4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
3S40A 5DHPA 3VZBA 3V8RA 5DHUA 1Y3IA 3T5PA 2JGRA 1SUWA 2Q5FA 4L02A 2P1RA 3PFNA 1U0TA 5EJFA 3V80A 4V24A 1Z0ZA 5EJHA 4WERA 4HAOA 3V7YA 3V8NA 2I2BA 2QV7A 3V8MA 2QVLA 3AFOA 4WRRA 2I2CA 5DHTA 2I29A 1U0RA 2I2AA 3VZCA 2I1WA 3V8PA 1Z0SA 4DY6A 3VZDA 5DHRA 2I2FA 3V7WA 1YT5A 1Z0UA 5EJGA 2BONA 2I2DA 3V7UA 5DHQA 5EJIA 3V8QA 5DHSA 1Y3HA 2AN1A
chains in the Genus database with same CATH superfamily
1PE0A 1D7OA 4S24A 2GFIA 4G5XA 4QJIA 1VE6A 5ESWA 3BOSA 1L4GA 1LPSA 3UA4A 1S3FA 1LB1B 2OHHA 3X0DA 4EW2A 1NUAA 1USIA 1T8SA 1R8YA 1JHVA 5JDIA 1I8TA 1ULAA 3IBTA 1MD9A 1QIDA 3MT7A 1SOVA 4WTOA 5CPBA 5EWLA 3UO8B 5CLJA 3RTAA 4NZZA 2WIJA 3OO0A 4O4JF 5T4FA 1PJ4A 5HGXA 3VNVA 5CIQA 2Z5VA 3UWOA 5CEJA 2C5SA 4AJOA 5DLQC 3QFFA 1SEPA 5I9MA 1XDSA 2RAUA 2B0CA 5IUNC 4MW5A 2BI4A 3Q2KA 2ERCA 2VDUE 2FFAA 1XQYA 3KDAA 5H0IA 3REOA 3HTXA 1N75A 3MILA 1STOA 4GP7A 3U3OA 3X44A 4P7FA 3TFQA 4Z7OB 5L6LB 1P5JA 2AN1A 2JW5A 3RK4A 4HWPA 5G53C 2XUKA 2IP2A 1GKLA 1C1YA 3G0OA 1OLUB 3M6VA 3R3XA 1BDHA 1ENOA 1HE2A 1G20E 4UE3S 3FKSA 2HJVA 3L8ZA 3HB9A 2JD2A 6CHYA 2ZR7A 2JNWA 1YS9A 3OEHD 2QLMA 2RGGA 4HDCA 3KZ1E 2R1UA 1CEEA 3E15A 4RS3A 5JWHA 2IYWA 3VGJA 2WYVA 1FYXA 1A71A 2WUGA 2XZLA 4KWIA 4XGQA 4FMPA 1QX4A 2FWBA 4HBZA 4FP9A 1VKNA 3P9ZA 3HB1A 2E2WA 3CZRA 4O4HF 4OCZA 4BNXA 1H8HD 2OQIA 2W2KB 2FDXA 2OGZA 1P0PA 4UDOA 1ETHA 2QEQA 3LA6A 5HCIA 4C0XA 1F6DA 2FWAA 3HG7A 3IDAA 1IU9A 1GSAA 2A5DA 2ZBEA 2R6CA 1XMQB 3HDJA 1C14A 1WXQA 1NF2A 3OM9A 4M3NA 3P2IA 1HDEA 5KX5A 1ZC4A 1OAKA 1P1IA 1WLNA 1BA3A 1Z4IA 2R6R1 2WHRA 4G89A 4IILA 1GN9A 4IRUB 5U1PA 4ZI3A 3EC7A 1N6HA 3NVMB 4JUAA 2DETA 1YL6A 5BQPA 1GTJ1 1MBZA 1TAQA 3JQBC 1QOQB 1M7GA 1GGJA 2FMIA 3C48A 3EFBA 3FJYA 3GGJA 1PWZA 3BIXA 3T7DA 2QR5A 2QYSA 1T29A 4QRDA 2BGRA 4TMFA 5K9ZA 3HVIA 5DO9A 5EQDA 5GWXA 2XWPA 2J0SA 1Z2CA 2RE8A 1EFTA 2C4UA 2X0FA 1OUMA 5EP2A 4Q6BA 3DE3X 2ZSDA 2O3QA 1FL9A 1RKQA 1UBLS 2PUHA 4CIDA 4ZGGA 4H77A 1ZOOA 4HHEA 1QWTA 4KCGA 1X0VA 2ZI9A 3FOCA 5JC1A 4LGCA 6PFKA 1M2WA 3SFTA 1HNWB 4WH0A 3IRUA 1HNXB 5ITZB 4KQWA 3IA2A 3JASB 3KQLA 2MSDB 2HQOA 1UM8A 3ZX4A 3OM8A 5AI6A 3ENWA 4RL6A 2O8EB 3A9WA 3EGIA 5CYGA 1B0PA 2IEGA 4PSUA 1EA5A 3X1JA 4HRVA 2VA8A 4GLBA 1GEGA 1U5BB 3LX8A 4JLPA 4BV9A 4G5RA 4XA8A 3C7AA 1L8OA 2IYUA 3CFYA 2ZSFA 2GAAA 4IOKA 4RMGA 3VPDA 1Q0PA 2JD0A 1XEXA 1KYTA 1KXZA 3IE0A 3W2GA 3AKZA 3WWCA 3TQOA 2FF7A 3HCOA 4L7QA 2JLAA 3G2NA 3MWYW 4RVHA 5B1HA 3T3PB 2Q6LA 3C3YA 4K2HA 1ZUNB 1CUZA 5ECWA 4AI6A 4GMDA 4NATA 5JBQA 4EQ6B 3JS5A 2MIIA 4F9EA 3EZLA 4E5VA 3F46A 3ORSA 4ADSG 1YASA 4ASUA 2I9KA 4OBEA 4RSGA 5IEJA 4IGFA 4EG5A 2JKDA 1Y3IA 1VMEA 2UKDA 4GWLA 3G49A 4MS1B 5KQSA 5GONF 4L02A 1HQKA 3LWDA 1NYQA 5L9AA 1J5PA 1NONA 2YVLA 4LDAA 1H1LB 3R5TA 2X4LA 2JFBA 3NNDA 4ARCA 4YI3A 5C8ZA 1ZA2A 2RHJA 5CCXA 4DLPA 4C4AA 1S2NA 1MX3A 4HD8A 1L5SA 5ICMA 1TEXA 1GQ2A 2WNSA 2B8NA 1GUYA 3A1TA 2C99A 2Q3HA 1VCNA 2I2DA 1T43A 1QORA 2A35A 4OF4A 2WEKA 3FYUB 3KD3A 5JADA 3SOPA 3RUCA 3M1AA 3QVVA 4MI6A 4RLSA 4BMNA 4L9SA 2NT4A 2VPQA 3QIVA 2VCHA 3F9CA 3SDZA 3I28A 3TQIA 3SHFA 1P2DA 3EIXA 4QHTA 4ZCTA 1D2MA 3JRWA 3HWWA 3KSMA 3FKJA 3V4ZA 4YCMA 5KSWB 4TUYF 2FPGB 3T94A 1MCZA 4FBLA 3EBOA 3TVYA 4ETMA 5D2CA 2UVPB 4YTEA 1THMA 3LC2O 5TLSA 4M2LA 4G8DA 4DW8A 4LWQA 4ZODA 3RC9A 1UJ4A 1U28C 2GPWA 4AZ0A 1E1KA 1KR5A 2QI9F 3MGCA 3OLQA 4HO1X 3TMKA 4MWTA 4QBFA 1RHJA 1P4AA 3FFAA 3SXJA 5BPFA 8AT1A 2UYHA 2UYGA 4JQSA 3T3MB 3K9LA 2Q9CA 4YK7A 1D8AA 4JNKA 3ML1A 1FYDA 3OX2A 1Z34A 5F5XA 5BYJA 1EDDA 4EJQA 3T06B 5BNWA 3CS3A 4OSPA 4QUEA 1DZIA 2NLOA 3LT2A 1KZ1A 2P0EA 1MC5A 3EQ6A 1UXGA 1WDMA 5AJUA 1X2EA 1Z5UA 5C9ZA 3NDIA 4B40A 4BCBA 4XRRA 4MUHA 3AETB 3P9XA 5JLAA 3P9SA 4PYJA 1WF3A 1P17A 4RA9B 1QGAA 1VSVA 1Y1KE 4M89A 4NOKA 3TIIA 3CNOA 3UB2A 1CYDA 1G41A 4FI3F 2R6ZA 1NZDA 5B6PA 1H2FA 1DKPA 3DPIA 4MB6A 1ISIA 4IUBS 1RZ3A 2C00A 4POOA 4HG2A 4R01A 2PH7A 4HLQB 4XDGA 5DDIP 1Z28A 2QTVB 2CJYA 4UHKA 3JQFC 2AQHA 1ENPA 3ZQ6A 4O4IB 1U8FO 1DAOA 1L5HB 1AQIA 2GK4A 2ZE7A 5FOUA 4NU5A 1OTXA 2P41A 2VFAA 3UJBA 3ZV3A 2I4MA 5SZHB 1XVUA 3PEFA 5K1ZA 5F2EA 2QX4A 5TPWB 4DQXA 2YZGA 4CL2A 2O5EA 4MNTA 3NM5A 5KEIA 2A7QA 1SVIA 2DQ4A 4HLCA 4HXYA 4R2MA 5HILA 1GXSB 3K70D 1O89A 3REGA 3A6LA 3RG8A 2E4YA 3VZDA 2X8JB 3G2MA 4WLOA 3T9DA 5D7BA 1KVRA 1KK0A 4PC6A 3C5CA 4CQNA 3HXOA 3HRKA 4YRGA 2BH9A 3TNJA 1LSOA 3U4AA 3EVDA 3QY9A 3PDWA 1E4EB 3W6PA 4Q4HB 1XRNA 4WL0A 1ANKA 1P9OA 3PUIA 1JFLA 1X42A 5CG2A 1PNOA 4KFTA 1KR2A 3W8RA 3RF6A 1DXHA 3GUZA 3RI3A 3MG9A 5HBRA 2GEJA 3ZYCA 4HDAA 2XOEA 5I8WA 1UOOA 2Q46A 1XT6A 1TIPA 1J06A 4KP7A 5FJIA 1QF7A 3GDGA 4B2YA 3V2GA 4L22A 1R9MA 2OGUA 3QE4A 1XB2A 4MQLA 4OIFA 3UK7A 2RB5A 4E5DA 1E66A 1E0DA 1PR9A 2UYOA 2D5CA 3E9MA 1QTQA 4YB8A 3DVAB 4DLSA 3AB3A 2NPFA 3VHQA 1WZ2A 3BK1A 4PLGA 1KP9A 4F1KA 3DVRX 4LYAA 4L75A 2C2HA 5IF9A 1N77A 2RGUA 1TJPB 1ADCA 2NQ2C 5F9FA 4F0JA 4NESA 2WVHA 3H04A 4UCQA 1T36A 1EBUA 2EHJA 4TL7A 1DXYA 2B35A 2XT0A 4MW0A 4F5EA 2PUDA 1I0LA 1G8FA 5BR7A 1UBUS 4MGKR 2CV2A 1Y8CA 2A78A 4KLNA 3L06A 1U8AA 4I2VA 2Q6KA 2ZJFA 3LQ2A 4KR6A 3D3WB 