA 3DTNA 1ZJYA 4NESA 4XYMA 5BR4A 1H8EA 3OCJA 2H51A 5GONF 4FMCB 4RWZA 4FYXA 1GR1A 2F8LA 4LUCA 3VBEA 2Q4BA 3I5MA 2WJWA 3LNTA 3TKAA 5DHPA 3W9YA 3WKCA 3KJQA 5BV8A 3BD7A 4QRIA 3ZGVA 1IOVA 4B81A 3VH4A 2OC9A 3LVBA 4DGSA 4G2TA 2CFSA 4G85A 1TOAA 2P2SA 4BLQA 2QHXA 4BTVA 1ZWLA 1ST2A 3BKWA 4NQRA 1XZJA 1A1VA 5EEHA 4UNRA 1M8JA 3NEJA 4IQGA 2FDRA 4BLUA 4DSZA 3KTFA 4YCBA 5JYEA 4UE2A 1Y1RA 2X14A 3NETA 3MYRA 4W1SA 2FZLA 3EYAA 4FGSA 5K0FA 2NP6A 3NHSA 1NJ8A 3C3XA 4MR9B 3LUHA 1EK1A 5KOHB 9LDTA 3S8MA 1XJ0A 3TI9A 2Y2UA 3A04A 2SBTA 4ZC1A 3C3AA 5I4KA 4DLUA 3IT2A 3IV9A 3TR6A 3ZHTA 4TT3D 1ULUA 1DBSA 2EDCA 5A6SB 4CM1A 5EJ5A 3OIVA 2C29D 2OHIA 4H6WA 4TROA 1UHTA 121PA 1P62B 4R2MA 2O54A 1IUOA 4LKRA 1HG0A 1JA1A 4XA8A 4F8YA 2AXNA 5DRTA 4UM9B 2XXAB 3LRTA 2QLNA 2ZROA 2ZI4A 5CVEA 4HH3C 2BM9A 3BZBA 2O2EA 1DAEA 5B6JA 4LBWA 3AVVA 2GLUA 2VA9A 3A9CA 3BGSA 4XR4A 5EN4A 1G1AA 1T2DA 2H07A 1IMOA 5DF1A 1P2FA 4BV9A 2AN1A 2I2BA 1JPVA 1VDZA 2G8NA 2NZYA 3LCUA 4G0NA 1S9DA 2NACA 2X19A 1XTRA 3V2UA 1I0ZA 1OAOC 4DCGA 3PNYA 1G6KA 1KZ9A 3K9NA 4XJTA 3F8WA 5K3FA 5JPDA 1RRGA 4O4HF 2VTBB 2H65A 1CR6A 1J39A 1II8B 1AUPA 4K81B 1IUPA 3CZ4A 4OHCA 2OP0A 3HCWA 1C81A 1NJ1A 4BGVA 3OQIA 4EHLA 1XWWA 3AEQA 1PS8A 2BEVB 3BMOB 4N8SA 4MWOA 1WLYA 3OHMA 4JHXA 4NYMQ 4YRDA 5TMPA 3ROTA 2QDXA 1T1SA 4RENA 3IPXA 3TEMA 1NC1A 1D0IA 5D3MB 2IZ5A 3GP8A 2P75A 1VI6A 1XLUA 4MLPA 2Q29A 1VRCA 4H59A 4NYIQ 1D09A 1I6KA 2K2QB 1T0PA 2BGJA 3CUKA 3KO8A 4QULA 5KC8A 2Q99A 2YMMA 3VPSA 3AY0A 4TVOA 3ZWVA 3M1IA 2I65A 4F8EA 3OKPA 4RZQA 3X3HA 1O6FA 2BR5A 3T41A 4R01A 1CVIA 1O9BA 1YA4A 2XAAA 4JGBA 5C7YA 3QEBZ 3H13A 3HLKA 4RL6A 5H0IA 1S2IA 4WFKA 4B17A 3GUUA 1SCUA 4KAXA 3VZPA 4FCVA 1LDNA 3WNDA 1UZLA 4J7CA 1ZCFA 1JVBA 2VYND 3HJAA 5A5FA 2W42A 1YVEI 1UBNA 4X71A 1GG8A 2GLTA 1G55A 3LPAA 5AM2A 4RMGA 2W90A 3NHBA 4AK9A 4MK4A 4RK1A 2P2YA 2O20A 2G9VA 3AFIA 4YJFA 1DHRA 5AVWA 5HIAA 1WZ2A 3UWPA 2NWQA 2B2CA 4PIMA 3UF0A 1NI4B 3BXHA 5F9FA 1R6BX 4DARA 5K5EA 1A88A 2BHNA 1DMSA 1Z0UA 2HYDA 4OI2A 3EGDA 4PVCA 2G06A 5AD1A 1PSWA 2UZ0A 4W1RA 4AJ4A 1NVDA 1TO2E 2RGGA 2D1RA 2VP2A 2WQ6A 2OXEA 5D3QA 3TPZA 4YHHB 4X64B 2EZ8A 3FTFA 3VJKA 3QYFA 2Q21A 1HKUA 4UJ5A 3QF4B 4G41A 2AB0A 3T7AA 4Y9SA 1MABB 1DTWA 1R8YA 3NEAA 2H7YA 5LB2A 3KT3A 1G8GA 2NTEA 3BHJA 2EJTA 3A3KA 4O4HA 5BVIA 3GAMA 4Q9NA 3CVYA 2DHCA 1NYLA 2B83A 2C42A 2IFTA 1NW8A 3G13A 5KOJA 3R0ZA 3ZE6A 3LLVA 4DABA 1BWPA 5DXFA 3V4OA 3HCBA 2WJVA 4ZMBA 1T13A 5ALGA 2OCXA 1EWQA 1NASA 1PW7A 3IEMA 1BHSA 3PLNA 3QX8A 1X8XA 2EHDA 1QU2A 3W90A 2G4LA 2WWHA 5DHSA 2OV1A 1HZJA 1XQYA 4YAGA 2Q1SA 4ZRMA 2G1PA 2Z9DA 1TT5A 1VB5A 2NSYA 4OHOA 1E2KA 1V37A 2AK3A 3BE4A 5LM3A 1AG9A 3LU1A 4KQJA 4Y3UA 2WUVA 4QOGA 1MFZA 1GCIA 3B1KA 2EVWX 2Z8ZA 4KC0A 4FHEA 1PV4A 3QOXA 1GUAA 4BVLA 1LK0A 1JSZA 5I9TA 5HTOA 3PO8A 4EI2A 2V6FA 3C4QA 1QHGA 2R6DA 3HXPA 5DCWA 5SV2A 3KKOA 2JGLA 4WN9B 1QKKA 1UJBA 3WTBA 4DPKA 4KYIB 4M0DA 2XF8A 3OU7A 5F73A 1YQ9A 3TJRA 1QGUA 3B85A 2JVJA 2GZSA 2RFLA 4Q7JB 4UQOA 3ZI0A 1U0HC 2PQ2A 3KSUA 3ZDZB 4A8JB 4WCFC 1NW5A 4C01A 2IUEA 2FMXA 1O97C 5CEEA 2VBIA 1CE8A 1YTUA 3H5RA 4MEAA 2P8JA 5B4UA 3Q3IA 4PRYA 3EWNA 4MMZB 4G81A 2WZDA 3N6VA 4DMLA 4UDOA 5JS8A 3IQFA 1P80A 5E8RA 3A26A 4QXQA 2B4RO 4YFYA 3BF7A 4ESVA 4ITUA 4LI0A 1QG2A 3E23A 4O0MA 5K6AC 4MKXA 2HZ7A 5FULA 4DKXA 2IHBA 4B5KA 3GJ4A 1SIUA 1ODLA 3ETEA 4RMIA 1KOJA 3G8CA 5HQ3B 1XX6A 2VBCA 2O8BB 5CM2Z 3PK0A 3QVMA 5ULLA 4BN0A 3DUFB 3DPSA 4FX2A 1CS4C 1U9ZA 5FBKA 3FFBA 3ROEA 5KVSA 1SBNE 2FJPA 5CJ2A 4BWVA 4YGXB 2J4CA 3DFIA 5J2TF 3I42A 4DBZA 1EMDA 1II9A 1SCNE 3I6MA 3L1JA 3JYPA 2IYNA 5F5LA 3HVRA 3MWDA 5FA5A 4XPIB 1E7YA 3WC4A 4M1ZA 1XKQA 4WVFA 1JLHA 5T8KC 3ZLBA 4EJFA 4PGMA 4OI1A 3GMDA 1TGVA 1V8DA 3L0DA 3M2TA 4G9BA 4IOLA 1RSZA 3EOAI 2WILA 2FZEA 3UMJA 3ASVA 2OXRA 3ZHCA 4YPOA 3VPFA 2BP7B 1PV2A 4B32A 3WIUA 2OQVA 1H2ZA 2Z1NA 5IC6A 4EMUA 1GGEA 4YLGA 2HWWA 2ZIAA 3TH5A 1JWBB 2YWBA 1BKYA 1MR3F 2YHSA 3ZI4A 2O2XA 3O4RA 4BNFA 4U02A 2ZXUA 3WRYA 3BA1A 4IR7A 2BUBA 1U8ZA 4L73A 2I67A 1XTBA 5HZMA 4JEHA 