1LCIA 2AQ8A 3OU6A 2QLBA 2XW6A 4S2EA 3KOYA 4UZEA 1V8DA 5FO1A 9MHTA 3GNTA 2WG2A 4K8RB 1Y5IA 3A31A 1PWXA 5AYVA 3P52A 4ODIA 2C9YA 1RLUA 4F3RA 2JAHA 1XHEA 5E6RB 1JTVA 1YMQA 4DDWA 3ZV6A 2JJ1A 1M1YE 2ZBQA 3T3EA 4JL8A 3SIPA 4I4TB 3AP2A 3IVXA 1P18A 4E2YA 2VNIA 1IUNA 1IVYA 1GV1A 2Q5FA 1FTQA 1Q7CA 3DTTA 2CMHA 4G23A 4MMXB 2XKBA 2FRDC 5FOWA 3U4HA 5AJXA 5AWFC 1CUCA 1TQ8A 4D0SA 4ZCSA 1RPAA 1FSFA 1P4JA 3K09A 3G8AA 1NX6A 5JSHA 3UHPA 2P3QA 3E35A 4YJ2B 1MG5A 3WDKA 3KLBA 4D6YA 2WJIA 5DLYA 1X7DA 3UHAA 3JQEA 4BGUA 3L1IA 5KVCA 2XDWA 3PE6A 4MV0A 4NVRA 4WADA 5J4YA 3FSEA 4XYBA 4KOAA 4U9IS 5CM9C 1E63A 1ZM4A 4IH9A 2D4HA 5LOVA 5TPZA 3IEXA 4KTVE 2P79A 4M0EA 3DHWC 4Y18A 3RWMB 2CL5A 1VHQA 1G7TA 2ZB8A 4RY9A 1PQWA 1VHDA 5BVHB 2RHDA 1R74A 1P2GA 4OP1A 4UM9B 1ADGA 3SHVA 5FWNA 3A9UA 3RYCB 5C51B 5EJ5A 4YFYA 3EDCA 2ISQA 4PN3A 2BRUC 4JZYA 1PJCA 1WMAA 3AEZA 2B99A 1VYTA 1N4DA 1KMHB 5LXTF 1CQIA 3UQYS 3GT0A 4M1WA 1E3DA 1Q1AA 1UWLA 5ALYA 3K9HA 4RBNA 3V33A 3Q5DA 6AT1A 4PTYA 1K89A 4KW7A 2V8BA 1EGQA 3SFVA 1JQBA 3SG0A 4X7PA 2ZP1A 1MTZA 4DR6B 3CH6A 2I54A 1O77A 4NPCA 1BSVA 3C16C 1Y8ZA 1IXKA 3A77A 4W5TA 3ZIUA 1CR2A 1A5AB 3U56A 2C7BA 1Y89A 2X1VA 2ZQYA 3C3JA 3D4BA 1UQUA 4GR4A 2WT8A 3TLKA 4EY3A 5LL6P 1XP8A 2FU5C 4NCIA 3R0JA 2X2PA 2IWRA 1P29A 1GKUB 3R7AA 3TLGA 1G21B 4J16C 1G7CA 2Z43A 3CNBA 3QXCA 1U0RA 1V4BA 1X94A 1K6EA 4UMFA 2WU4A 1IHXA 3K0CA 1WD5A 3RUHA 1YZGA 3F49S 2B36A 5HJ2A 1GGMA 2LD4A 5EQJB 4HMOA 3ITDA 3F3KA 3M4XA 3FYTA 4URXR 4R1PA 2RJ3A 1FDWA 1P31A 2HF8A 4LI0A 1JTEA 5BYBA 3D3QA 5AK5A 4JP2A 2I03A 2XZTA 3O3MB 1CHDA 4C43A 4HN2A 2EF1A 2LCIA 4GEKA 1SQSA 2QRKA 2ZUUA 4M88A 3BA6A 5JAMA 8LDHA 2HDOA 4ZCMA 2ZULA 2I62A 2SHKA 1JHAA 3L5KA 1LF5A 2JLRA 4YBZA 5E6SA 3FIJA 1V7QA 3T1TA 3F4LA 3R9IA 1C3VA 2C61A 1EUCA 2J08A 2VRWA 2W6MA 3TKLA 4Q7LA 5LU8A 1YFZA 4J91A 4MYTA 5JUWA 1ZK3A 3STVA 4M0DA 2LDBA 3EIWA 1KOFA 1DLIA 1Z75A 3FSGA 4LXHA 1NPDA 3RAGA 2GN8A 3P2OA 5KMGA 1GGFA 2DHCA 1N7JA 3RSGA 2JVJA 1ZKDA 3N2KB 2EWVA 2HU5A 3KTOA 2J5XA 3T7RA 5JZSA 3DL2A 1JJVA 3HBNA 1ZI6A 3NH9A 3P2MA 4M1KA 3O1HB 4WKGA 2KJQA 1EHYA 4OHFA 2MMGA 3JZFA 1I2BA 3C3PA 3CIFA 4U7TB 5FF9A 3A58B 3CLUD 4D3FA 4F4JA 2KLBA 3ZQUA 1QV6A 4AYWA 5A4FS 1OSNA 2GA9A 4KUGA 1OXMA 2WWGA 3UMJA 2FV8A 2VRNA 2ZYDA 3GC6A 5A9SB 4J3JA 2HIAA 4BTLA 4TRRA 1NMYA 1RD4A 2WZCA 4JEUA 4PFKA 1N92A 4BRUA 3QUCA 4AFNA 3I5XA 4XFDA 1YGPA 3TQFA 3GROA 5AXDA 1SURA 1AD2A 3A27A 3CG0A 2CL7X 4HADA 5BSUA 1EXWA 1WCWA 5L7WA 1SHZA 3HDGA 1ZGGA 3JR7A 4BNWA 4Q05A 4L4UA 1ZSVA 4CM1A 1E1RD 3DE4X 4BGEA 4HDQB 4I50A 1KAQA 3OJLA 3AIMA 3KTAB 3TD6A 3S28A 3IDSA 1TIKA 2RHMA 1PUXA 5E7IA 1R0LA 1R6VA 2QX7A 4JXJA 4X8MA 3TPZA 3HZRA 4Y1RB 4BZWA 1V2HE 4LHWA 5LYYA 2VSNA 5A9SA 1OI2A 3KQQA 1YE3A 1U8UA 3ZE0B 2IZZA 1HTWA 4BVHA 4CEJA 4FYJA 4KWEA 2JZNA 1CSEE 1HUQA 2L19A 3O91A 5IVIA 3ZGZA 3G6WA 1YCDA 3DTYA 2JAWA 3MTQA 4D4LA 4US2R 3OCWA 4HTAA 4OV6B 3H5IA 4QLOA 1VJTA 1KJWA 4IMJB 2XB6A 3AFIA 1HT2E 2H9YA 1IHDA 4O2LA 2EJCA 4RIEA 3RVRA 3B60A 3H1AA 3NWJA 5K0GA 2PH1A 1NVXQ 2AJTA 4NYJQ 2C03A 2M32A 2PTGA 4QPDA 4EAQA 3HBMA 2B25A 2FEWB 3PG5A 3Q3IA 3QVGB 1R9GA 2GAFA 2P62A 3RU2A 1U0TA 1OHHD 3ECAA 1V16B 2X0KA 2W00A 2H1CA 3E7DA 3OJWA 1U28A 2KMLA 3GD5A 1HYBA 1TM4E 5FWDA 2AR7A 2A0WA 1CQPA 2Q5IA 3IOYA 5JAOA 1JU3A 3A9TA 5AM5A 1ZRHA 4V0KA 1Z7GA 3AB8A 1XAGA 3BGDA 4O0MA 1NSFA 3D1JA 3HSSA 2IPAB 4UAVA 4UHHA 4X41A 5FBWB 1U5BA 1WXFA 1KFBB 1N0WA 3QTLA 3C70A 3KT3A 2M9MA 1QGZA 1B8OA 3FMFA 4XWGA 3OKPA 3GBSA 3QITA 4FMCB 1F60A 4HK4A 2O52A 1JWBB 4KG7A 1T3TA 2HBRA 3HJBA 4RCYA 2FMTA 3GZNB 1CRWG 1KEPA 1JYEA 4AYTA 3PITA 5EKUA 3PNKA 4YX9A 2G1PA 5BT9A 1G21A 1VMIA 3QFHA 4QOFA 3C43A 3GR6A 1W4BA 4HNAB 3E9RA 4MW7A 1ZEMA 2B82A 4NIMA 2XQKA 1UDWA 3NATA 4BEWA 5BN4A 1DI0A 1HEIA 1OPRA 3PFGA 4WW0A 4K9DA 3S29A 5CVTA 1H3EA 1QNFA 1A5BB 2ZJOA 3PHIA 3RYHB 4L15A 1HE5A 2IH4A 1WB6A 2BLLA 4KDEA 2ETXA 3JQ7B 1NVKA 2NO4A 2O7VA 1Z22A 3GN2A 9ABPA 2YJ5A 1TW2A 1XAHA 5BYKA 4WECA 2P9BA 1P5FA 2O57A 2R8EA 3OZFA 1KI7A 1RTTA 2N9UA 4R16A 3I01M 3V9PA 4DCVA 1FZQA 2WP8J 3KHSA 3ZJUA 1QO0D 2RC6A 3ETHA 3NHYA 4RMIA 1I7QB 1KDVA 2HMUA 4WCFA 3GGSA 3H5AA 3DEJA 3ZWOA 4K9PA 5LPNA 4Q4LA 5LZ4A 4ZKDA 3GP3A 3RQSA 4URHA 1N2EA 3GAMA 3M5DA 2E4ZA 1VKJA 1L7XA 2XE6A 4L9RA 3SBXA 3BD7A 3ZK8A 1MZPA 1BJKA 1VE7A 4ZFNA 3R0IA 1KHXA 4AVYA 5I9SA 1N9GB 3VR4D 4OU5A 2Q7DA 1BAPA 1RRPA 1RKVA 2YS7A 2O8EA 3SI7A 2I7TA 4QRIA 4ZYVA 3CSDA 3ANLA 1SHJA 4JIMA 3TSAA 3WXMA 3FZQA 2ODNA 1HR0B 1ZM3A 2XUPA 3K53A 1TMOA 2CXTA 3PNPA 2WJWA 5NLLA 4DVJA 2DHQA 4BNKA 1Q2UA 4B9AA 1M66A 1NIJA 1ABBA 2FFRA 4GF5A 3IA7A 3FOWA 3OTQA 4HXFB 1VP3A 2OORA 3M5CA 4AMYA 3UMBA 2C2OA 1W36D 1LDBA 4UXIA 5LQAA 1X9HA 4LX8A 2VEDA 4EKDA 4EGQA 4RTMA 3IFSA 4RVFA 3S1AB 3JAKA 1RI1A 4CETA 4N7MA 2BGJA 4JCCA 2O1EA 2HRRA 5AVYA 5IWCA 5KKCA 2ZFUA 4EMTA 3LZDA 4LY9A 4WDRA 2IXGA 5CNKA 4ZHQB 2DG2A 5EIAA 4F2HA 1IY9A 2BYTA 1ONBA 2X6RA 3DV0A 1AU9A 3L0PA 1ECCA 5EP1A 2QTLA 3OPVA 4RPKA 2YZ2A 2HXYA 4Y2RA 5FYQA 1Q57A 3EIEA 2GTHA 1Z12A 3VR3A 2D54A 4JP5A 1HFKA 4YUYA 3EF0A 5JQWA 1KRXA 3PHGA 4F6RB 4NE7A 3IURA 3GK3A 4NRDA 5J5CA 