2QRLA 2G4VA 1CRQA 2F1RA 2VJCA 4PONA 2FK8A 3WLOA 4JJ8A 3OURA 4XLLA 3DLHA 4BEJA 5KYGA 1K3QA 3GARA 1LRJA 2O0KA 3C43A 4QT0A 3CMCO 4F9TA 1HC7A 2Y3IA 3UXYA 2KI5A 3EVNA 3EVAA 4EUNA 5IAAA 1G66A 1PK8A 3LQYA 1LI4A 3EMKA 2ORED 2C2GA 4URZR 1SAYA 1GDTA 4KFRA 1T5HX 2PKRA 3AM4A 1RJGA 3OD1A 1L8XA 4CGYA 4RTKA 4YAUA 3WISA 4B6GA 3JZDA 4ZVTA 1PR6A 3FX2A 4Y1RB 5JQGB 5TEWA 1MKYA 1NLMA 5LNK1 1F4PA 1G2QA 5JERA 1SKMA 4X3CA 2X76A 4UVGA 1D6SA 4PS1A 3LP5A 3FTPA 2JA2A 3OLYA 1IG0A 2H16A 4MRSA 4FNOA 3C8DA 1B6SA 4KIGA 4G4IA 4GSYA 2H1IA 3IHTA 3QKWA 4AP6A 5J2TA 1UZAA 4TTIA 1MZPA 2ZRLA 4ZOAA 4MPRA 4JAVC 5I7AA 5IBRA 4DKJA 2CXNA 3CT6A 1GVHA 5ALZA 5J4VA 2ZJ0A 3P97A 4EKIA 3Q1LA 3CUWA 3DGEC 4Q48A 1FZTA 3NC4A 1A8QA 4DJJA 3D0QA 3U09A 1RBMA 5LZ8A 5KMGA 5JARA 1W52X 5AK4A 5AIBA 1UFOA 1RCFA 2ZRIA 5AW7A 2N42A 4AC9A 1HDRA 2MHCA 1H69A 4KRXA 4HV4A 5EZYA 1KH1A 1P77A 3UM9A 4YUXA 3DEHA 3LUPA 3M89A 1VJDA 2GN2A 3TIIA 3BHIA 3UJAA 4G9EA 2XE4A 1GTJ1 2OFOA 4RMJA 5CCEA 3OWHA 3SS9X 4ENVA 2HEIA 4CMBA 5AVVA 5ES4B 2C99A 2DWQA 1QUEA 2J8ZA 3HN7A 4L3VA 2JD0A 2Q4RA 5FTKA 2D4AA 2B1GA 4J03A 2LP4Y 4TGLA 1TMGE 1HGXA 4XKJA 4RLQA 1HI9A 3T9CA 1G1MA 1TQHA 2ALJA 1PIWA 4CV1A 5EXEA 4CIBA 1NBIA 2WG2A 1GRVA 4NARA 4MUAA 4Q02A 3NRJA 4ZZ0A 4PHGA 4A73A 5E3JA 3LCJA 4PYRA 1W7AA 1ECCA 1U1IA 2CWWA 5A4MS 3EYWA 3WGHA 3TGPA 2E37A 2QOEA 4DUGA 3BFPA 1HA3A 5KYUB 1RC0A 2KS6A 2ZSUA 5A5DA 1MTOA 4KPFC 2CXTA 1SKUA 3BL6A 5FQOA 3A9SA 3OX2A 4M9UA 3FDFA 2G9NA 5KTPA 4XR9A 1QX4A 1W46A 1J0BA 1S3FA 1SBYA 4TMVA 4QBGB 1DEVA 4YROA 4NDZA 5BUSA 2PUAA 2JLYA 3WQBA 1Y6FA 1W25A 1BX0A 3CEHA 3SWWA 4ZI7F 3C39A 3EIWA 1GPKA 4IDDA 5A3SA 1CS0B 4AN4A 1GXCA 2VJDA 1WXEA 3K73O 2YH2A 1CK4A 3CLUC 1UDBA 4FDLA 4WOJA 2FF7A 1OBFO 3ORSA 5F3DA 3W34A 1E3JA 1W6RA 3WWZA 2G71A 1J56A 1XFDA 4EQ6B 2HL6A 1M1XB 5B3AA 2Q1YA 1AK9A 1N1GA 5ALUA 3S44A 4CLRA 4ABTA 1QGOA 4QQKA 1V8FA 1JDPA 1EHCA 3PCXA 3ZZNA 3KZ1E 1P2BA 4P8RA 2R8BA 2XBLA 3NV7A 4IAOA 5JBQA 2WNSA 4J91A 5DW0A 3ZGOA 4BFZA 1ZCZA 4AROA 2XRYA 5EYPA 1YKSA 4L4ZA 3FMPB 1A8HA 4KL8S 1BVUA 3W4KA 4AQ7A 1W5SA 3ZH2A 3SY8A 3TECE 3O38A 4FD2A 2B8JA 3R5KA 3IJEB 1QV6A 2JRLA 3SSAA 5ITZB 2Y05A 4FIZA 3WP1B 3H4TA 5BNWA 2XB6A 3AI1A 1R6AA 3PHGA 5C0OE 1TAGA 2ZDGA 3E9QA 4X00A 3GCXA 1S02A 2I1VB 1QU5A 2AH5A 5E3HA 4S2UA 1SD2A 1OILA 1Y6RA 4OY3A 2EFHB 4YQYA 5DRYA 1SURA 4R51A 2QVGA 5BSHA 3A8TA 5EJGA 3ZI7A 2ID8A 1MPXA 1ZVQA 2PEYA 3OCWA 2FQXA 1XSEA 1ES9A 2VAMA 3EIHA 3BXZA 2XT9B 3DDNA 4CETA 1A82A 3NHYA 4JC4A 5DTQA 2NSDA 1S6YA 3RHTA 3AI3A 5DOZA 2OENG 4RLHA 2F3RA 1JIQA 2FZ5A 4IJKA 4WY8A 2LXNA 721PA 4RZSA 3C7DB 4O2AF 1LLCA 3K9HA 4CF5A 3OZVA 1QZUA 4C4OA 1JKXA 5JCZA 4FW8A 4FCTA 5JCJD 4EHIA 2I3DA 4Y2UA 1KP2A 2IHVA 1QAMA 1J1IA 1U4SA 3EN0A 4LMBA 4LW8A 3BD6A 4O4LB 3VYVA 1PUXA 2REQA 1T8RA 1H1LB 2VP9A 2YMQA 3NCHA 2NIPA 5D51S 3UATA 1CW2B 4P5DA 2VT2A 1V5WA 2Y92A 5KVCA 4N3CA 3BHNA 1J2RA 2F4VB 4RS4A 4CLOB 2YBDA 3KEGA 1YZKA 1I4TD 4Y2PA 5A0VA 3A1EA 3JARA 1O5IA 4LYHA 5J2UB 3WK8A 4BNXA 4C0SA 4F38A 5KU7A 4URYR 5IDWA 3PWKA 3U7EB 3TG8A 2OYRA 4YWHA 3ZQKA 4FBMA 3IE2A 1T6ZA 2J1LA 4MYRA 2W70A 1E2MA 5G0UA 3RJZA 4AB1A 4CRWB 2DBQA 2Z8YA 4Z3DA 2IPMA 3IBTA 4J07A 1DC6A 1TK3A 4P83A 1N4AA 3SXPA 2JGRA 1JQ3A 3SQNA 2P9YA 4ZT3A 1J00A 1X19A 3IBCA 1V0JA 5EMJA 2XSZA 2X6TA 3K8ZA 3RWOA 3DDOA 3CRZA 2VHTA 3GO4A 4ZTZB 1JLLA 4LSWA 4DWVA 1UPCA 4LYJA 2XRZA 4R1TA 3DZDA 4IUYA 1ADGA 3B3JA 4M49A 1O58A 1VMEA 3C3EA 8AT1A 3OZDA 2BRUC 4IMRA 5FL7D 5BV1A 2IIVA 2OAGA 5AXDA 4CNBA 5A7FA 1JSCA 5DSXA 5AW5A 4LZAA 1UIMA 1KYQA 4ZODA 4DA6A 5F4BA 4B4DA 1TAHA 1GU7A 4I5IA 3F2VA 5FWDA 1XDGA 4RHCA 5LD2C 1SPXA 2CSWA 5CB4A 3WFJA 2QTGA 2VHYA 5CM9C 3MWEB 3IAAA 1NPTO 1PJCA 1JNXX 1GR0A 2H59A 2ECQA 2QLJA 2XJ9A 4MDYA 5LOVF 4IGIA 4O2AA 4Z9XA 2FQWA 4M9RA 4H87A 4Q4AB 3VJMA 2HNBA 2X41A 3KJHA 1BS9A 3GJ3A 4LRXA 1QQBA 2OK7A 4QODA 2HH9A 1KHTA 4HX5A 4RQBA 4E09A 4K26A 3DC2A 1VPVA 2K5UA 4OK5A 1U3TA 1U65A 2D0IA 3IS3A 3NBFA 1Z4LA 1LA2A 2BHRA 1MAWA 2PWZA 3PGMA 2ONCA 4FINA 1U0EA 1DDIA 2J3DA 3NX4A 4URXR 1M2VA 1N0WA 3GA0A 4B6SA 1P4AA 3VKHA 4BY9E 4C4AA 3G85A 1YRQA 2FMKA 2GCGA 1ZESA 4WKCA 3QZUA 5CCBA 4P3NA 1GFSA 5EMNA 2OXTA 1J70A 4AM8A 3EXAA 1UJ6A 3F3MA 1QNFA 3K8YA 2UUCB 4AKIA 5DJ5A 3HXOA 2OGWA 2Z04A 1MBZA 4J0QA 2KMLA 4K8RB 4RVHA 4Y67A 3AR5A 1L7PA 3KFXA 4JYAB 3U44A 1TM7E 2Z5LA 2F3UA 3QPBA 3H17A 4H4DA 4HADA 4U1RA 4RKRA 2HPZA 2B2NA 2BKXA 3OUZA 1R00A 4AJIA 2BMAA 1IJBA 3HXTA 3Q7QA 4EX7A 5I5GA 1M7HA 2CJFA 3ICOA 3OC0A 1FTQA 4A0EA 1MQSA 3EGVA 3DPUA 1I6LA 4DY4A 1W9MA 2WTBA 3KTAA 4OJTA 4ZVPA 3RBAA 1EWVA 4F04A 5JDIA 1FVXA 4ALJA 1QDEA 2Q2QA 5JANA 3DLAA 3GBSA 2PCLA 4R31A 1Z15A 4IHQA 1R0YA 4WX2B 4AO6A 3DWEX 4DQUA 2GFQA 1HE2A 3MGAA 1DKRA 2ZYUX 2J7PA 1ZU4A 3M5CA 3PUVA 3RG2A 3WRXC 2JHFA 3UHOA 3IR6A 1YRHA 1MIHA 2J31A 3FGOA 3NUQA 1OBHA 3U3XA 3ZDCA 2FRXA 1XA0A 2X9GA 1DE0A 1GPUA 1N5RA 4QXMA 2OCYC 4INAA 3CRW1 3OZ7A 3NKFA 3Q5GA 4CWAA 1EQ2A 2VP3A 1U0RA 3W1VA 2AEJA 2X0JA 4ZI3A 3OJXA 4E5PA 2EJCA 2G36A 1HV8A 5EJ8A 4DQLA 2NUPB 3EGWA 4Y2GA 4BNDB 1DIAA 1P18A 1VHDA 3FNRA 2EERA 3NB0A 2RBKA 4D8YA 3PA6A 1FFGA 5LOVA 4HATA 3EVDA 3GNTA 4O2LA 3QPCA 4F2GA 2QGFA 4BB0A 4Q00A 2RGXA 3SYKA 2NXWA 1KK0A 1YRLA 2IUTA 4TQGA 4JI7B 1AMOA 1FTWA 1FF9A 2C84A 4EUFA 2BTQB 2R5NA 4XVCA 5C1PA 5K09A 3PDWA 2QROA 4BP1A 3GXBA 1Q16A 4UNQA 5COBA 1PNOA 3M9XA 4ND4A 4L4YA 3S4YA 4JBYA 3V4SA 5HVNA 2A4KA 1I3CA 3BK1A 1TJYA 3PSAA 5GP1A 1RRPA 4HDKA 2NW6A 4YT4A 2MSNA 4OOEA 4OHYA 2JC3A 2OBXA 2RGNA 4BLSA 3N74A 4AP9A 4KODA 4NZ9A 1Z3IX 1GQYA 2EKQA 3E2IA 3B1FA 4YJ2F 1PQYA 5FORA 1KE2A 1NRJB 3TUIC 3WR5A 4Y1FA 1KJIA 3UTDA 2A1UB 2OPBA 1NVXQ 2WWWA 3BXGA 4I1OA 2PV7A 1U1CA 3KWJA 3GPIA 3RVKA 3KSBC 4BEWA 3AVOA 4MW7A 2X1MA 3ISTA 4HGQA 4I50F 3AHDA 4ZU6X 3ZQJA 5LQJA 4QEKA 4L7QA 1GZDA 2A5YB 1BMDA 4K87A 1SRQA 5CIYA 2QD3A 1XDSA 4QEDA 5K4GA 1LW7A 2Z83A 1GIAA 3DKRA 3EUAA 3B2EA 2GSDA 5EHQA 3UJ7A 3WYAA 4B73A 5A4FS 3S2UA 4JMLA 4LRSB 1X80B 1CVLA 1EFTA 1MVOA 1ONNA 1V6SA 3G9QA 4LVUA 5F12A 2HMWA 2WUFA 4MWBA 3R5JA 1F3LA 3KZVA 3HBFA 3R3ZA 1BCRA 1N2ZA 1KK3A 1VBMA 2WDZA 1OYYA 2M1ZA 3V1TC 3QLJA 2QUHA 3ZGNA 1OLUB 2ZSAA 3Q9UA 4OP3A 3WXMA 4YMHA 1CXZA 4I5EA 3H6GA 4V0RA 1Z4OA 1WA5A 1GITA 3UV7A 1YZGA 4UPVA 5CEJA 2IYUA 4V0QA 5DTJA 3TSYA 2FPGB 2FHPA 3KHSA 1QRDA 1OIWA 1RDFA 3HKEA 2GM3A 3I30X 4BFWA 3HJUA 3GDGA 4LPKA 2WMNB 1UADA 1UUFA 5C31A 5FV7A 5B37A 3G8BA 4AKSA 1SBCA 5JQGA 1EM8B 2RI1A 3OZGA 1X9IA 1DCMA 3UHFA 3B2QA 3OQNA 1HQCA 1MAUA 2VPQA 4G2NA 3WNCA 2PAAA 4G25A 2WTXA 4HNAB 5KJCA 1JWAB 2IK8A 1VFPA 1GEGA 3DV0A 3DT6A 1T34A 1U0BB 3T3MB 1VLHA 4M0LA 5DGHA 5AOVA 1JR2A 1PWYE 3LLCA 5LQCA 4HQRA 4II3A 3W9SA 2IQ5A 2XGOA 3OFVA 1GQRA 3LY9A 4BQEA 1VMAA 4KXVA 4PRLA 4QGHA 3WJAA 4YJ2A 1FNMA 1UXGA 1IM5A 5FTMA 3QMWA 1B0UA 3L46A 4KVGA 3E5MA 2R44A 1RI4A 2QR5A 5KX5A 3UK6A 4LJ4A 3WMFA 1Z06A 3M6LA 4RVOA 5KYKA 3ZGLA 4UUOA 1O94C 1ZZEA 3KQUA 4OQ4A 1RI1A 4L27A 5H02A 5I45A 1K7CA 3VNVA 3ET5A 1ETUA 1DEKA 2WOOA 4I50A 3NW9A 2F00A 4QIHA 2WIBA 5DM2A 2OLJA 1E9SA 1ECPA 1K2NA 2HJRA 5DBFA 3IAUA 2GRUA 5F1YA 3D0OA 3SX4A 1G3RA 4BMZA 4DM4A 4MV3A 4DV6B 4FYIA 4YMSA 1UOEA 1K0UA 2CJPA 3AM5A 5KI6A 4BJ6A 4EF4A 4XIJA 5B1DA 3AVWA 1VQ1A 1ZKDA 4EBFA 2R60A 2H0AA 3JD1A 3HZHA 3MOIA 4IINA 4JMPA 4MYSA 4YUAA 2OO3A 2WKWA 3DZIA 3OY7A 4LAFA 4PYNA 2XA1A 1OHHD 2E5FA 2J46A 1XHEA 1YR6A 2XNDA 3NM4A 3E5NA 3DV9A 4FDAA 5K3BA 3T5DA 4DRXA 2QXYA 3AVTA 4MICA 1BHQ1 1SCKA 3CLRC 3BRCA 1U2EA 4AY6A 3SXUA 5A2GA 3I9LA 3KR2A 5LSAA 1DJLA 1NGSA 3N5KA 3DEFA 5IMBA 5BN5B 2IV2X 2JH9A 5CRIA 4KJXA 3QU5A 4YV7A 2NLOA 2VI5A 3A6GA 3S1AA 3SMQA 3WWOA 4PYJA 2XWJI 1QIJA 2QNIA 3N7UA 1OREA 1SQ6A 3DB1A 3LL4A 4RDIA 3E05A 1UF9A 4H6PA 3HZRA 3FJOA 3AKDA 3ZGYA 1MB4A 3BVPA 4CDGA 3WS7A 4DQXA 3L9XA 1QR2A 4QUHA 4B34A 2OBNA 4K9KA 5DIZA 5J5AA 4B0PA 3ZY3A 1G21B 2KX7A 2H5EA 2G76A 4ID9A 4UBNA 4IFIA 1LPBB 1BWSA 2O3TA 1SHLA 1X42A 5A4DA 4EG8A 1CJCA 1F2UB 3TQCA 1KEWA 3TB6A 5LQSA 1RIFA 3ZY5A 5KJ1A 3IOMA 1MR1A 2FX3A 2XB9A 4XVHA 1XD2B 3NBYC 1P9LA 3QHPA 1R8XA 1YR1A 5GONB 2H8GA 3HADA 2PX3A 1LPOA 2BEWA 2NSJA 4HL6A 1Z4NA 1T5DX 4PNZA 4X60A 