1GP2A 3OPMA 1YT5A 4YCDA 1NW5A 3H9EO 4Y6QA 5FXMA 2BKVA 4EO4A 5D5PA 2NIPA 4EBBA 2P7IA 1NN0A 2PV7A 3M6IA 3EMKA 2V03A 2JIPA 5EXDA 2Q1YA 1FVHA 3ICPA 1DRWA 2NWQA 3B7PA 4GE3A 2POQX 3KVVA 4X61A 2B9VA 3IBCA 4BB6A 4Q4JA 4RSHA 2VP3A 3A37A 3VKHA 4CG3A 1JBEA 1QYVA 1VYVA 3VU9B 2QGZA 2NXWA 4QL3A 3EOZA 4EHJA 1XF9A 2VT6A 2C4NA 4R7ZA 2UXDB 1M6YA 2NG1A 5KWJA 2IYQA 4TQAA 5DVZA 1DTSA 3LBAA 4ZJZA 2ZR0A 1MXHA 2XHZA 3LECA 1H2ZA 2EGGA 3GHYA 4HQNA 3KJEA 2AF4C 4D0NA 4ZU1X 3HHEA 1CZOA 2Q2QA 4R9RA 4FN4A 1K3QA 2C78A 2FQYA 3WIOA 4GYYA 4FXPA 1BKSB 1E59A 4B4DA 5AQ1A 4XOUA 3CEHA 4DT1B 1Z36A 1SQGA 2G6TA 2VWPA 4ZWNA 5BW5A 3ZTWA 4EYKA 4RD4A 9ATCA 3IPYA 2KBFA 1E4EA 3PSHA 2JGNA 5B7NA 3I6UA 2R1ZA 2HEGA 4YRPA 1C7RA 1TZCA 2VQ6A 2Q2WA 4ZYZA 1NXWA 1YJCA 1WU7A 2NQ8A 3GRKA 1AQ6A 4YXWA 2HMTA 1R37A 3T12A 3O3CA 1QFYA 4R5HA 2ZITA 3OTGA 5ARCA 1WZEA 3HKCB 3EE6A 5DJ5A 1DPGA 5ISMA 3OIUA 3PVZA 4JIGA 4DTCA 1CF9A 4MO9A 4FGLA 3SJCA 4RTLA 5JNUA 2CMFA 1ZZGA 4MMZB 5IKOA 4PS0A 1BOOA 1GL7A 1YULA 1Y6JA 2H2HA 3CKLA 1Y3DE 1UKYA 2Q4OA 3PZRA 5CM2Z 3U13A 2Y68A 4E5PA 2X9QA 1Z6YA 1ZY2A 3GMTA 3P0RA 2BMWA 5LA6A 4QOJA 1BNCA 2OPBA 2FWMX 3CMCO 4L28A 4DEVA 1U5CA 3C97A 4NAUA 1ZMXA 1GZUA 3WYFA 1D4AA 2FMHA 2JI8A 5JROA 3W4JA 3K35A 4J7AA 4RJIA 3CF4G 1XWIA 3FYDA 4QU8A 1RADA 2FRDA 5IDXA 1IHUA 3CVUA 3RVKA 4FDVA 1OZAA 1VJ1A 3OF3A 4G9BA 4N18A 3TGWA 4DLYA 4QLBA 4JBWA 3DB1A 3GHHA 4KKXB 4FT4A 1Q95A 3O8LA 4KLAA 1R6AA 1MFPA 3FYCA 3HWSA 4HWTA 4LTMA 1JB1A 4X8LA 4LRYA 3BXGA 3V4OA 4JYZA 3ZV4A 2Q5EA 4MITA 4JI8B 4IZOA 3O0DA 3TZ6A 5EJ9A 1L5FA 1NUSA 2K87A 1K6MA 1QLHA 2OG1A 2XWQA 3LLCA 1RNLA 4NV3A 4O02B 4TZ6A 1E2HA 4LYEA 3Q7RA 5GV8A 1XALA 2I78A 4MULA 4O2RA 1SK9A 3L6UA 1JDSA 4O2AA 3TVDA 4EPYA 2PUTA 5K7SA 1DX4A 3PDCA 5H02A 2GPYA 3BXFA 4GXQA 3WBJA 3F2IA 4PBSA 3LX6A 4KO4S 4L8LA 4BO8A 2WV9A 3U3MA 4JB3A 1B6TA 4QX6A 4EGAA 4OHMA 1DARA 2EBHX 3ITEA 2X8LA 5I47A 1YJMA 4GZMA 2OD7A 3C41J 3LCJA 3LF2A 4LV5B 5B2ZA 4RHFA 2HTFA 1VPVA 1YB6A 4AB1A 4MKIA 1G59A 1R66A 2MSCB 1RKBA 1ZXBA 2FDRA 1ZRSA 2AK3A 1FRFS 5LD2C 1US8B 3DMPA 1BN7A 1FNBA 1V3VA 2TS1A 4KFRA 4MQ6A 4ZQHA 3F96A 3WG9A 2WMYA 3L8DA 4QODA 1U8TA 4J03A 1PNQA 2ATCA 1J1IA 2H7VA 2FF5A 3HZZA 3CA8A 1YTLA 4OJTA 1SBZA 4BXOB 2PIAA 3VMFA 2I67A 1DELA 2WDPA 3HU3A 1WMDA 3IT3A 4C0QC 2JA2A 2I65A 2XAUA 3EULA 3OEED 3CUKA 3IPLA 1WB4A 5SY4A 1BEEA 2EL9A 2W7TA 4RH3A 4YRKA 1U0OC 4O2BB 2ZZKA 5A5GA 5DP2A 2FVYA 4RIHA 3ZNOA 4RFVA 4ZVRA 4B3TB 5A3VA 3WB1A 2GJ4A 1L3CA 4BNGA 1YR7A 5F7OA 3CN7A 4RY0A 1P7ZA 3I12A 5DYGA 4B5LA 5H1YA 1DOHA 3FGZA 1T4CA 3WGHA 4HDMB 1VGVA 2Q2NA 5T4EA 4D9GA 3Q3EA 3ELYA 1U1IA 2C2YA 5TJ9A 4GOKA 3U1VA 3RG2A 2DTEA 1WR8A 2EW1A 4L95C 3I53A 4FYWA 4KWHA 4KGDA 4JEMA 4YC7A 1P1KA 4UNPA 1NLMA 3WGNA 4DYDA 3OF5A 2R86A 3NHLA 5TIIA 1O58A 3KJZA 1K8YB 2IQ5A 3H9BA 3IS3A 1GKIA 3CY6A 3NHWA 1CVIA 5H4HA 1M8GA 1NT4A 1B8PA 1RAAA 4HX5A 4RF3A 1ZM9A 5CT6A 4HDSB 2GHQA 1H4QA 3C3BA 1ZFNA 2BCGY 2DPYA 2X1LA 1KHHA 1YB4A 3A70A 5THKA 3SSNA 3HC7A 3IKVA 4BN5A 4TVSA 5C31A 2XRFA 3UF0A 1U6KA 2VXBA 3Q11A 3Q7QA 1MVOA 3W1VA 2QMZA 1M1ZA 2P2NA 3ESQA 3S81A 4DKJA 4FW8A 5HDBB 5A06A 2A4MA 1P77A 1D6MA 1Z8NA 5I7AA 2OXCA 1R0CA 3KV1A 3O8RA 3WK9A 3KQSA 3QF7A 4EEZA 5EUCA 1U7TA 1QRAA 1LGQA 1G21E 1Z4JA 2IZ6A 4JJGA 5EERA 1OIVA 1EGHA 3OUNA 1K7YA 3C6XA 4MW6A 2OORC 3Q41A 3VPXA 2O2XA 1G8YA 3TOXA 1VL6A 1GQRA 2C4HA 3GUCA 3ON5A 2Q07A 3MSXA 1T9ZA 2GYVA 5E0OA 4NU8X 3VH2A 1HKUA 4BNIA 2K2WA 2CDAA 2XEXA 2WFLA 1ELOA 3D3NA 5KYUA 5TV2A 2E6KA 1C29B 4ZO9A 1YK0A 3PEVA 2PR2A 1ZJWA 3E5HA 1Z39A 3RYIA 5B55A 4UHBA 4Y0VA 1PEAA 2WTBA 4E1BA 1DBWA 2DM6A 4GICA 1G1MA 1RHQA 5F9MA 4AUMA 2Q6OA 3R5KA 2XYHA 2J3HA 1DRJA 2YUIA 3TOCA 1KI9A 1MW9X 4HN9A 4L8GA 5TS2A 4JT9A 1MIHA 2WB4A 1KY2A 4IJMA 1ZUIA 2WTNA 2BEVB 3OC0A 4OKNA 3ZK7A 3QHPA 1W1IA 1SD1A 2XYVA 3I5AA 1RS0A 4L0QA 4F06A 3NDBB 1HQDA 3PGJA 3LYAA 4I81A 1NXTA 4LHVA 4NK4A 1JJIA 2A5LA 3MAGA 4RXUA 4WXPA 3HPQA 1INLA 1JH9A 4JGGA 2OLEA 1RZRA 1X74A 2HK9A 1BX3A 2JK0A 3N8HA 4FGKA 1OZFA 1MJGA 2WZQA 4NBWA 1XMOB 1I0IA 5FOQA 3LHSA 3LZCA 2R6GA 3GRPA 4H15A 1U7VB 4OHCA 2BONA 1JAIA 3DBHA 5E0KB 2GNPA 3W34A 4OQLA 3ZEIA 1ENZA 1GT91 3DDNA 3LXUX 4CUZA 4OKIA 5FA6A 3WIDA 3DQPA 4FZRA 2ZE5A 4IFIA 2IV7A 1EM6A 3ROGA 2DFLA 4QAJA 3K0SA 4AS1A 4J16A 2UXBB 4I4NA 2Z9BA 2G5CA 3KOXA 4ZYTA 4EDFA 3ZXYA 4CCYA 3EOAI 1N3BA 3KUXA 1N2CA 3KPUA 2Q3MA 1OLXB 2BE9A 2JFQA 4J1QA 4Y9DA 3ZXSA 4XWYA 3GUHA 1FMLA 3FWPA 3R8FA 1UEIA 4WKOA 1M8PA 2FZWA 8ADHA 5KTOA 4BC0A 3MZ0A 2WMNB 3OETA 3ET4A 3B6EA 4MX8A 3V8PA 4B9EA 5B6IA 4L3WA 2RG7A 2BKAA 3EZNA 3L7BA 3MA0A 3RBAA 1EEXB 2V6IA 4WIAA 4D9FA 2DZDA 3MN1A 4IHJB 3DA8A 2BZ1A 1R8QA 2PMBA 4KQEA 5LP1A 3L4KA 1E5XA 2VJBA 1W5SA 1DU4A 4JLWA 3UGKA 1KAOA 2BGLA 4DLAA 3AVXA 3VKFA 2HFJA 4U2EA 2NU8B 4MUAA 1LW6E 2G0NA 3MOIA 2ZJ3A 4FX5A 4G07A 4PLHA 5EPOA 4AG5A 4A6EA 1ZJJA 3FCUB 1VLHA 4QBGB 1KKMA 5E9QA 1XEWX 3M7IA 4A10A 5ALHA 1C0EA 4DCJA 4BNHA 1ZJ6A 2X7HA 3DVLA 3SZGA 1MB2A 2FZ4A 3KAPA 1DQPA 1UT8A 4ND6A 3T4XA 5G0UA 2V7QD 2XMPA 2OWEA 4Y3UA 5JAQA 3OQMA 3Q8KA 3HY4A 1UF9A 4F4IA 2DB3A 2I6TA 2I91A 5JERA 2EBFX 4AL4A 4IOMA 