2DE0X 3NJ4A 1OV6A 1IY0A 1SU4A 3AEQB 1WCIB 1EHYA 1DJNA 4IZOA 3B5JA 4KLRA 1CQJB 5BQOA 4YY3B 3ZIDA 5AP9A 2QN7A 5EWMB 1GAXA 1A7AA 3H11B 4JOSA 3GRVA 4NMXB 1NX6A 3CEJA 5SZKB 4FR0A 1MP0A 4IIJF 1MJ5A 3O3MB 4RA6B 1OLOA 2Z4SA 5FBVB 2II6A 3I01M 2HIHA 4NJMB 1CQIB 1R16A 2P1ZA 3TLAA 4EUHA 3BJMA 3OT5A 1HDGO 3X1XA 5ELLA 1VSVA 5J23A 2F1JA 1RXVA 4ISBA 4AZ3B 4WT7A 4PHCA 2G0AA 1I6WA 1RW4A 1Z18A 1QS0B 4MGHA 1S8NA 3G5TA 2BD0A 4C21A 4U63A 2HQOA 2PSEA 3G1UA 3GEEA 4Q24A 2E87A 4CMKA 1DADA 4YJHA 2F43B 1XV5A 3DV2A 1EUYA 4XPZA 5ICGA 2MSLA 3G9UA 3OZTA 1MQ8B 2R00A 2NT3A 3M1LA 3V7FA 5EP2A 3WSTA 4X6UA 5IAOA 5IHPA 5KHOC 1V95A 4Z7OB 4LS3A 5BVGB 1JV2B 3EFOB 4BO0A 4AIRA 2F3PA 2DKNA 3TL2A 5KS2A 1F20A 2ODPA 3HVUA 4JBHA 2LKCA 2ZBUA 3E7XA 3Q3JB 3CXRA 2GYUA 3LW8A 4R9PA 1XRLA 5DE3A 3T7DA 4Z5XA 4NF2A 1DFGA 4YREA 3VO8A 1E6MA 1GNTA 2IA5A 3O3CA 3RAJA 2P4QA 4YACA 3FNEA 4KYVA 2OZVA 4OHVA 1FX0B 3OPNA 2QR2A 5CVVA 5KEIA 1ILEA 4PCAA 5BN1A 2A5DA 1N7GA 4IVPA 3FHTA 3UAOA 1EP3B 1H05A 2KB3A 2H5JA 3FNGA 5EJ2A 4LY9A 4HN9A 4FUTA 4BVEA 4QDXA 1M8GA 2OPHA 1XVVA 1RAEA 2MSEB 2B4YA 1T8TA 1UP7A 1V41E 3I1YA 3IKJA 3N0WA 3ZCPA 1EH5A 2ATVA 5HQ3A 4JQSA 4B0OA 1I4WA 3EXFA 1G7SA 5KQLA 2V1UA 3PRYA 1BDBA 1G19A 1NQUA 1TYDE 2YYAA 3ANYB 1BE1A 2DFLA 4TT8A 4N5IX 3L82B 3V6LA 2AXPA 3MT0A 1N1EA 1A0OA 1Y1SA 1HTWA 4IIJA 4BNJA 2G3YA 4F11A 3IAS6 5EKUA 3Q8LA 5DYNA 3BGIA 2VDLB 2EGHA 4JLUA 3SZ3A 5JZMA 4FXOA 3HKDB 5REQA 1QFZA 1OFGA 3KPJA 5L7YA 1L4MA 3A1TA 1NR7A 5EESA 3VPYA 1Z8NA 1DDOA 4EHJA 5BV7A 3AIMA 3ROFA 2GK7A 4N18A 4X24A 1IN7A 4R9UC 3EZLA 4B82A 3BGOS 3GJ5A 2WSSA 3PFNA 1XCMA 4U6QA 3SSMA 3UYLA 2RHTA 3RC2A 1ZC4A 4QWMA 1Z3CA 4M8SA 2GKSA 3U6KA 1ATIA 1OH8A 3EMDA 1C1DB 2FR8C 3RR2A 1AZWA 1H2HA 1WHTB 4ZV9A 2OB2A 1ABFA 1NMZA 2A0YA 3ENWA 3JW8A 3LX4A 4ZVKA 3LZCA 2HK8A 4TN1A 4U3JB 1QP8A 2CN1A 2WP0A 4F4JA 2DULA 4S35A 5FOTA 3RS9A 3WKEA 5EQFA 4E5NA 3EQ2A 4M1TA 2AE1A 3AKZA 1HBJA 1M73E 2YYSA 5AVZA 2ZRDA 1OXTA 1WHSB 3UOWA 4IIBA 2XUFA 2CV0A 3OPYA 3J7AC 1KIMA 4HTFB 4W7IA 3LFUA 3PNPA 1S0UA 3W0LB 1IH8A 3HJGA 2KJQA 2ID7A 4P5PA 2OUKA 3H6KA 5ANRB 4G4SO 5LYYA 2V5VA 2PT9A 4XJSA 1AQIA 3GCGA 3Q3VA 4KQ2A 1P72A 4L1KA 4LYAA 3ULKA 2OKCA 3L1HA 4WZ6A 4C89A 5B57C 1AXGA 4CM8A 3E58A 2RIRA 2IU0A 4Z4FA 2BFPA 1C3VA 2H92A 3RUEA 4D81A 1L4GA 5JY6A 3E8SA 4HGPA 2N1MA 2Q3JA 2RBEA 3BTVA 4HTAA 4P3OA 1XXHA 4BE7B 1D6MA 5EKTA 4MH0R 3NDIA 3PUZA 5HMMA 5HJ5A 3IJPA 3U9SA 1PE0A 5DLPA 2AG8A 4RKWA 5B3JA 3TMYA 1YB4A 4PW0A 4Q4JB 1FSFA 2KYRA 3NNSA 2GILA 1NLUA 3TQQA 3WMGA 3IQDB 4FZVA 5JAHA 2Q0HA 2JFZA 2Q6IA 3H2KA 1Q1AA 1Y81A 2XMCA 3DONA 3F49S 3OF5A 4OK3A 1IZ0A 4OJYA 1I7NA 2H1FA 5IT9A 2IBTA 1YJMA 3TW4A 4TKVB 4AG6A 1KJWA 2ZRQA 3I0MA 4DR6B 3A2LA 2HXGA 1SJ9A 3B9RA 4RCZA 4UDYX 4GLBA 5DULA 3OF2A 1XEAA 2XQGA 3A7EA 4JLDA 4H1WA 1T3HA 3QBDA 4MYHA 3D6TB 1V1RA 2Y0BA 5AXBA 4E4RA 1ODFA 3FDIA 1KAMA 4KQ1A 4RJLA 4U6NA 3V33A 4BVJA 2O2IA 2ATEA 1P1IA 2H9IA 4WKPA 4DA8A 2XT0A 2VF5X 4DLXA 4BNLA 2NV2B 2WJ4A 2OGTA 3DBVO 1T3SA 1JHUA 3QUBA 4CZ2A 2IZOA 2XHEA 2Q9UA 4GPEA 4D98A 1NQWA 2FFHA 4OREX 5ALSA 2VEOA 1ADFA 2NZ2A 2VJPA 3IA7A 2KM1A 5D7BA 5K8VA 4O02B 2FN8A 1B8VA 2Y1GA 4F7WA 1K5HA 2RK6A 4LJRA 5DNYB 3A6JA 2QA5A 3CBQA 4WBNF 3RTBA 5EE5B 3U3DA 3WMEA 1LW6E 3M0EA 4FZ5A 5EXTA 2BMWA 2YV1A 5KNCD 2IDKA 2GLXA 3JWGA 1NZFA 3ZKWA 3P2OA 4B3HA 1JB1A 5IHXA 4C2BA 1JEEA 2C3UA 2SKDA 4FSXA 2P9QA 4EVQA 3OLQA 1WE2A 3KUDA 4RGBA 2RJOA 4X3OA 5AHWA 1U8XX 2EJBA 3DJYA 3QEMB 3TM4A 2BBWA 2JRCA 3EULA 1N0UA 3RFXA 3RTGA 3U7QA 4B48A 3WMWA 3JAMA 4L5IA 4JJZA 3AKYA 1EGVB 1WUKS 1K2VN 1H0RA 2XUHA 5JELA 1X7GA 5DYYA 3LW7A 4A8JC 4E46A 2JD2A 4QTYA 3O03A 1E2HA 2FWRA 4ILKA 3QVGA 3TLGB 4GKKB 1RM3A 4B4UA 1OHHA 2XB2A 2GZ3A 1B8PA 1M8PA 1TJ5A 2EZ4A 2L82A 2C5EA 1U8AA 1J2TA 4HF7A 4W8GA 1AF4A 3H4VA 4OGKA 4KIFA 2VK1A 1WO8A 1TRKA 3RWBA 3IEUA 4PYOA 3AJDA 4BCDA 4H3KB 2WLSA 3D2BA 4H4CA 2Q5FA 1KVTA 1TX4B 2IY8A 3DQZA 1SQSA 3EXG2 3VR2D 4BN5A 3VOSA 4NI5A 4WOKA 5FUQA 1XHFA 1Z0KA 2IYPA 5K0EA 4BB5A 1VM6A 4NWIA 2AJBA 1WPGA 3KBBA 1MOSA 3H6HA 2ERXA 4LX8A 1ZMXA 2J6HA 2XMDA 3MTGA 3MT9A 1YFZA 4PAWA 5I7VA 1VJ0A 3D6UA 2PUJA 2PXHA 3MJFA 1GRCA 1F1JA 4NICA 5EY5B 2JASA 1UZMA 3BQNB 3ZTWA 4UCWA 2JGAA 3CEMA 5K0CA 2FW6A 2GCOA 9GPBA 3DO8A 4JLJA 4D9FA 2DH6A 3AJAA 2XCOA 2GQ0A 3CR7A 4GXRA 1UAYA 1XVUA 3H16A 1FYXA 4WBNA 3ZWXA 4RV5A 4XB2A 1YE8A 1FDOA 1G5HA 3VJLA 3MTIA 4UUBA 1FUKA 5FWYB 5IT5A 4JFAA 4B2LA 3HP7A 1USUA 3Q6NA 3VR3A 3I8OA 5JAOA 1SVMA 1IRIA 4M7RA 3OLXA 4RFLA 2Z6VA 4DDUA 2X2FA 2FRDC 3BWVA 3C5CA 3KKLA 4O2BF 3GVHA 1KJZA 1VLLA 3O93A 5PGMA 3R76A 3VR4A 1UBHS 4YP0A 1QG6A 1GRRA 2VSFA 2X5XA 2JGDB 3NHKA 1U98A 3AUXA 3NOOA 3O4FA 4IEEA 4XLZA 1SC3A 5SY9A 2GYWA 4F6RA 4HAWA 3TPFA 4BRSA 1E3MA 1YDFA 4MV1A 1IONA 1C8LA 2F64A 2PUEA 4BNVA 1R5JA 1E3DA 4F4IA 3KWMA 2JVIA 2I7CA 4P4UA 2BHTA 1PBNA 3EVTA 3TF5A 1DXYA 4Z8YA 4DXHA 3OFSA 5KDDA 5ENDA 1YA6A 2HBYA 1BMTA 2JI8A 3ZU3A 3DLBA 1ZSYA 1Y9AA 4DG5A 3F6BX 1PL7A 3NAZA 1T5BA 1XZGA 5T4EA 4ER7A 1JDSA 1JXOA 3I92A 4YI3A 4C0HA 3GNLA 1E2UA 3CVVA 1QHHA 1V35A 3DLCA 3RYCA 1VSUA 1U7XA 2ZSIA 2QM0A 2XOEA 1K3TA 2HJWA 3OTGA 2R1VA 1KMCA 3PE3A 5C3MA 3KX2A 5KDLA 4A6XA 3NGXA 1YB6A 5GPBA 2OCAA 4F4UA 1Y8QA 4MNTA 4PXAA 4RX1A 5B4TA 5JMOA 3WWPA 3MCVA 4K05A 3O4IA 4LEIA 1KI6B 3TD9A 1YR3A 3EH1A 1LWNA 2BFDB 1C7QA 1KMHB 3L06A 4YJKA 4EFMA 2H2GA 1HFKA 2Z09A 5TIIA 2PMWB 3I23A 2XH8A 4ABYA 3RQIA 5A3JA 2YXNA 5IKXA 4BVHA 2CLMB 5I9BA 4AKTA 4C4XA 1M2OB 1LZLA 1X87A 3B1YA 4RDXA 5KQPA 2VZEA 2H9AA 4PPQA 1BSVA 4XGNA 5L3QB 1LKZA 3EG9B 1GKUB 3PIDA 4C03A 3AP1A 2RH8A 3E70C 1CIPA 3JPYA 1TPZA 3UUEA 4QJ3A 2H48A 3TQHA 2DHEA 3KV3O 1NM5A 3MMZA 2X7XA 4MW5A 3HMQA 1B0AA 2HHCA 2WD7A 1GHTA 1OCEA 4H4EA 2AOTB 5AOCA 4ZI7B 4O2BA 3C3CA 3STVA 1G2IA 1QYXA 1RYFA 3L0IB 2QTAA 2ZRAA 3AERB 4OAQA 3FI9A 4BVAA 2NV0A 2QTVB 1XZDA 1JILA 2P9ZA 3HVHA 3L7AA 3Q2KA 4WFQA 2NSHA 3SBDA 2X8JA 2X7JA 1N5OX 1NTOA 1WDKA 3TJZA 1ONPA 3K96A 3WVNA 2O0JA 3B1ZA 4L6CA 1Z88A 3LCVB 3THRA 3UT5B 1OB5A 4HDSB 1XJCA 2DGDA 2HDWA 2PKEA 3GZJA 2ZR9A 3ND5A 2GSWA 5LLSA 1EB9A 2YRWA 3TIFA 5H68A 4M9XA 1AGNA 3ZBUA 2NZWA 1SVNA 4JJ6A 4EJ2A 2O3QA 3UK1A 6YASA 3UFXA 2F3QA 5DASA 5EE3A 3GP5A 2W2NA 3EXHB 2C1XA 5FBHA 1N6NA 3GHHA 1SIWA 3R7LA 5M34A 3PXGA 2ZETA 4C0JA 1L7NA 1N7JA 1XPRA 2JLWA 1G8JA 4NTZA 3TDMA 3U4MA 4AY2A 1HETA 3MINA 3ILVA 4Z8XA 1W4LA 4RD2A 3KZOA 4GRDA 3CNHA 3RYHB 3DKPA 3KCQA 3T9DA 3KKNA 3CEAA 1ACJA 1RQ2A 1NG1A 1Y33E 4G5HA 4MZDA 4ENWA 2OORC 3JQFA 4ZQIA 1U2DC 4TV9F 3NXSA 2VQSA 3ND7A 3O94A 2IOFK 1CDOA 2IYSA 5LDHA 4CXMA 2B30A 2VTDA 3G2NA 5L4NA 2B1QA 1EA7A 1TF5A 3V55A 5L7WA 1ZUNA 2CDBA 2IYYA 3IIKA 3CZMA 1NIJA 2R6GA 4MRMA 4O1MA 1D2CA 1R4MA 3ETGA 3IUSA 3VYTB 3OCCA 2J3QA 3ZWCA 3NIWA 3QLVA 2FMHA 2P65A 5EQDA 2PSDA 1NDQA 3GAFA 3DHWC 4BNHA 3OHPA 4E14A 1XFAA 4MZXA 2AFIA 1RYBA 3O21A 3GLGE 3KD2A 2PGOA 5CXSA 3IVCA 1IXZA 4S12A 1ECGA 1X94A 4BTLA 3GLGB 4AXXA 3TYXA 3BIOA 5FWXB 4GS5A 1U6JA 13PKA 3M3HA 5EHNA 3C41J 1B93A 1SXPA 1ISIA 1QIHA 2PX6A 1QM5A 3E2PA 1Q6YA 1V48A 4D8WA 2XKJE 4NZOA 2D59A 1WMAA 1BVHA 3C85A 2CYBA 3E4CA 4J3JA 4BNUA 1D9XA 2A9RA 2XT6A 3PCRB 3V34A 5IULC 4CGZA 2PJZA 5CBKA 4D9CA 5JSQA 4V3BA 4BDTA 4Q6WA 2Y1EA 2C1ZA 3UK2A 3X1MA 4PLWA 4LGVA 2BVNA 4MWCA 3K1YA 5JXHA 1JR3D 1OBCA 4YCNA 1HL7A 2DJ5A 1Y0BA 2IHNA 1LD3A 1XN1A 2I6QA 2F8SA 1Q0RA 5KYYB 1FXWF 3NYQA 5EC8A 5JD5A 4PXYA 3GFRA 3CZRA 4RK0A 2J45A 3PA8A 4TWBA 1KRWA 4RJIA 3MWGA 2OV6A 1NP6A 3OEHD 1NBMD 1ZD3A 3UJ6A 2YIMA 1R3UA 5CNMA 2HUPA 2R6CA 1GLVA 4H0NA 4N03A 2MSCB 1NVTA 3P2IA 5ICEA 2W2QA 2O19A 2B1IA 4XEHA 2PMBA 3GCZA 4TV9A 4YDRA 3ZY4A 5I47A 3EARA 2NO6A 2BKVA 3H5AA 4H7EA 3FBTA 1ZK3A 2BN4A 3I12A 4BGIA 4HQ0A 1DMZA 3GEBA 5TQ0B 2QJWA 4D0GA 1KEPA 4OHUA 5KNCA 2A1IA 4EJ0A 3DP9A 3IUJA 5DGTA 1WOMA 1V6AA 5DHRA 3BCRA 1F0YA 1UDAA 3T3IA 4BMCA 3FAKA 5WRFA 4B7AA 1JECA 1AUXA 2OV4A 1CULC 3EZNA 2XVYA 4D99A 2D1SA 3JD4A 4O4JF 4GE0A 1LPSA 2V0NA 3D5EA 4GLOA 1TNDA 1MO6A 1T4CA 5CIQA 3SF8A 1QZZA 2JS7A 2FV8A 3FSGD 3IDQA 4R4JA 4II2A 3IIJA 4S2EA 1GFZA 1NXWA 4A16A 1E7RA 1C9EA 1LFAA 1NW6A 4JX9A 1QYIA 5LPNA 5DHTA 2DHRA 