4N9QA 2CMGA 4NWIA 3THYA 5BNTA 2EYQA 3FSJX 4QGAA 1V8ZA 2C9CA 2HJSA 2RHOA 2XTMA 4DJ5X 1Z2AA 2CUTA 4G0MA 4RKWA 4X8HA 1Y98A 4P3XA 4YRQA 5ICFA 1E60A 1GVNB 2AFRA 3EXHC 3PJFA 4NZPA 4BX9A 4EP1A 2JLXA 3ONNA 1RRFA 2W4QA 3L8HA 3AR2A 1H9AA 3BJEA 4ZQBA 1UP6A 2XBMA 5AR1A 1SIBE 3Q3VA 1QZUA 3QHQA 4ZOLA 3B9PA 4YIHA 2Z2XA 2WHPB 4FC7A 3TE7A 3UGQA 5HUJA 4IJ6A 4X0EA 2ODQA 1DFHA 2PUEA 5KMGB 4J3FA 1ND6A 1AURA 1YFJA 4JUCA 3N6XA 1QCDA 4XLLA 1F4VA 2PUFA 1Q5PA 1A4UA 1R7RA 2DULA 2GFHA 3AX6A 1QRUA 5LLTA 3IAXA 3J7AC 4M37A 3OA0A 4TZKA 3VGPA 1QIGA 2YMPA 3HXKA 2JLZA 1R18A 3OEWA 1BCSB 1O6GA 1YR3A 4XM0A 4BZQA 1PJAA 3F47A 3G1TA 3WS7A 2WA1A 4M9QA 4BFZA 3T41A 1NX9A 3B20A 2ZU6A 4MI9A 4EHFA 5LIPA 4P32A 3OHMA 3R0ZA 4C7JA 1XDBA 1ZVQA 2XE4A 3HR8A 2QY6A 4R71A 3QVSA 3WOHA 5L3SA 3FPCA 3GJ7A 5CLHA 5EJFA 4V2UA 4B74A 3ZW8A 3G02A 3U3JA 2PUAA 2OXTA 3T3NA 3QW4B 3ZIAD 4LF4B 3NALA 5KU1A 1E1DA 4LQDA 2ZUTA 1WOYA 1DUIA 1TGYA 4PNZA 3W6ZA 4JI5B 1NBOA 3WJ1A 2AMFA 1WW8A 2OFXA 4ZC1A 4JLMA 3TNYA 3ZPXA 1U8EA 4B3DA 4DA4A 4IEIA 3BMCB 3HLYA 2RBEA 4IQGA 5K8JB 1TK9A 1C9KA 2YHIA 3ODPA 2C5BA 3FCEA 3TGPA 1F2DA 4WSOA 3ZY5A 4LMRA 4ON9A 4S1PA 3UAOA 3BTOA 3M0EA 1UINA 4PGFA 3ZOZA 2BGUA 4OJYA 4U2GA 3FUUA 4HAYA 4B76A 3FPSA 4X3PA 5AI8A 5HE9A 3HPRA 1Q11A 4B48A 3HCDA 2DR0A 2JFWA 2VXYA 4EB6A 5KX5B 5BV1A 3ST7A 1WNFA 1K3UB 3SEQA 5JSKA 3I1JA 4V3CA 3R4VA 3KT8A 1RMYA 4JX9A 3LX5A 1IWPB 1R00A 4KPGA 3WFZA 3KG2A 3QW2A 4LZWA 4Q9KA 1E6LA 5F3DA 4C6TA 5LWHA 3UBMA 1G64A 4BQFA 4RS4A 4JDPA 2A9OA 5JD5A 2QD3A 6YASA 1U4OA 2IYSA 4N6OA 1G8PA 1TYAE 1XCMA 4D56A 3AEQB 4P80A 1K68A 4P4GA 5KYXA 1O6CA 2R6AA 2IPLA 4BIIA 4FKMA 4CM4B 1NN5A 2VWQA 3D0QA 1N6LA 3LDHA 3V42A 1ODKA 1TTPB 2BWJA 4TRJA 2PPVA 3R5XA 1JQ5A 5A7FA 3E23A 2FUCA 3OHSX 5BSRA 3E7PA 3B9BA 4J90A 2ZXFA 5JVDA 1C3JA 5ILQA 2V4UA 3W4KA 2C9BA 1NQOA 3B2EA 3DMGA 2CSWA 1GA4A 2BGIA 4F71A 1V1MB 1LRLA 4L3VA 3TLBA 2HO4A 1GM5A 3OCXA 3QXJA 2WM2A 3LYHA 1QU3A 1F0NA 2AWNA 1L4KA 2V5AA 3N6RA 1K7SN 3ANYB 4AN0A 1AS0A 4H9GA 2VHCA 4MW2A 1QYXA 1SH7A 2YX1A 3DB2A 3P2JA 5D1NA 5KYTA 1N5LA 3PHCA 2GF2A 5ETJA 5I9IA 4BGDA 2VSFA 4AZ3A 1T35A 4O3MA 3UG7A 1JR3D 2EJVA 3BFJA 1ZIYA 2DCMA 3AR7A 2IC5A 2VF2A 3MJTA 5LNK6 5M3BA 1LK0A 2WK1A 2EBWA 5BWCA 4D8XA 1ORHA 3FDIA 2PE5A 3ZJVA 3TZBA 5DNEA 2JCYA 2I2BA 3HI4A 4G4SO 4HKTA 1K6IA 1B6RA 1RPNA 3HFRA 2QRLA 4L8YA 3VZQA 3GFVA 1X8LA 2FMFA 4BV3A 4QICA 1GRNA 4OHKA 2ON6A 2A1TS 3N75A 4QFDA 1OB5A 5DTRA 4JGIA 4PG8A 5LWQA 1NTOA 4NPHA 3SYLA 2J6IA 2RCYA 1OI7A 4IH4A 4BE9A 3LC0A 2F48A 2VP4A 3KQVA 1GCIA 5ADWA 2XWBF 2EP7A 4G41A 1XDUA 4G4GA 5LYJA 3N2GB 3G17A 4RFLA 2B78A 3ZY4A 3UICA 2PSEA 4L27A 2QXYA 1WXEA 2V7EA 3DUFA 3ADBA 2QOEA 1QYIA 1IM2A 3CX8A 1H1TA 1XZAA 2KI5A 1UADA 5LA6B 3V6LA 3CBQA 2V98A 1OKKA 3QBDA 4R8SA 2D7CA 3V8BA 5LMUB 4JELA 3MOGA 3QBVA 4XQ0A 4D81A 4IWYA 5AW8A 2NUBA 3L6EA 1UMKA 4ZAGA 3BWCA 5KSYA 1G19A 5AUPB 1CUBA 2LVBA 1LTQA 1KETA 4CLOA 3QEAZ 2WJPA 2CXUA 1QS0B 5ALOA 5LZ9A 1LBHA 4H16A 1DKOA 1PFWA 5EEHA 2VBGA 4RY8A 3N5KA 1SC1A 3MINA 3HJNA 3F1LA 2XT9A 4X9XA 1CULC 2GN9A 4KOEC 2EF0A 1V43A 1Y5MA 3A1WA 3MUEA 4MGIR 3Q9NA 3LWNA 1R6BX 3AJEA 2PA0A 5DSTA 4URYR 4B83A 3BCRA 5KQPA 3SZUA 3M6AA 1YU6A 1WVIA 2CXOA 2B6NA 3B48A 4LWOA 4M0CA 5TSDA 3QVKA 4EG1A 2VLIA 1ACMA 3IQEA 3IQGX 4KE7A 1TLTA 1TJ3A 1XELA 3U16A 4CGZA 3KV3O 1JZSA 4R2LA 3NDJA 1HDCA 3E5RA 2AI3A 1U7DA 4ZI7F 4IO1A 3D4IA 1BW9B 5DIZA 2RGDA 3AVVA 2PH3A 2PSJA 3E0QA 3ZI7A 1JU4A 3W79A 4JOSA 1YKSA 4C4XA 3N2NA 5HQ3A 3BWBA 4WLEA 3F3MA 5H4GA 3ZKWA 1WDLA 5ALPA 3H5VA 4P7GA 3ZD6A 5E38A 5IJWA 5DM0A 2BDEA 2PXCA 1BCSA 2IVZA 1F2TA 1K5HA 4Q82A 1WJGA 4EATA 2OXIA 4C5BA 3H05A 1ISMA 2XB9A 3BORA 5JS7A 2ZYRA 3MFYA 2JRLA 5AJHA 1EFVA 3L2OB 3ROXA 4DCPA 1TKAA 4DXDA 5A4MS 1DAGA 4GXNA 2I2AA 1REQA 1X1TA 4MKXA 3VJLA 1V0JA 1ZUWA 4EFNA 4A0GA 1A8SA 4AO6A 2EW2A 1HURA 3WLPA 3ENZA 4FI3C 1BIFA 2JD1A 3RNLA 2D13A 2A4KA 2NXJA 4PG5A 3K05A 1X1BA 1P1HA 1ZBDA 1O97D 5AVXA 2AG1A 1ODFA 2RI1A 1LDGA 4WVLA 4OHZA 3UFXB 1TUEA 3GVIA 3U5TA 1A9ZA 1NM5A 3WGQA 3LV8A 3TNFA 3U26A 4M76B 3TTVA 1JIKA 2O07A 2IS1A 1O0BA 1W85B 2GXQA 4RDXA 2PUWA 4CF4A 3QWFA 4OMUA 3QXSA 2VP5A 1VB3A 3DCJA 3EXFB 3OZVA 4LOLA 3FZNA 2FR8A 4TMTA 2GA8A 4I7EA 4PZUA 4R1QA 3T4EA 1A2KC 5K0EA 3BBPA 3V46A 5KTKA 5LQKA 5I3CA 4MWBA 3HV2A 3N05A 1CWUA 3T7EA 1T5IA 1NFRA 1I3LA 2WWIA 3H87A 4MVJM 4IJ5A 4DBVO 4LYGA 3H5NA 2ZDGA 3BGIA 2Q9UA 4PLFA 1FS4A 1B6GA 3Q98A 4YNBA 2H63A 4O8CA 4AKHA 2IUFA 4CKEA 3IX7A 2PO5A 1CX9B 5A0TA 2GXSA 1ZIPA 2FTKE 3EPRA 2OYSA 3L7MA 4GMHA 1ZKMA 4LJKA 3AONB 5BSVA 1W85A 4W9RA 3V1NA 4M0PA 4E2XA 4XKJA 2CW5A 3S6JA 5DM60 2OZPA 3ZZMA 2I4NA 3G2KA 1RXEA 1N2XA 1RMQA 2GO1A 1SR8A 3VKVA 2G1UA 4CI9A 3VO1A 1M1YA 1DQYA 5K4AA 1C8BA 2C3PA 5TE9A 2PLRA 3QWIA 2WSIA 1XLTC 1OC4A 1MRSA 4G4JA 1VLLA 3DAFA 1L7PA 2HLPA 3DZHA 5AUQA 2BM1A 1IXZA 2ZT5A 1FP2A 5HJEA 1XU7A 3FNGA 4MS1A 5C80A 4WZBB 1FFBA 4M0UA 1A5TA 1KVQA 3WAKA 4GMFA 2EKBA 2G9RA 1BVHA 1ZQ1A 3T3HA 2W42A 4MHTA 4YPVA 5SY9A 3ZDDA 1A9PA 4B8WA 4X3OA 3WWYA 1JVBA 3ZWKA 5EZYA 2YWRA 5DBEX 2E6UX 4L8WB 4WK6A 5FPYA 3RNOA 3SYRA 4F4UA 1DEHA 1OX4A 1XEXB 1ZCAA 2SKEA 1G6HA 4YMHA 1SZDA 3UAYA 3ESCA 3EUEA 1QIEA 4WLNA 2N1BA 3A28A 4LXGA 5KJFA 4ZCQA 4L4YA 4WACA 2L2QA 3GFBA 1JHYA 2O5RA 3VOAA 3HM9A 4BQPA 1PJ2A 2QYHA 5F2OA 4CV0A 3JASA 1ABFA 5K3FA 2ZUEA 3GA7A 2WA2A 4IQ4A 4TTVA 3IEUA 4L8VA 3THWA 1KO7A 3N39C 1IK4A 3O1JC 1E8NA 3QU4A 3SQWA 1UHTA 2V6BA 2V65A 1OFGA 3CISA 3CLTD 2BR4A 3QQ5A 5H80A 1NG9A 3AEKB 2XTJA 2DWUA 5KTSA 1BEZA 4PVDA 3JQAA 1YVRA 2VJNA 4I4IA 4Q1FA 1FB5A 2A84A 3LPMA 4QNNA 3HCBA 2I5PO 5DIFA 4LJ6A 1O96B 1J4OA 1CY6A 4JENA 4QEKA 3WLRA 2R00A 2NV0A 2VQEB 1RBYA 1OXXK 1Q0RA 3HVKA 3N8GA 3SR0A 2V6MA 4CG1A 4HT3B 4F7DA 1E3WB 2PS0A 3PXAA 3P97A 4QDKA 2DQYA 4RHYA 2Y2UA 5KHAA 4AY3A 4BDTA 1R0RE 4RF2A 4DUYB 4MKGA 3A4LA 4JKOA 4IG9A 2PUGA 3OTIA 4RADA 2VJLA 4FWTA 1NFFA 2HB6A 3FYUC 4ZANA 4JI1B 5JTTA 2Y1XA 3FI9A 1Q1QA 3NI2A 3CRW1 4GKBA 4KAAA 5K4GA 3GLKA 2IOQA 2YRXA 4B35A 3AESB 2I6QA 5HIKA 1XDDA 3Q3CA 5DBIA 1K7XB 2EZ4A 1VIMA 1KKLA 4G8CA 4BJ3A 1PQPA 1VKHA 1R88A 2KYRA 5DKFA 3UJ6A 2EFCB 2YJTD 5AVQA 2FGKA 1CLUA 3P9PA 1JVNA 3GDWA 4N5IX 4W1RA 4BMDA 1B23P 3WLIA 2ZI3A 3Q85A 5EKSA 2GAJA 4B34A 1R0WA 3G5TA 4BO0A 3DEFA 3HCWA 1I80A 5IMSA 2CF5A 1I2CA 3OOEA 1DIAA 2CEKA 3CZ5A 3NOOA 2YQZA 1I6KA 4AJ9A 4AT1A 3FGPA 4C22A 5CDTA 1FFXA 1EVKA 5LQUA 1US8A 4NAVA 1A5ZA 1DWOA 1L5WA 3EFHA 1SK8A 3O2QB 3T5CA 1ULTA 3AWDA 4Y1EA 2J9YB 2I66A 2OENG 4KU4A 1ULHA 2WTXA 2PDAA 1SKYE 3TZLA 5K8VA 4DIKA 1IAVA 1VIDA 3LUFA 4PZLA 3V4SA 1YRHA 3W7VA 1D2AA 3L01A 3G85A 1I7PA 3QENA 3AL2A 1L5ZA 4FFNA 4R98A 3WTBA 1UMBA 4ESVA 3PQ2A 5KREA 4ALJA 4FONA 3BG5A 3L43A 4GO1A 2XAAA 4I6EA 1IEQA 5COQA 1WF6A 3R74A 2O5CA 4QDUA 1AZWA 2O2CA 4B43A 2Q6TA 4B84A 4YP5A 2P6RA 4BS9A 4NKRA 1AF7A 1PZXA 1RMTA 5CIYA 4V0ME 3I37X 1QLJA 4PFSA 1H1DA 3CSSA 3TJMA 4R54A 4OHUA 1AXGA 2BKUA 2I4OA 4HLUC 4UAUA 1EZ4A 1BGVA 1P0FA 1M6VA 3ZC3A 5ENVA 1HL3A 5BORA 4GP9A 5FI0B 3KFLA 4HTFA 2GZ2A 4Z4CA 4NENB 3DCNA 1T1IA 4Q6WA 4CV1A 1CJMA 4TV8B 4X6LA 4AJIA 1VE5A 2GN0A 1DT3A 3HACA 5K09A 3ROZA 4IW3B 1CD5A 4KQCA 3CX7A 5MF6A 4G65A 4KXLA 5KX5F 5HVNA 4ZDJA 4LC1A 1CCWA 3WB9A 1ADJA 2AFHE 4G67A 5FLEX 2AZ4A 3H2JA 3NYQA 4RGBA 1NTRA 4ZQEA 2CCKA 4MUFA 5IEBA 121PA 3LT1A 1N3IA 3W6UA 2Q5HA 4UZFA 5I7VA 4JB8A 4XIYA 3RJTA 3GG2A 3OIGA 1SELA 4KO8A 1WZIA 1TTTA 3NWEA 1ZCZA 2BRUA 2H00A 3FPBA 5BN5B 1HSOA 2GM9A 5AVJA 3QFCA 4I55B 2FRVA 2ZB7A 4TLEA 1GU1A 2H4YA 3I92A 1AKYA 3WGOA 4FD3A 4IGKA 2ZSEA 1LNQA 1UJ5A 1WY5A 1NVEA 1X7ZA 2D06A 1NM5C 1NKTA 2X3UA 4JC4A 1XIVA 2B0JA 1ES9A 1JF8A 4LJSA 4EJ2A 2CJWB 1IIRA 1LJ8A 1EDZA 5F35A 2K7FA 1P0CA 5UKDA 3NONA 5BNFA 4PGHA 5DTJA 3CONA 4KO3S 1EH5A 5IASA 3DL4A 2G28A 1L4FA 1XN1A 3UAVA 2KB4A 2GXUA 4QUAA 1IPEA 1RRVA 3MCUA 4YDRA 1LLFA 4IEFB 5D3MA 1NBME 4CV2A 5K05A 3E22A 4MWOA 5ALGA 2W6QA 4KR0A 4YJ3B 3NCHA 4A4DA 3PC7A 3M1LA 3L49A 1NDQA 1XR3A 4IDBA 2XXAA 1JIIA 2BJVA 3AEXA 3JTMA 4LXTA 2FZ5A 2HTEA 2G5TA 3DT6A 3PUXA 4QPJC 4YFVA 4XUGB 4D8YA 2O2YA 4P5DA 1ZHHA 3SKYA 2EJTA 3BTVA 3GFRA 3I39X 3SHWA 2XDQA 4CODB 1L4MA 2AF3C 5BQ5A 3K0CC 1QV9A 4PYQA 4UU8A 1KFCB 1ORRA 2BHRA 5EJMA 4R1TA 1Q7GA 3E7XA 1WKBA 3W5VA 3SHQA 1CVRA 3VV2A 2VT2A 1O2DA 3RREA 1H2XA 5TGDA 4CIXA 5IM4F 4QYSA 3MGAA 1CXZA 3LYLA 1GNTA 1HBJA 1N2ZA 1X80B 3KYJB 1GFZA 3ND6A 2VJQA 4JYPA 3ZJ5A 3MWDB 4AJEA 1WXHA 3PNLA 3UW3A 1T0HB 4NF2A 1ISFA 1HKHA 5DOVA 5MGBA 2QTCA 5H3HA 5L7TA 2QR2A 1DQSA 1L1EA 4MAAA 4QOIA 4EGJA 2NZWA 4KR3A 1J09A 1OWNA 1R1DA 4XVUA 4MICA 4ZQGA 3IEIA 3QTTA 3QG5A 4DMFA 1EZ1A 4ARAA 2I4IA 4RPJA 2BGTA 1V95A 4RJTA 1QUFA 2J85A 2YZNA 3DTVB 2M1XA 1Y1QA 1MTOA 3LUPA 4J29A 4NH0A 3IBFA 1RLMA 1ZN2A 3KWJA 1S7GA 3OT1B 1CYEA 4MVJF 1OROA 1SKMA 1W34A 5FUWA 1FP6A 2QUAA 2PJRA 1H0KA 2C83A 3AW9A 1KZGB 1NW6A 3PUZA 4FNAA 4K03A 2PUBA 1AV6A 1DIHA 3OQOA 2O2HA 2B61A 2HA2A 1VJRA 4A36A 2QZZA 3JQAD 2XCOA 4ZV9A 3I8SA 3THYB 4QSHA 3DEAA 3BJMA 4KK3A 3NJ8A 3V4PB 2D3TA 1U94A 1IBSA 1A4RA 4WCVA 3VAZA 1OI4A 2DC1A 4JS0A 2NP7A 3P5SA 3LKDA 3NM4A 4Q15A 1G8GA 1XZCA 2FOLA 3NYRA 2H9IA 4KODA 2PKWA 1GLGA 3P9NA 5HEKA 1AKQA 3ECSA 3WE7A 5DNYB 1O08A 2CK3D 4DSOA 4NECA 3OLCX 3QLUA 4OA8A 4BQSA 2PMCA 4DV3B 1NJ5A 3AFMA 1T8WA 3ASUA 4DLWA 2VPTA 3NJRA 4ZPJA 2CL6X 3DBOB 3RS7A 4DRYA 1QDUA 4ZHQA 1YRLA 1Y9ZA 2IRWA 3EK2A 3RGGA 2JIDA 2VDWA 5BUQA 2ZUFA 2BFMA 2VDKB 4K9NA 1KI2A 4FKZA 2Z8YM 1AQJA 1O9HA 2AR9A 2RIPA 1IBRA 4YYEA 4I55F 2XUZA 3T7AA 3HMKA 2P9CA 3HCFA 1QQ7A 4EYQA 2F8SA 1PQYA 3C6YA 3CNNA 2Y0DA 4JI4B 3H75A 1PWEA 2O6HA 1YZVA 1M2GA 1UXOA 2QAJA 1DXQA 1R0KA 5BV8A 2D2FA 2UYYA 2W0MA 1K3NA 2EERA 2FR8C 2X77A 4CTMA 2YOFA 3O8CA 1OCEA 5AKZA 5JY1A 4R9NA 4N4AA 2ZPAA 1NQTA 2RHRA 3KM0A 2BHNA 1P0MA 1L7AA 3LRXA 1OH6A 1DO8A 4P38A 1KQNA 3RVMA 4IDFA 3O2JA 1GLVA 2XBLA 5KOHB 5SYMA 4ZO6A 4P08A 1E0SA 2V9PA 4I1VA 4U2BA 1KOLA 2P9QA 1XTKA 2Q4RA 3ZWDA 2P75A 2HMAA 3VC3A 1JFFB 2ZBDA 5AIAA 4ARBA 4WUVA 3JQQA 2WHQA 4BGVA 3G0DA 2D74A 5CT5A 3M5PA 4UOZA 2O1SA 3HVUA 5TDHA 1O95C 4WKBA 5FULA 4AMGA 2UZ3A 3BT7A 1XCBA 3RKSA 1XVIA 4HX2A 1OVGA 1YHYA 2Y1LA 4N54A 3B1WA 3GFTA 2JHGA 4TSFA 4ITVA 2DBYA 2QP3A 4IUDS 4DQKA 4EJ0A 2ZPUA 2XUJA 5FPHA 5BOVA 1V7PC 1UPTA 5ESXA 1YZKA 2AI1A 2Y1DA 2ZRHA 1ZX1A 