5IBCA 3DMYA 2WV7A 3G5UA 1UDRA 1X1AA 3V4FA 2ZB8A 3IYLW 4EJSB 3FZNA 1Q6ZA 4UTRA 1E9CA 1K06A 1L7EA 4YB8A 1PT7A 5FADA 1V4BA 2PANA 3Q6MA 2R68A 4PR3A 1WZCA 5ALHA 1JJVA 4CIVA 4GX2A 2JFFA 3WDMA 4PG5A 4CKCA 2ZUSA 4X6YA 3S2ZA 5LP1A 1W36B 3LGXA 5KQSA 1GNVA 2IDMA 2XBMA 4DZRA 2JFPA 4ERXA 1G21E 1RU3A 3F7MA 4QG3A 4PLCA 4G8BA 3W6UA 1HNWB 2C96A 1LI7A 1LPNA 4Y2QA 1NC3A 3LP8A 3RWMB 5EUMA 3H83A 4LG1A 4D43A 1AKYA 1OX4A 3AF5A 2FPLA 4AZWA 2N75A 5EIBC 5ER6A 2CDNA 4MO2A 1H93A 4AD8A 1FXWA 3ZQUA 4L0CA 4GZ3A 3ER8A 2P5TB 1US8A 2I2DA 3LPCA 3V80A 1AQUA 1Q74A 4AL4A 3AY7A 5TQ2A 4D44A 2QQEA 1W88B 2WU4A 1RAFA 1XUOA 1Y4DE 3TWOA 4BKRA 2COUA 4DVGA 2F1IA 2C2OA 2M6KA 2GPYA 1Q7CA 4F7DA 1DT5A 1EU1A 2IEBA 4UHHA 2VP5A 4W99A 5LQAA 4Q0MA 2LCIA 4FR5A 3IPAA 2WUGA 1C29B 3MF4A 2I71A 1KA9H 2JJ1D 2Z0MA 3GT0A 4DREA 3IP8A 1PFWA 3TVYA 4DPMA 5B2EA 1JS1X 3LT2A 4WESB 4UNPA 3O4HA 5HF6A 3OQMA 2PS1A 2ZBVA 1BQEA 2HCBA 1D2NA 1HOXA 1I30A 1Y3FE 2Q7XA 3DW3X 3GLKA 1Q17A 3PL1A 4YLEA 2X4IA 3V9AA 5GJWC 4R71A 3NJRA 2ZB2A 1OGJA 3H2SA 4JOQA 4IIFA 5HJEA 1OLXB 1MDFA 3CNEA 2B1RA 1C50A 2X3FA 3HFRA 3RTCA 2ZIWB 3TZBA 1W48A 3K2EA 5FPSA 3SIXA 4G2SA 2A0XA 2O8DB 3CLTC 3M34A 3SSNA 3G0DA 4G84A 2R1TB 4GSKA 1C9KA 1FP6A 3JQBA 2H2FA 4ER6A 4UNSA 3G7NA 5AKKA 3TFQA 3U9LA 4AY3A 2ZJ7A 5BOSA 3ACBA 2A6PA 3MEQA 4NBKA 4W82A 521PA 2WY2D 1J1UA 1V2HE 2RE8A 3STYA 1G4HA 2Q5HA 3PYLA 1I6MA 1OWOA 2HRQA 2WTAA 3JQQA 2FP4B 4G8DA 5H1YA 3ZY2A 3DAYA 2AJ8A 4GW3A 3IPLA 4MQLA 1JQDA 5C7OO 5D1HA 1H6BA 3THYB 1QQ6A 1VKJA 5D86A 4V0LA 1HDXA 2PFKA 3MRXA 4OHZA 3W8EA 3AYZB 1G0NA 2GARA 4BU1A 4ZZ3A 6ABPA 2C78A 3TLJA 5BSUA 4QGSA 2WWGA 5DT2A 1N2CB 3T1HB 2Q3EA 2YNMD 4D9IA 3NP7A 1RT9A 1ONOA 2WA1A 3IQZA 4IEIA 3EQ7A 4FFLA 3NEYA 3VX4A 3TBFA 4AJOA 4L4XA 3THXB 1N8NA 1DC4A 1BG6A 3DCYA 1CUBA 4EF5A 2P2DA 3OIUA 4M89A 4W63A 2FEOA 3AEYA 1G18A 4EZBA 3KYDB 1HTTA 4KRFA 2DC1A 5IKEA 1DL5A 1RJ9B 3KJIA 3PHJA 3LWDA 3QLUC 3VPDA 4DW8A 4DR1B 1OB2A 2VHJA 1XTJA 2L19A 4BE9A 3E9DA 3ONWA 3DC7A 1UBCA 3ED5A 4M8LA 4C3VA 4V0SA 1DWPA 1U9JA 1E69A 2ZGVA 3HLYA 4ZALA 1PJ2A 2AZTA 2GN9A 1UJXA 4CM4A 3ZHYA 3IUYA 2P67A 1YDWA 1DDGA 4L07A 2XUOA 4DBVO 4DOMA 5LNK6 3BBLA 5JPIA 1GAWA 3Q87B 2FR0A 1XZKA 4FT4A 4IWXA 4Q9KA 3L6BA 1TXGA 2A14A 3TGLA 1O6BA 1QR6A 4MV7A 2A86A 3BWEA 3GIDA 4IDHA 2VZLA 2F55A 2C57A 3FVTA 3L7LA 4FFDA 3GRAA 4HXEB 5KBYA 1ORHA 2FSPA 2VG8A 3BRSA 2BMEA 3GL9A 5DWQA 5K3AA 1GUDA 3FY4A 1XLTA 3CKLA 4YUWA 4ZAVA 4RZ3A 3DZKA 3MW8A 4AXBA 1XQWA 1A72A 3EFEA 2GN8A 5AQEA 3JALB 1VE3A 3VH1A 1NBWB 2IEGA 4HZUA 1S8FA 2WIFA 3CV3A 3STUA 1E2BA 5DX0A 3GQBB 4QQNA 2J09A 3BMQB 4JN6B 4JP1A 5FV4A 1NDUA 2P4HX 5I3CA 3OM8A 4IH9A 2J08A 2V7QD 4EGAA 1Y9ZA 5IJ0A 4B6RA 4WLNA 3S2FA 1NP3A 2REXB 1PQPA 5TX7A 1U94A 3PPWA 2VOEA 5FOQA 2Q8PA 2JHCA 4C0QC 3FZEA 1KRHA 2ASEA 3JASA 5FF9A 2O23A 3ZCXA 4AYXA 1P75A 3ZYCA 2AW5A 4RIHA 2PZLA 4IICA 1C80A 2O4UX 1FEZA 2DFTA 3QTBA 3M8KA 4GE3A 1JAYA 4UXIA 2XWQA 2NO4A 1BMFD 3ZK9A 3SAJA 1P81A 2FRVA 1U2GC 3OO0A 1U9IC 2ZANA 4OH7A 1K3FA 2ZJ4A 5GM2A 5HIKA 4NXNB 4OOFA 1TCBA 2W83A 2O0MA 4ZEWA 1Y80A 3O7WA 2O6LA 3V7UA 3BWDD 2ZTLA 2XMSA 2R1ZA 1QG0A 3L4BC 4GYWA 3P4XA 2C3YA 4MVJE 3H5WA 6CHYA 1PFYA 3HCAA 1Z22A 1W93A 2NU7B 2BZSA 4EL5A 2GTHA 2NAPA 5IU6A 4MVYA 4A82A 2M6SA 1DEAA 2R84A 3HFJA 4D3DA 3DAGA 5CLJA 3ZWBA 3NFYA 1MZVA 4PWZA 2XIQA 4X90A 4DWOA 2J9XB 2YMPA 2QTMA 3PPXA 1S3GA 1EFHA 3RTEA 3EPJA 4RSHA 4KBFA 3BIFA 2JLZA 3W8DA 3K1ZA 3DNMA 1JHVA 2X9NA 4CI9A 5E0OA 2IDZA 5JAPA 1M6EX 1T1EA 4J1QA 4LHEA 5TY0A 2MDTA 1XZAA 3H8VA 3P9SA 1ZM4A 4KFTA 4PEVA 3TNFA 1TLLA 1VMKA 5J4KA 3TKYA 5K9ZA 4GUAA 3F8SA 4TMYA 3JQ6A 5AKIA 1QP0A 3PQCA 5I51A 3AVPA 3OZSA 1NJFA 4LTMA 1SA0B 3ISVA 4NBLA 1KYZA 5FOVA 1L7AA 4OAPA 1XMVA 3BTOA 3DBRB 1HXHA 1YZNA 3PNLA 4RAOA 1NBMA 4KO2S 4J43A 5CA0F 5DMXA 2EIXA 4MWSA 4JGIA 1QLWA 4IIJB 5JADA 4DT1A 3D6JA 1J0AA 1UFVA 2X8WA 2F6RA 3DCIA 3JATA 3PU6A 4M8NE 1M75A 2AR7A 2BFEB 4O25A 3NWOA 3D59A 1W0JD 1K4YA 3ENVA 2IX9A 3WLQA 3CYFA 3LLUA 3PR2B 4KQGA 4B2YA 4TWRA 2FDXA 2ZIFA 2ZSBA 3EVFA 