4FJ2A 4FWBA 1QRDA 4CKXA 1M2KA 2INGX 3ZLJA 2RKBA 3TR5A 2NU7B 3EEFA 3M9LA 4TLBA 4BZXA 2X8BA 3BIOA 2BIFA 2P3OA 3UBTA 1S1MA 4PXYA 1QHNA 2KLHA 5DNAA 3LY8A 3N53A 1A76A 3LHFA 3CLKA 2DY1A 1MOSA 1Y6RA 1J9ZA 1B8VA 1ZITA 2BM8A 1DKMA 1FC0A 2BZGA 2OBXA 3DBVO 4HQOA 3VBCA 1IOWA 5CURA 2J3IA 3UWDA 1JVSA 3E3NA 4RCZA 1VDMA 5KJ6A 1XZIA 5AJWA 1QG6A 3MELA 4C6RA 4H4DA 1AGPA 3NP7A 1IM5A 1A2OA 4AWBA 1BWQA 1RYNA 1Q16A 3GQVA 4WZ6A 3MRVA 3WL8A 1YZFA 2B8TA 3OX1A 4Y2TA 4DTIA 1NT2A 4B46A 2BI8A 4DLLA 3GPLA 1HV8A 3BICA 1GILA 4RPHA 5L40A 4MV7A 4BY9E 4HL6A 3K0FB 2OCPA 5EJ4A 4DM3A 3F6EX 1OBVA 1IK6A 4WK0B 2QQFA 1EXDA 3TR6A 5CX1A 2O2GA 3ZBQA 1LGPA 1T6XA 2LZ0A 2RGBA 3OPNA 4BMSA 3IKLA 2H5LA 4M9RA 5AM0A 3TDKA 2WQ7A 2BGWA 3F5QA 3GRAA 4OM7A 5F73A 7REQA 1Q7TA 5JYDA 1H2AS 1VMAA 3D6JA 4M7OA 2O05A 2QYOA 4ZI7B 1XMSA 1YL5A 3LH5A 2B6HA 1VJCA 3IP8A 5ALSA 1ZOPA 3WYCA 1NSTA 4UXHA 1HH4A 2AB0A 2FEZA 2QRVA 1GRVA 4I6JA 4PG4A 1ML3A 5FUQA 3O2NA 4IDCA 4OQNA 2PSHA 2XDYA 3GD7A 3EXG2 1YXMA 3UAXA 1AIPA 2ZKLA 1A98A 4OK6A 4X91A 4ND5A 3EWNA 3LUJA 4XLZA 5DBFA 3VU0A 2YFQA 1BXRA 3JARB 1Q1BA 4BNLA 3DYBA 1L4YA 1U9CA 4FDUA 2JJQA 4JLKA 4TS4A 4RW0A 5I7FA 1EQAA 1QVZA 1JT9A 1UKEA 2IOYA 2CHFA 3KTAA 1WXXA 3OOJA 3O8OA 5BNIA 4XFKA 5LVAA 4C07A 4QGSA 4G5OA 2FQWA 4Z9FA 1GUZA 4EA6A 1G5IA 3FDZA 4P31A 3KIPA 2O4UX 4Z0TA 3R3ZA 3E03A 1D2HA 1C1XA 1HLDA 2ZWMA 4O2BA 5HKLA 1WXWA 2I1VB 4KVAA 2IHZA 4JYAB 2F1KA 4LF9B 1AJEA 2WIAA 1ESZA 5BURA 2AC7A 3IQZA 2GAIA 4BXOA 1ISHA 3UN0A 2Z8ZA 3WSWA 2VDRB 3GXBA 1AMNA 4DA0A 3CH7A 5EL0A 1J0XO 3NBZC 4IIJA 4KZKA 1YMVA 2FZVA 1D9XA 2OV3A 2R8ZA 2PT9A 3BSSA 3E61A 3FDJA 4PICA 4PIMA 5JFGA 2J7PD 2M1ZA 2Q9AA 3WGZA 3FOBA 3H2YA 4G1EB 4LK2A 3O8OB 5FLKA 1N8KA 2AWOA 4G97A 1E9RA 2K4MA 3R7LA 4BFCA 1QIKA 4CWAA 5DYTA 1JWAB 1NBIA 4B3XA 1XG5A 2X4DA 4RGQA 1BMFA 4DSZA 3HCNA 1H94A 4P8RA 4DWOA 1UP4A 2C1XA 2MSNA 3LFUA 1TJ4A 1MA0A 5DCYA 3NNSA 1QIFA 1WPXA 2QHXA 3I0ZA 5IFLA 4IIHA 1LX6A 1AHIA 1SKYB 4PC3A 4C20A 3I2FA 4CKZA 1XJWA 3O74A 4X85A 4DC1A 2P4UA 1IY2A 3EVNA 4F11A 2VNJA 3T15A 4ALKA 4H1HA 2AW5A 2EBUA 3AI3A 3H84A 4D0GA 3MWEB 4DZRA 1JHDA 4YP0A 2F1IA 5D5QA 2WI8A 2KFUA 3GEIA 4KNWA 5KVAA 3EXEA 2B8EA 4HEHA 1N6OA 3Q2IA 4W7IA 4D9EA 3LT4A 4M8LA 1BW9A 2M6RA 1YRWA 4V38A 4D82A 2FSSA 2G4LA 5CX4A 4MQEB 1I30A 3B2QA 1GV0A 3B8HA 2TMYA 5BN3A 5JJCA 2HYIC 2OK8A 1YCHA 4M7RA 2XXBA 3JWHA 2NW6A 3B5IA 4EVRA 2VP6A 1TL7C 3E2PA 1RC0A 1I3MA 2PL5A 3IAUA 1O3YA 1PTJC 2A0YA 1I4DD 2NXEA 3ABZA 1F7VA 4I9NA 1GJRA 3DWGA 4QDTA 4XCQA 1ODSA 4PCVA 4EITA 5JZBA 3NHJA 2F17A 4F3NA 2NV6A 3TDNA 1O6BA 2A59A 4LJ7A 3E58A 3R6WA 5LQMA 3OZAA 3TI7A 4K40A 3H3FA 1G8JA 2V0CA 4MZDA 5IFKA 3FI0A 4UU0A 1GPMA 1I1NA 5JFOA 4QO8A 3COSA 2JAQA 3IDQA 4CN9A 4I08A 3QUBA 2IXBA 2JHFA 1SUFA 2HWKA 3EWSA 4G1FA 3S99A 3RB8A 3YASA 4CKBB 4RLHA 1CFZA 3T7TA 2AFFA 1IXRC 3HMQA 5ALWA 3IALA 4BLTA 1NMSA 4Y0AA 4YMIA 2BFOA 2C5AA 3O1LA 5G1NA 1K8QA 5ALUA 5AVOA 4D4KA 3ABQB 2QVYX 1E3TA 5C7LO 3ETEA 1ODJA 3HUUA 1YJBA 5DASA 4QU9A 1CJBA 4L3OA 1E3SA 4R7GA 4WZAB 4D3SA 2EZTA 3TOVA 1BC5A 3ISVA 1H66A 4GQAA 3OZSA 4L6IA 5F33A 3VPCA 5ALQA 1A9YA 1FTNA 4UNNA 3ROQA 3MS7A 3IUMA 2YWXA 1NBAA 2CYCA 4RVNA 4AMVA 4EM6A 2RGXA 3ZGNA 3PB3A 3D3EA 1N7HA 3PTZA 1YDHA 5A6SA 4H4CA 2F9LA 5DX0A 1MEJA 5AUOB 2ZYGA 1ECJA 1XP5A 3UIEA 1NJ1A 3K8YA 3DBLA 3RABA 4C9BA 4IIXA 1A82A 1WU8A 4JJEA 1YZ3A 4OHRA 3GVCA 3N0VA 2HR1A 5H16A 3EOBI 4HDNB 3ZCVA 1PCXA 5BN1A 1YUNA 2NX2A 3G8CA 2AA3A 3R3JA 2IE0A 1WVGA 4LKRA 2JJYA 3EF3A 3SDBA 4PSKA 4YJ2A 2I3ZA 1XD2B 4YPOA 2VZ0A 5L4LA 1RRMA 4KE6A 3KQTA 4DL9A 5CHEA 3GVXA 1L4UA 1TQDA 4ZOCA 5LUBA 3RSZA 3UWPA 2E49A 1IRIA 1PDOA 2J9RA 4ND2A 1B74A 1P6UA 2ODBA 1PV4A 2CJPA 3RVNA 2B3TA 4I4TA 1I01A 1PW7A 2B8WA 1RHUA 1WV3A 2QM7A 5EWLB 3RS5A 3VR5D 4Z2AA 4C03A 4RK7A 4JJ8A 4BQQA 1ZI8A 1V41E 2PIEA 1Y7HA 2G0AA 5A0FA 3VPHA 2QTNA 2DUJA 1TEVA 2YS6A 3CLRD 2DUUA 3AF5A 3H2GA 3GLIE 1VCHA 3IOEA 4DNXA 1Z8DA 1BS2A 1KXJA 3AHHA 2BBOA 2YWBA 2JS7A 3GJ0A 1CY7A 4RZUA 5JPDA 2VNAA 1IN1A 1KH2A 1PQ4A 4EPWA 1N25A 4F46A 4YS6A 1M8JA 4P4TA 2UZIR 2RJOA 2IYZA 4JEHA 4NU6A 2ZUVA 3RBVA 1WXDA 3T8YA 3UCFA 4BLPA 2XPCA 3IB6A 5B4VA 4LXIA 5BW4A 3TLAA 3PFFA 1QH9A 4HAUA 1M6EX 2AW3A 1UZAA 4HLNA 5E6RA 3T7SA 3LQFA 1L0BA 2QMQA 3UMZA 3QKWA 1U8XX 4M87A 1C3OA 2IYLD 3MT8A 4J0FA 3WQSB 4EHKA 1ZH2A 2EIXA 2IUEA 4BOYA 2OLJA 3K8ZA 5FHQA 5BUCA 3VDMA 5C32A 5KOJB 4RTOA 4YIKA 3KQHA 1XZEA 1EK6A 4XVQA 3S3TA 1XZLA 1Z4KA 4DKXA 1W48A 2FH5B 2D0IA 1BXGA 3ZU4A 4ZYYA 5AOCA 5P21A 1JEAA 3TSZA 5A04A 3JSAA 2WNHA 1T36B 3AJDA 4E88A 4Y6PA 2HJ9A 5JJ5A 4LE2A 3SOZA 1E3WA 2Z2ZA 4I9FA 4TL8A 4KPFC 4BNUA 3PO8A 1XVLA 1QGDA 3CNQS 3LP6A 1OYYA 1N6RA 1S4QA 3PEUA 1KMIY 3FN4A 3MCAA 4LNHA 4EMUA 5F76A 3FMIA 3D5TA 4QQFA 1KYIA 4R9SA 1Y7PA 2L69A 4H7JA 3W4IA 1EI9A 1EAYA 3VAYA 4MUIA 1FUUA 5K0TA 1HF3A 1T6YA 5E7QA 2GZ3A 5JXWA 3CRNA 1K7CA 4BKUA 2HQSA 5U4QA 1GT6A 2DBVO 3AEKA 3LO5A 4LC0A 5JS1A 1DDIA 3R20A 4LA4A 1BZYA 2NZXA 5JS8A 4PHFA 4ZXFA 3UNXA 5DXFA 1L4NA 4BUJA 1BH2A 3GEHA 5K3FB 3H16A 4AIIA 3ZQJA 4H6VA 2HNAA 1C0LA 3PPVA 5FNVB 1JG2A 1G2QA 3PV0A 4DLKA 1PD0A 4V1CA 3A3KA 4FNOA 2JHPA 1K2NA 2XTZA 5IH3A 3SYKA 2I7DA 1JT2A 4DLVA 3U7RA 5AVWA 2VQSA 3UWKA 1RRKA 1JG6A 1X1CA 2PYZA 1KFJB 4PNEA 1OT5A 4EX6A 1L5VA 1VFPA 3FTQA 3P0FA 4L78A 3WNZA 3PDIA 4WKNA 4OJQA 1GTRA 3C3KA 1OFHA 2Q1XA 3CVJA 4QEZA 2CYAA 2YWJA 1T24A 3R6DA 4HNTA 5K0FA 1RAIA 5KDDA 4EGFA 1NOIA 1WLSA 3NWOA 1Y81A 3O93A 1D7AA 2Z2IA 4TMYA 3ZZUA 4EECA 3LRTA 3QY0A 4J0IA 4EX7A 2GJKA 3ELDA 2A9VA 3CZCA 4LBYA 4M0FA 1EUDA 4XR9A 3SIRA 3BXEA 3IJEB 5ECGC 5TRTA 5E3JA 5IRCD 3H1EA 2OHVA 1TUGA 4R3WA 3S1SA 1CTQA 3HK2A 2HH9A 2YBDA 3M6LA 4F04A 1GZ5A 3GGPA 1U9JA 4OQXA 5D5HA 4QASA 4BMOB 1MB3A 4MLZA 3WVNA 3NV9A 1Q21A 3AQIA 4LDQA 4XGRA 2GEDA 3JYOA 5T8KA 4DA7A 5J4KA 3VISA 1TAUA 1NQVA 1R8SA 3WNQA 1M75A 2IITA 4LSWA 4NPAA 5GZ6A 4DJDC 3W8FA 3ZXIA 4QQKA 5ALVA 2CSXA 1L6RA 1CR1A 2IU4A 4HTFB 3T9BA 3WKCA 4BP1A 1U2TA 2J3KA 2QSUA 4P3YA 4WLVA 2NMVA 1J8VA 3NHFA 3PFCA 5L3RA 5KPDA 3EGCA 4TV8F 3Q8MA 4MQFB 1OT3A 2AEMA 1XEFA 2Q5CA 2UVPA 4H3VA 4WQMA 5AK4A 1TO1E 3ROFA 3KUUA 3K1JA 3DEYX 2FN9A 3H18A 4WZZA 3IV7A 1NHWA 4NK5A 3RE1A 4LNAA 4REQB 4N82A 5D3ZA 3G88A 1PWHA 2A5GA 3JW8A 4IS2A 5GIOE 2PU5A 1Y33E 4AJ2A 4L1KA 3ZD9A 2J3EA 3HJAA 5FWYA 3MLBA 5CK5A 3FHOA 4UMVA 3DKVA 1OGYA 4QGHA 3D9QX 4WRRA 4KB5A 1LZKA 3DWEX 5TVGA 2JH8A 1NPYA 3JD3A 4IQFA 1CNEA 5HK8A 2HSWA 3A6DA 5F4BA 3FJ1A 1N2CB 2FFBA 3KPYA 4N3AA 4OP2A 4PPFA 1U7UA 4E0BA 3DSHA 3L9WA 4BPBA 3QPAA 4WXRA 4BVLA 5DNVA 4IUYA 4J2OA 1FFXB 3PX3A 1CEYA 1OAAA 1QCZA 1XMVA 4KNVA 1SZCA 3CZAA 4B6SA 3KE9A 2CFSA 4JJIA 1D0IA 3RO7A 1WABA 5GVSA 3EA5A 4MKHA 4NMLA 4O63O 2JF0A 1UK7A 5JNRA 2QENA 3GXOA 2IXTA 3IIKA 3R1IA 1IZZA 3PHLA 3OZIA 3O82A 4KE9A 1PUJA 3LK7A 3AHFA 4Q48A 2P1RA 5CA0A 3WV4A 1Z17A 2B1RA 4ZZ0A 2GILA 3L7YA 2OQRA 3LDFA 2ADFA 1I4LD 3VKUA 4MIKA 1WULS 5A3QA 3AIKA 3UXHA 3IVMA 2DERA 1DBQA 5D86A 3R7SA 3EZXA 3KO8A 1U5AA 2LC1A 1U7PA 1J24A 1K0UA 5CAEB 4CT5A 1RT9A 4BRWA 1RWVA 4F3YA 4HC4A 2ORED 3O4IA 4AP5A 3CUWA 4RZ2A 3GBVA 1MHPA 4O25A 3LW8A 3JWPA 4F60A 4IEEA 2PGOA 1H9BA 1ZA1A 4Z3DA 4J4HA 3SX4A 4V1CI 2FFHA 3HWX1 5KCZA 1JAXA 1DJPA 3INTA 2OO5A 1M76A 1KRWA 1M5UA 4AWAA 1X8XA 3FW1A 1IJKA 1XTSA 5TY0A 3U48A 1APBA 1QH1B 1G2PA 2NUPB 3EY9A 2E4VA 4GPZA 3RARA 2DFKB 3W2TA 4CUJA 1EK5A 4H27A 4HWSA 3M82A 2VTEA 4IKPA 2WWXA 4ZARA 5B30A 3JD1A 2GBPA 3QUAA 3I1YA 4RV9A 4A15A 3AKCA 3AILA 4PLCA 3JY6A 1RHRA 5E4JA 1XN4A 1JQKA 3CF4A 3GJ5A 1P6XA 1K7EB 1RAEA 3FM8A 3ROKA 1QH1A 3STHA 4YUZA 3QGMA 3DNMA 4WN9B 5KYVA 2HK8A 4QCJA 4BWGA 3HSKA 5DMXA 1YFKA 1DE0A 1F4PA 4PPNA 3NC0C 2P9FA 3SSMA 3TDMA 2OR3A 2NQTA 4RVOA 5C5CA 4PRZA 2N42A 2UZAA 3FG9A 5BRJA 1JEYB 1QZTA 2Q5LA 3D0RA 1CQXA 1VYUA 4LRTB 2PT7A 4PFJA 1K27A 3O5AA 4AXXA 2VWGA 3G2LA 1TZMA 3EQ9A 1V8BA 3L0BA 4YP6A 2ECFA 3F7NA 3KUKA 3OT5A 4DDHA 2GEFA 521PA 3QLTA 4BMCA 1VL2A 3QYPA 2GJ9A 2VNKA 5A3SA 4DBZA 2F7SA 1F2UA 5HKAA 1TU0A 1W4RA 2QMOA 2RDMA 2HHCA 5K3EA 2WTMA 2CZGA 2DUNA 2V6JA 5BWMA 1SY7A 4MUYA 1ZGZA 1NNUA 1T91A 3R6LA 3ZHVA 1E2FA 4EL5A 4A2QA 4FLFA 3MYRA 1DKRA 1JIUA 4FINA 4BJHB 1CY1A 2AJ8A 2E5WA 4HDMA 1MO5A 5HUHA 1TB4A 1VBMA 4GYJA 4YGYA 1TF2A 2F3UA 2J9FA 1GRRA 1OOEA 1E3IA 2P9JA 4Z0NA 2H5EA 1B3RA 2HA4A 5LUAA 5IK2D 4KNYA 1E3LA 4RJKA 1P2UA 3FAZA 1U3UA 3TMAA 1QP4A 1CW2B 2JLUA 1T3LA 2FY8A 3BSWA 3ZV7A 4DRXB 4M1OA 2OEPA 1IQ0A 3PF8A 2YYSA 3GARA 2Z57A 2AOWA 1UBTS 3AC0A 2HJWA 3LYUA 5DGCA 1W36B 4H7HA 1IOLA 1D2RA 2BFDB 2ZRQA 4UFNA 5D7NA 4A27A 5DBHX 4F56A 4HFMA 1AKTA 2PCLA 1OLUA 1DCMA 1FRQA 2WJYA 4XVRA 4C7XA 2ZSAA 3F8WA 1J49A 5JANA 4IIUA 1SPXA 3RHFA 1E2IA 2NYRA 4LK3A 2DEUA 1ZD1A 1A8IA 5HG0A 4EG4A 2C9MA 1E79A 1J42A 1T2AA 1RACA 2FQ1A 3GNSA 3RFVA 5U9CA 2XRYA 1XE3A 2WAAA 3OX3A 2QN3A 3IPAA 4MPPA 3CNHA 4TV9B 5HM8A 3JTEA 3ANMA 3MD0A 1H6CA 1ORDA 2C5FA 5DRYA 2LW7A 3KLNA 4EW3A 1TU4A 2I6FA 2IP4A 2BR5A 4DIBA 2QP4A 2J07A 2GRAA 4TQUS 1C3EA 2PX3A 4PCLA 4UE6A 5J5VA 2QQ0A 2V7QA 3W5AA 4DUZB 5AKGA 4DLUA 1T5HX 1A8HA 1X0XA 5K8UA 3KB8A 3VSBA 2HY7A 4L5IA 3WL5A 3TRJA 5C5DA 4KRXA 4HAWA 3TW0A 3UFXA 2R25B 3KHKA 2X2EA 3CPHA 5I8PA 4N48A 5D01A 1X1EA 3FRIA 1EWTA 3R7DA 1GCOA 3MUFA 4AICA 3WBBA 2ZT6A 2OHXA 4C3OB 4M7PA 3DTNA 4B6GA 4GH5A 3FLAA 4X6UA 1KJZA 1DC8A 4EB8A 2EP5A 3H0CA 1BKYA 2GK3A 2V7TA 4QWMA 2ZWAA 4HLDA 3O9VA 5C4MA 3IP5A 5ITWA 3FTFA 4Q37A 4CZ2A 1KSFX 4G0YA 1U0GA 4P4LA 5AJVB 3U19A 4IJUA 1DBPA 5C18A 5IZ4A 4UPVA 4EUHA 5ER6A 4Q4AB 2FG5A 1F7UA 5LKAA 5JSFA 1MB0A 4ZO7A 5C4IA 1VLQA 3I9LA 3PLRA 1B15A 2DFPA 4K5QA 4UTXA 2LGJA 1JKJA 2AN3A 3A4TA 1G5RA 3F6PA 1OJLA 1M1UA 2AZMA 2ZRBA 3AEUB 5HQTA 1M2JA 1NF3A 4F4DA 3EIUA 3G2JA 4GKAA 4OLFA 1YZQA 3NHKA 1FX1A 2HMVA 2PWPA 5IXJA 4OFXA 4KUHA 4JWKA 1RXCA 1ONSA 3QMPA 3WGYA 1U80A 2FZLA 3CSUA 4JIWD 1WZUA 3K31A 4OH1A 4OXKA 5AVKA 4PHTA 3VDXA 4I99A 1T9DA 3ZHZA 3EZYA 1K92A 2QDKA 1SEVA 4B0PA 4L5AA 1RQXA 4FT2A 4DB2A 3BB1A 2GD2A 4NX2A 3KBOA 5IT5A 4YECA 2Z4SA 1IN6A 1IHPA 2JGIA 4AJLA 1NULA 3RVQA 2ZTHA 2W4MA 4HOYA 4LOKA 4FXOA 2B2CA 4OSOA 4AN1A 4DMCA 1KQ3A 3USZA 2VBFA 4EYOA 4CQLB 5ELXA 1V5FA 3ADOA 5FEUA 1T2FA 4M46A 4ZOAA 1TCAA 5JMTA 1F5NA 3DDOA 3D7NA 3EG9B 2QW0X 4O59O 4X64B 4YV1A 1KYVA 1R2QA 4N49A 3CZPA 1BXGB 2X9GA 