3JQGB 3O73A 4DB4A 1QV9A 1RYYA 4RH3A 5SICE 5JEEA 1MMFB 5AI4A 2WAXA 3RAFC 1KVQA 2YYYA 1EHIA 4E08A 4DR3B 4Q4CA 3BYZA 1NOJA 1YASA 4G8JA 1SXJD 3ZVNA 1NBEA 3TW8B 4HRXA 1QAOA 2A94A 3AFGA 5FPQA 3KQHA 2M32A 2V96A 3KAQA 4JCOA 4JXZA 1UL1X 3RRXA 3DW1X 2JI6A 4EO9A 3I45A 3P96A 4ENSA 4FMBB 1JVNA 2RI6A 2DLNA 2ZSDA 3HCPA 3M5DA 3SIRA 2NU6B 3PUKA 4HXYA 1OY1A 3DYVA 2QPAA 3ESQA 4MAMA 5KNBH 1RM4A 4JOCA 3KQWA 5F52A 5DI3A 4LJ8A 4C4SA 1JALA 2ZM6B 1PLJA 3I0ZA 1R9MA 2WTEA 3C6BA 3E0XA 4UM8B 4ZYUA 3DO5A 4F1JA 1Z83A 3HUFA 2PQ0A 4LC9A 2FEMA 2VP4A 2CJXA 2YRXA 1E9VA 4IDEA 4INPA 1WXIA 3UB4A 1MN6A 4AWXA 4TSFD 1XNJA 3I4FA 4ZO8A 2BI4A 1M8KA 4IJ5A 1RZ3A 5JVDF 3B89A 3G89A 3BULA 3AO0B 4TL8A 3RTDA 3IR7A 3QFHA 1DQPA 1L7BA 3O1LA 4UKDA 4EKDA 4F5EA 1CZLA 3EGXB 1N33B 1L7DA 4M36A 4JSYA 1G3UA 3AHFA 3TTXA 3AL3A 1ZD9A 2V4UA 1NBAA 5KYWB 5IAGA 3VAYA 2IZ6A 3CE9A 4KKXB 4OYRA 3RVQA 3LQRA 4IQ0A 1NVWQ 2OT3B 4DMUB 3VNBA 4P36A 1OU0A 1EXDA 3WYNA 4N5MA 5CA0A 4DVJA 4UTNA 4EL0A 3NHLA 4CL3A 4F5WA 3DZHA 4F2PA 5KTSA 1Z7EA 4YRQA 1E79D 4EZIA 2J3IA 2AX3A 3TEFA 2O8CA 1FHRA 1V1MA 1WXWA 2JJ1A 2P9CA 4K9LA 3UAXA 5AOAA 2XGMA 5HFNA 1QJ4A 2X58A 5KYXB 1QLHA 1Q7EA 1RC1A 1ZH8A 3V7WA 2HF7A 5LUAA 1N5JA 3B51X 3A58B 3CE6A 3I0NA 2C8LA 4FFRA 3JVEA 5CDGA 1YS9A 4RYLA 1NVUQ 1JWLA 3DAFA 2G77B 4LXGA 3RRBA 4BFXA 3ZBQA 1LNZA 3FPKA 5C8YB 1KORA 1G8MA 3K6SA 1PX2A 2PZFA 2O8EA 3EA4A 4ZTBA 1J8MF 1L5ZA 2ZDHA 3QK7A 4Z0NA 1TECE 1J0EA 1CTQA 3OAAD 4YMWA 5J9FA 4F4FA 1O7JA 4Q4HB 1IBLB 1OT5A 2OZLB 3GUHA 4PLZA 5TGDA 5CIWA 1U11A 4KRYA 1J1ZA 4JBIA 5JC8A 3EAGA 5C18A 1J49A 1SOMA 3ZDRA 2CVPA 5L3SA 4P6VF 4GMFA 1Z17A 5LQRA 2JZCA 1J4OA 4IIHA 3WL7A 4I6EA 3TR0A 1GYRA 4E6PA 4PPGA 3JQ9A 4BLVA 1NMYA 1R9JA 1MC1A 4TSRA 5BMVB 1QIKA 1J33A 1NUTA 4OJQA 1B1CA 2IXEA 1GXSB 1SBQA 3F6RA 1VXOA 4QO7A 3ZWDA 1NURA 1WD7A 1EUCB 1TTHA 3NDRA 4CTJA 3RW9A 5JVDA 4CUZA 1Z12A 2FEAA 3WBBA 2YNMA 1OQAA 2FQYA 2IHYA 3DL4A 3Q0IA 2E4WA 3MWFA 1N75A 2J6CA 3DZFA 4QE3A 1SZDA 3N1UA 4LE0A 2DT5A 5FT9A 3R2JA 2GN0A 5JLAA 2GHTA 2WV9A 1QMPA 1DBVO 1VPLA 2ZI7A 1O87A 2POQX 4KWCA 1ZRHA 1BVRA 4JU8A 2OZEA 3JZIA 1VRVA 3DDSA 4QPPA 1PTJA 4GLJA 2DCUA 1UPAA 2P9JA 3CC8A 2WT8A 3T7JA 1CDDA 4IO0A 4MIOA 4TRJA 4YP5A 4DMKA 2ORVA 5KNBD 4B3TB 1QYVA 4DIOA 1K8YB 4Y2JA 1NVEA 1REQA 2FEPA 2WKSA 3OQ1A 5F76A 4AUNA 4C20A 1E3WA 2IUSA 1UBJS 2WWYA 1RXCA 4F93B 4BNMA 2EJVA 1D4ZA 3E3MA 4QLBA 3QPUA 4FJ1A 4KSBA 4O3MA 2WHEA 1TCUA 1M34B 1P1HA 2H2AA 2QE7D 1XZFA 3PE4A 3QQ5A 1AKUA 4NBUA 2JLAA 2PX4A 3WSWA 1LSSA 2AFHB 3ZLVA 4GBMA 1NXTA 2Q3BA 5BXYA 1NA5A 1OMOA 1PL0A 2QUBA 4LZWA 4QYXA 2QP9X 2C00A 3FUTA 1MJNA 1XZIA 1AKWA 2B98A 2FVXA 2YJ4A 3KR0A 4BX8A 4YIHA 3SOZA 1EDDA 2BV3A 2Q1TA 5AI5A 5ENZA 1XF1A 4DNXA 4XRRA 1G8PA 4O29A 3O0DA 5K0SA 4Q1FA 4BX2A 4Z49A 2C7RA 1K98A 2BE9A 1DRWA 1Q11A 3HBLA 4EDHA 4IDQA 3JQ8B 5G4KA 3GLIB 1JHRA 1Z08A 4QNNA 2CB9A 4XCQA 3FPEA 3C3KA 1O54A 1WZUA 4XUGB 5D6OA 2W2KA 3W2EA 1GRQA 4QT4A 5KCZA 4KE8A 5TMBA 2FPKA 1J7JA 1K8QA 4I14A 2B3DA 4DTCA 3U9TA 3KXPA 4P54A 2FSSA 2A1TS 1TKRA 2E4VA 2V7QA 4GR9A 1WXGA 3LUFA 1PVDA 3CPSA 2QZSA 3SF0A 4D4JA 4F12A 1FP4B 4NVRA 4LHVA 2RAFA 4U7JA 1TTTA 5IXSA 5BPHA 1P44A 3IMCA 3UBTA 1C30A 2SCUB 1T25A 2HHLA 2YV2A 3DHVA 5AT1A 4ZOLB 3F67A 2C9MA 1P9RA 1TKAA 4Q15A 4RIFA 4EY3A 5FWAA 5ICCA 1YE5A 3VDNB 1VHLA 2PUTA 4RD4A 2XDQB 1FDTA 3PT5A 3RS8A 3SC4A 2D7CA 3CUEF 3GZTB 5KQMA 2OQRA 5TJHA 4YO7A 3NU1A 1MAHA 1QORA 2PGLA 2VDVE 4KVFA 3OVMA 3H9EO 3KOUA 2MMGA 2XDWA 5TVKA 1WW3A 1Z8FA 2DHDA 3QLEA 4FFBA 4J0IA 3PQFA 5KWSA 3VGJA 3KB1A 2QL7A 3ICVA 3JYLA 1K9SA 4IVNA 1E7MA 3OT4A 5K0JA 2VQEB 4CLEA 1DWOA 3LVRE 1L5KA 3I6YA 2DBYA 4PHHA 4NEQA 1H3NA 4GLLA 3AVXA 4RFSA 1J8YF 3G8DA 3FOZA 1ZVJA 3D8NA 2WHXA 1Z7BA 3JQ7B 4LHZA 1HYBA 4J1TC 3QUCA 1M67A 2Y6VA 1G63A 1TIKA 4Z99A 4NFSA 5ER9A 2DY0A 3RJMA 3U4QA 1EJ0A 1PEKE 3IH5A 2EOAA 3PE6A 4WLFA 4DLKA 2FUKA 3PG5A 3TUZC 3NTOA 1KYTA 2PK3A 5CJPA 3SZGA 1YH3A 1JSRA 1U3VA 3HU2A 1QCCA 1OUMA 1P5JA 2XZOA 3G68A 2WTUA 4EKGA 2HWYA 2NPIA 4NCNA 1H6AA 1MO2A 1I80A 1JXQA 