3MCWA 3H6KA 3P26A 3RIGA 5IBQA 1CPYA 5HS6A 3FNHA 4CKCB 2AVDA 1Y42X 3GGDA 4LPKA 4QM7A 1Q6ZA 3AY7A 1YIOA 1RKXA 1CUIA 3OJOA 4ISBA 5C8YA 3V55A 1P3JA 2C3YA 3BH6A 3OAAD 3HR7A 1YB5A 4PAOA 5LYJB 5DYIA 1KIMA 3RS9A 1TKRA 2BEWB 4IR7A 1ZNXA 1G3UA 2P1DA 3JQCA 1JX6A 4O08A 4RKQA 3IR6A 4RYLA 5H3LA 3P71T 2FSVA 2B2NA 1PHPA 4HDOB 4JFAA 4OIMA 1NRJB 2DQZA 4ZVMA 1YL7A 4RA9A 3K2EA 3DEKA 4YMUA 1NNEA 1RJDA 2C94A 3CBGA 3LFHA 3PC2A 1OLSB 4GGMX 1RBQA 4H2DA 4ZQFA 5REQB 3WXBA 4RK5A 1H2HA 1JP7A 2Q3LA 4C0LA 4JQCA 1E6KA 1BEUB 3IJRA 4OLJA 2OXEA 4XASA 2DFNA 1A9XB 4Q9DA 4HWKA 3B1YA 1XEWY 3BQMB 5EVJA 3S5UA 2P3LA 3UXYA 2D8MA 2EFEB 4MQMA 5DHQA 3GAFA 4W8HA 1J2YA 3JAMA 1TTHA 4Q3OA 3TUZC 2GGSA 3QKTA 1RWNA 3BZWA 3QKSB 3NO4A 3OE7A 1G20A 5B57C 4B3FX 3TI9A 2FGJA 3MM4A 1JYFA 1U3VA 1U0HC 1UQRA 2BGMA 4L76A 4EUSA 4WOBA 2C2KA 3ZWMA 4KC0A 4FJ0A 1YJ8A 3CH5A 3OQJA 1EDOA 1Z2DA 5CDFA 1NURA 4S1WA 1MC1A 2FI1A 2OPHA 2JBWA 3HV0A 2WIKA 2FPMA 1UP7A 4RQUA 4HWGA 3W6OA 4KIJA 3NB0A 4NCKA 3SZ3A 1QB7A 2O23A 2YTZA 3QELB 4PHGA 2OCBA 3P27A 3T5TA 3NKVA 2Z0MA 2D59A 1Q12A 1VCOA 2GSDA 1XSEA 5JVDB 5A6VA 2SKCA 3PRYA 4KXNA 5I8ZA 1BN6A 5EJ7A 5BUZA 5IX8A 3OZTA 1A4IA 1IDN1 2IELA 4GZ5A 1GADO 3TYXA 3EZFA 3FYUA 5JELA 2MINB 3N7TA 3MJDA 4YYZA 3HRIA 3RHTA 2KE5A 4FGZA 3HX1A 4IXTA 4GOMD 3UOGA 5LQRA 4YDSA 2CLKB 4JOCA 4PLVA 3GEGA 4REOA 5BNZA 2XXJA 4KJXA 3R23A 5L45A 1J25A 2QIPA 2PANA 2H18A 4IGEA 1P60A 1T0UA 5KNDA 4QULA 2Y67A 1QG2A 5JSZA 4QJBA 1J56A 1ZONA 5G3YA 2AH5A 5L7YA 4DOMA 4F84A 3L5OA 5E4FA 2OBYA 4GYWA 4KQ9A 1TT7A 1U4NA 3NM6B 3K1AB 2FHSA 4FR2A 4PR3A 4Y2JA 1NWHA 2JFXA 3AK4A 3C6QA 5BPHA 2HBZA 1B4DA 4MUJA 3M6MD 5G02A 1U6IA 4H3SA 4YV7A 2REOA 3QHAA 4RK6A 3OFKA 4J6EA 1UT5A 2IBSA 1RTKA 3D0OA 3MUOA 2WTUA 2A5JA 4G0UA 4N0PA 1ZMTA 4HDRB 4RGVA 3UMMA 3T3OA 2WY2D 1JI3A 4X1IB 5BRAA 2A0XA 2GZ1A 3NTRA 4KQ6A 3LQQA 2F4NA 2QV0A 3KQPA 1W2WB 3VHRA 4ER0A 1U1GA 3UJPA 5BOSA 4OHBA 3DE2X 4TTIA 1Y3AA 4LVNA 3LM8A 4W5NA 3WMFA 4BEVA 5G0SA 2BKEA 1RYFA 4A16A 3SJAA 1DWQA 4X90A 5IANA 1IG3A 2JGLA 2PHZA 2KBEA 3DR3A 4BO9A 4YQFA 5EJEA 1MH9A 3K71B 1Z15A 1EGAA 5BN3B 3W7BA 3RRYA 3SFZA 2ZSUA 2A9PA 2DT8A 1Y9AA 2GWHA 3O4HA 2O8CA 3LTEA 2FRXA 3TPFA 4CF3A 1VM6A 4QG7A 5MGNA 1XYGA 4JONA 5K3BA 5F7XA 2XT6A 5DNCA 2H8KA 3FD8A 3FCCA 1EQUA 3GGOA 4WY8A 5JNSA 4DEXA 5K6RA 2P8SA 4B71A 2D2EA 2D5AA 2WWHA 3MWFA 3PNMA 4B7AA 2XRZA 1DCTA 3FHTA 4HDSA 3DULA 1RXYA 5BWBA 2QVXX 4TOIA 2GJAA 1JEDA 2QT1A 3VJRA 2CUKA 2J4CA 3NKFA 4MS3B 4G0XA 5LZ5A 4LJRA 2OAEA 2XCUA 1FMFA 2DU8A 1GFWA 3BD9A 5FD8A 5I4IA 3PGKA 4YJKA 1NWCA 2XGGA 1NUPA 4ZRDA 1CS0B 3CR8A 1IULA 4OREX 5LLDA 4NFHA 5I9LA 3TTUA 4Q93A 4XOIA 3SM3A 3T5AA 5HX7A 3KR2A 2C77A 2WPDA 1IQRA 4AURA 1TAGA 4FFPA 421PA 4ZGWA 2HT1A 4R69A 3GUYA 3KOWA 1ZOIA 1TE2A 2EEPA 4KTTE 5A71A 1OXTA 1GARA 1QHHB 3FF1A 1DEAA 2Z2KA 3PXUA 4JBHA 5DW0A 4DQUA 4YRAA 1UDXA 3M49A 4QYIB 4MB0A 5BXYA 2ENUA 1YSCA 3JYLA 2GSWA 5J58A 3E1KA 4I5GA 3AFOA 1W52X 1YQGA 4MLDA 5HFJA 1MJHA 1P2BA 3BXPA 3HLTA 3OJFA 5JVDF 2M6KA 5A3RA 4LE0A 5EGSA 5J5AA 5JI3E 3AERB 4NFYA 4KQIA 1YK1A 2Q27A 2VH2A 3CG4A 1FVFA 3BFPA 3OWOA 3PD1A 4CG0A 1E92A 1O6FA 4BQIA 4NZYA 3E3AA 3ED5A 1D03A 1MRZA 1MO2A 1Y8QA 3IC5A 4R1OA 1RW4A 4PEVA 2V9CA 3K2BA 3DE7X 3BEDA 3FTCA 3HLKA 3KB6A 3UGTA 1V8PA 4JUBA 1MN6A 1B0ZA 5AICA 1MPXA 2JLSA 2PYDA 5LDHA 2FPSA 3DKPA 1QNLA 2IOHA 3JARA 1HFEL 1FBTA 1SXIA 1Z73A 2C59A 4WERA 1VKOA 2C4MA 3SJBA 2I2CA 3ZXUB 5ICEA 1Z0FA 1Y1LA 1AK1A 4BWVA 2WBLC 4KAXA 2ZE6A 4C1NA 3BGOS 4H7FA 4XGNA 1DV2A 1SGWA 4QGBA 1VKZA 3D1VA 1W8IA 3FRHA 3WKDA 2HF7A 4OXNA 4ZVVA 5LB2A 2RGYA 5DTEA 3OO1A 5EE1A 1H5UA 2R7AA 4MKRA 3R6TA 4Z4QA 2PK3A 3U31A 1EG7A 2ATXA 3DP9A 2V45A 1W9HA 1DEXA 2GD0A 2IYRA 2ZAMA 2C97A 1RXVA 1WZNA 3ZEAA 4PQEA 2E1RA 5KB3A 2X2FA 3K9NA 4KO1S 2Q1UA 4YAUA 4LBWA 4YJHB 6ADHA 4DAOA 2XCTB 5EYPB 4ND8A 3G8YA 2GCIA 2WD7A 2PBFA 1AXRA 4MPDA 1IJFA 1YWGO 3BCUA 3E48A 1MHTA 2JVIA 1ESMA 1MGOA 2VKQA 4FMCF 4PX9A 1JHOA 5HFAA 3ZCRA 2PX5A 3QKIA 3TW8B 3F9IA 2DH6A 4XWWA 1XBTA 1A9OA 4ND7A 3RSSA 3V1LA 4FFDA 3ZHRA 1KQPA 2VBIA 3N28A 3N8KA 5HKBA 3ELVA 1F48A 3WWOA 3ZWNA 2EX1A 2NAFA 5C7IO 5CVJA 4P1ZA 1NASA 3TRDA 1RWPA 4CQLA 3GLHA 2HREA 3IHLA 1IB0A 1GYRA 1KDOA 1PDVA 2ESRA 2NU7A 3H9JA 4FHFA 3URMA 5KSZA 1PT5A 3ZGXA 3AYXB 4UBOA 1F8YA 1RC1A 4HN4B 4R0MA 4XYLA 4XWKA 2CBXA 2I0FA 4NNOA 1EFLA 4OB6A 3USES 5KSPA 5FOTA 5ANRB 3WBKA 5DJOA 2KPOA 3SY8A 2COKA 3PVSA 3T5DA 2P91A 3NEPX 2F9FA 5ALRA 1ULUA 2TMKA 2RGAA 1GDHA 2DQKA 2I6XA 3BWVA 4RVGA 4I3FA 4Y2PA 3Q9LA 1R9JA 2R4UA 1J5XA 4OOEA 3RRXA 3VTZA 1WQ3A 1W0JD 1LC0A 4UEKA 4UNSA 5E4YA 1AO0A 2WIBA 2X9LA 5CCDA 4EABA 2J5KA 5JR3A 3DZ8A 1TM7E 4M83A 3LHKA 2BFNA 2GF0A 2VDJA 4R8KA 1BH6A 1EWKA 2PXXA 4CQMA 3IKJA 2YIVX 1T4BA 1J2RA 2HLHA 3GLUA 1PR5A 3ZD8A 1QANA 3B5EA 1X6VA 5D6NA 1KI1A 1CJKC 1M72A 2BEJA 1K97A 1SFRA 1TYDE 1D6SA 2XVAA 3CF2A 4RD2A 3ILXA 3U3KA 4FM9A 1A77A 1ZRNA 1SCUB 1E99A 4DCMA 4DMHA 5A02A 3VYTB 3CJTA 1O95A 3GLRA 3KZMA 1DUVG 5FA8A 4PRYA 2SNIE 3CN9A 4XIIA 3FTEA 3H3XA 2Q8QA 3FH0A 1U9ZA 3G5UA 5LOVB 3CVXA 2EZ8A 5ICCA 2FPWA 3J81k 3NRJA 4EL0A 1CR0A 1XI2A 4MA5A