4X1YA 2GXAA 5M3BA 2ASVA 3GDFA 1LY1A 1QQTA 2Y2VA 3ZV5A 5HS6A 3MCAA 5CYFA 4DAEA 2W2OA 3FTNA 4MVJH 3U61B 1GUBA 1NVVR 1X7ZA 2I55A 1D4AA 3DVAA 1ZMTA 3FIJA 3IBFA 4OKNA 2NXJA 2ZUVA 4Y2VA 5JHHB 4OFBA 1KFBB 4JUBA 4L76A 3OF3A 1K7YA 1Q20A 2XRMA 1O95D 1F7UA 4X1IA 2HEGA 2ZATA 2P2LA 4J49A 1L5NA 2BF4A 1OSNA 2H54A 4EMSA 5JXJA 3RIGA 2AFVA 1N3IA 2V7VA 5CHEA 3I62A 4MPTA 1WSBA 5JD6A 1JU9A 1FDUA 3IP9A 1OAOA 1ZH0A 2RHWA 2PZBA 3H86A 3V8QA 2KKLA 2FR1A 3MJSA 5JE8A 2QTBA 3FCXA 4WXHA 5BYKA 1MJFA 2ZXFA 4KUGA 2ZKLA 3TQOA 3GLHB 2ZUTA 3F6PA 4UBOA 4CQMD 1PYGA 5HKAA 2OILA 1VJTA 4DC0A 4DTIA 1O3YA 2Q5QA 4LE2A 5B3LA 4FI3C 3D7KA 1QB8A 3QA9A 4XOUA 5JO0A 3QXXA 1ZO8A 2ISCA 3FI0A 3N39C 4J4BA 3QI2A 4RKFA 3UCXA 4OBWA 3M4JA 3N28A 4QC2A 4P3XA 4PC6A 3MQ2A 3CVXA 1IBKB 4UPEA 4PSAA 2G70A 1FHQA 1HH4A 2B7BA 4NFYA 3HBMA 4QTXA 1XMOB 1BN7A 1D2MA 1J9ZA 1NXXA 4KXNA 3AUJB 1W5FA 3UGTA 1BXGB 4EKNB 2I34A 2Q4DA 1XAJA 4IM7A 4JLNA 4PS0A 3OQJA 3OIGA 3GMJA 2JZOA 3GYBA 3HUDA 3ORRA 4D4LA 2BCJQ 4DSAA 4H27A 4IMPA 1JBEA 1DIHA 4BS9A 4IDOA 2IIPA 2Y0DA 2EZUA 1E32A 5FYQA 2ANCA 2IODA 1P7VA 3LXXA 3PC8C 3VVCA 3PGXA 4BMSA 5CEFA 2H1OA 2BI8A 3SKXA 4F9FA 5CD9A 3RSSA 1RCTE 4TSFA 5U4XA 3DL7A 3KT6A 2MYPA 2WMYA 4PV7A 5IEBA 1ZNZA 1C8VB 2PGJA 5DLYA 5IC4A 2REOA 4JQCA 2YQ4A 2JKDA 4UULA 1YOVB 4RZIA 3NTUA 1RTTA 2IHTA 5E6RB 5HE8A 1ZK4A 2BC9A 2R85A 3DMGA 4GDMA 4HGOA 1NVMB 1S8AA 4I55B 2M9MA 1C1XB 3OE7D 2X1VA 1E1QA 1YGSA 3CGWA 1K7FB 5SYAA 2NXCA 2TRSB 4EPXA 4RK6A 1IXRC 2D1TA 4TTJA 4TYPA 5K7SA 5IWAB 1DRVA 2ODQA 4Y9TA 4DNFA 4CQJA 2JJYA 4EI7A 4BNZA 4PFSA 1RLJA 3B38A 3SIWA 1YZTA 4RAQA 2PBZA 2X8AA 4OXRA 3TNDA 3R9WA 2FPWA 4E7OA 1MO4A 1UKYA 5DNVA 1BX1A 3RUFA 5LWQA 1G8HA 2DB3A 1X7WB 4J76A 2QT0A 5LZ4A 3U5ZB 4W5OA 3E7PA 2NX2A 5EZ5A 4M98A 4M99A 1GA6A 2IHZA 3AHJA 4AFNA 1IIBA 4M1OA 5HUQA 1U7FA 4OUDA 3W5UA 2WVGA 3GEPA 5ALNA 1R0WA 1S2DA 2J0UA 2R87A 2DG2A 3A6ZA 4WZBA 4MV6A 4MVJP 4PX2A 2RGAA 4BNIA 2QN1A 3HUEA 5BXQC 1ZC3A 5F7JA 1YIDA 4LRTB 2CXQA 4KQIA 1W2WB 1IWOA 4NG5A 3X1YA 3Q1KA 4Z2AA 1N9GA 2GD1O 3K0BA 3W6PA 4RTOA 1PZMA 4ZYZA 1KKUA 3FMVA 4AJPA 1JKJA 1ZVKA 2H1CA 4R9RA 2VPZA 4ZA2A 3PXUA 1NFQA 4IJ6A 3NKVA 4B7UA 1N2CE 3T3HA 2RHLA 3QFFA 1GV1A 2DBZA 3NONA 1CR0A 1BDIA 3OKAA 4Q1EA 1C9YA 3ANNA 3HB0A 5KYTA 2VRCA 5SYNA 3NPAA 3AIOA 1YVDA 1YVRA 2JIPA 2ZULA 1W34A 3F5DA 4WCFA 5K05A 4KGZA 4W5RA 3VYWA 1JFFA 4O2RA 4S1OA 2P6UA 3RFVA 4OCZA 5EWJB 1E2DA 1H0SA 1XI2A 2CL7X 4PTLA 3WA7A 3T3NA 2ZS9A 2R4QA 3EXHC 2ZVQX 4WIAA 2PLNA 2QTZA 5K6AA 5IP5A 4X91A 3EA5A 4HNGA 3KYCA 3N75A 2FPSA 3U7JA 4JLMA 1P7PA 3KB2A 2OOKA 4P34A 3NBUA 3WICA 2PKQP 2HA0A 1F0KA 3U3RA 1GOTA 4P4TA 4N65A 2O06A 2YUIA 3K1AB 3UWMA 3RC3A 4V3CA 1BH2A 1IEWA 3CS3A 3CW9A 3G49A 3ITNA 4X6LA 1Z8DA 3I01A 2TMGA 3C45A 3U17A 4ZZIA 4EG5A 4KQ6A 4K86A 1CG6A 2G83A 5IM4F 2IYWA 5EGSA 5JJ5A 4ONEA 2Q8QA 1Z16A 4UDXX 1Y63A 4MUNA 1IJFA 2FSVC 5T8KA 2DMRA 4QTTB 4AI6A 1D1QA 3MAAC 2CBZA 1NOIA 5FNZA 3ZX4A 3V48A 1EXNA 1F6BA 1FNBA 4FBGA 1Z4JA 3ABQB 3SZLA 3N2NA 1I2ZA 2H1VA 2XYPA 3BCSA 4AVYA 3L7KA 1TUIA 4YMVA 1R15A 1CJKC 4EP1A 4CDNA 4RPKA 4EG0A 4EGQA 1LTQA 3GEHA 2AJCA 2BFFA 1FQJA 2YJGA 1C4WA 1LBHA 2C2BA 4ZKEA 4ER0A 2QLLA 1V47A 1Z2DA 1JEQA 2V97A 2V6IA 4M0EA 5D85A 2NUAB 1BQ4A 1EVIA 3DM9B 2GEVA 5AHKA 3U3ZA 4DRYA 1UWLA 4DDTA 2JCYA 2PGNA 4RTMA 2VOJA 4LY0A 5CLGA 1ZAKA 1FVFA 1AF7A 3R7SA 4FVTA 4EW1A 4HAYA 5KX5F 2I29A 1R0BA 3LOQA 4DMFA 1EJ6A 2CZCA 1KQFA 5CX1B 4QARA 1Z8HA 4BASA 1B1AA 2ROQA 4EARA 4R41A 1TZBA 2Q46A 2ZJ3A 3EC2A 1EX9A 3N2LA 4J29A 4ND6A 2J3HA 2PD6A 1LDBA 1SG9A 3THOA 3UK0A 3HE3A 5ALIA 1R8JA 2N1BA 3KIPA 5JDCC 1F6DA 3TIGA 2Q9BA 3TRKA 5LA6F 2C8KA 3EPLA 2QGNA 4N41A 2DERA 4O4JB 1KO7A 4D5EA 2O3SA 3G9XA 2ODAA 1BCSA 3DMTC 3FYHA 4L8FA 3W3ZB 1A2QA 2AZDA 4FYYA 5INTA 3CSUA 4OK6A 3G0GA 3M33A 4DIUA 4OF4A 3AP2A 1YQGA 4Q34A 2B61A 3LYLA 1GKIA 3PFCA 5T7BA 3PS9A 1BW9B 3LECA 1ZL0A 3LSTA 3O91A 2AOUA 4FDTA 2GO1A 3B52X 5FNVB 3KJXA 1PSZA 1IZYA 3SR0A 1LBEA 3L9WA 3NWEA 1H8HA 1A95A 2X3UA 3EZ7A 4L8WB 3T0IA 4DCVA 3UANA 3G1T