4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
2QVLA 4V24A 5DHTA 3V7WA 3V8RA 5EJGA 2QV7A 3T5PA 3S40A 5DHUA 4DY6A 5EJHA 4WRRA 3V8QA 3V80A 3V8PA 3AFOA 3VZBA 5DHRA 2BONA 3V7UA 1Y3IA 4L02A 2AN1A 4HAOA 5DHPA 3V7YA 3VZDA 3V8MA 2I2AA 1U0RA 1Y3HA 2I1WA 2I2BA 3VZCA 1Z0SA 1Z0UA 2I2CA 5EJFA 1Z0ZA 2I2DA 1SUWA 4WERA 2I29A 3V8NA 5EJIA 3PFNA 5DHQA 2I2FA 2P1RA 2Q5FA 1U0TA 2JGRA 1YT5A 5DHSA
chains in the Genus database with same CATH superfamily
4FCWA 3TTYA 1D6SA 4NV0A 3C3PA 4X90A 3W5VA 4Z51A 3M9WA 1EBUA 3D7NA 4CFYA 3A3NA 5FL3A 1B6RA 1XCPA 1E3WA 3FNHA 5F9MA 2IYPA 3GGCA 2GPTA 5DHRA 2DBQA 3HJGA 3KCNA 4TLLB 4W63A 5DXJA 4B48A 4MB6A 3LECA 5JEEA 3RUPA 3K9BA 2JI6A 3KQMA 1YV9A 2DBYA 1JLSA 1W0JA 2KJQA 2Q9BA 2YRXA 2F9FA 4RJKA 3ZWKA 2G4CA 3C5HA 3WIDA 3QX9A 4Q9JA 2ORVA 1OR8A 1I2MA 4HH0A 4O4LF 4DMUB 4ZK2A 2P2GA 3MD9A 2J85A 2KE5A 4RTPA 1WULS 4D42A 4A7PA 5BSFA 3D1JA 4GE0A 2VK4A 3WQBA 1X1SA 4DLUA 5EJ6A 1NHWA 4TWJA 2IZ1A 2XCLA 5C53B 4ADSG 2O4UX 2VAMA 1R4NA 4BFSA 5KNBD 3N59A 1A1SA 1ISPA 1OI3A 4NMLA 2OA0A 4EB8A 4TL7A 2C96A 1N1DA 4UNRA 1M6YA 2IU3A 1IHOA 3DZ8A 4FS3A 5IN4A 4YV7A 4Q66C 3NHFA 2YXNA 2G9NA 5GIPE 2XA1A 3DMPA 4N7BA 3HM9A 4H08A 4RK1A 3I6UA 2IYYA 2BKUA 4P98A 1ADYA 4TTSA 1Z22A 2SECE 3LL7A 3RJZA 4BZQA 2GASA 5HIIA 2Q7OE 1QX3A 3GJ5A 4G1VA 3VYVA 1W2GA 2PHZA 4FB4A 3A8TA 3OE5A 1W5SA 1PDWA 2JFNA 2OGWA 5TY0A 1NF2A 2HR1A 2C77A 5FFNA 4AX4A 4CEIB 1XZJA 2D7CA 4GBGA 3FYUB 3PYXA 5JPIA 4KOAA 4DCJA 3MCAA 3H1EA 1F4LA 4FX5A 2P9CA 3DFKA 5GONB 3SFZA 2E0IA 3GLFE 2CCJA 1F0PA 4X7RA 4LWOA 3UJ9A 1QK4A 3GELA 3OOWA 3WDLA 3MELA 1SXJD 4DLZA 1KYVA 4RV9A 3U6KA 2QD2A 2BKAA 2VAXA 3IA7A 3RC8A 4CTOA 3K30A 2ZJZA 4Y1RA 4EGSA 1F17A 5JAMA 2ZUEA 2O8FA 1BD4A 1OCEA 1V35A 2I4RA 3OT1A 3QW2A 4EHDA 3QFHA 3WC4A 2C7QA 5C5DA 3HWRA 4UULA 4Z4GA 4MO9A 1FY2A 5AM4A 1JXQA 5AESA 5A0TA 2CNDA 2KWIA 2QL7A 2G40A 5BN4A 1CUFA 3AILA 3GV0A 1S5PA 4B2IA 3UPUA 3EG9B 3UBMA 2LCQA 2YS7A 3A6EA 4OVKA 2V0GA 1G0OA 1Z8NA 1TI7A 1JDJA 2Z8XA 1CCWA 4KU4A 1CIVA 3CCFA 3D3KA 3T5MA 3SZRA 4OHYA 1P5HA 1EFKA 1QG0A 1QVVA 2B7BA 2CXUA 2P9HA 3NOOA 3QYFA 1JMKC 4C0BA 4EELA 2GBLC 1XLTC 3H6HA 4UMDA 2PFKA 3ZJ4A 4DANA 1J0DA 5KYYA 4DQUA 4B83A 1BHJA 2K2QB 1YFKA 2VPPA 4GS5A 4J7CA 4KQFA 3SD7A 1NBWB 2OCBA 2WEKA 2VRCA 2V7BA 5D1NA 3DSRA 1QIKA 4NICA 1EGQA 4RSMA 4LFBB 3IDAA 1PE0A 1JU9A 1V9LA 4GGPA 2OXIA 2ZTUA 3ZZMA 5IM5A 3RK4A 3ZJTA 4GNKA 3RU3A 3E7PA 2PUDA 1A3CA 1EFUA 1NP3A 3FPKA 5H8WA 3SF8A 1G7RA 2O23A 4BAZA 1IN6A 4LQDA 4Z86A 1G20E 3CBGA 2QV0A 2JKYA 1JEQB 1Q3TA 3L1KA 4FFPA 8LDHA 5C31A 1P72A 3A32A 2OAP1 1IN7A 1B8VA 2QN9A 2VDVE 3DS8A 3MIIA 2OFXA 3K0HA 4KN6A 5DPMA 4JI1B 4A9AA 5CDFE 4DV3B 4LF6B 1JHYA 2B1RA 3O47A 4LC1A 2I1WA 2HYDA 1M72A 3M6IA 3PI7A 5K3SA 4C06A 5JRJA 2YZGA 3BRWD 5EE3A 3DCNA 3RWBA 1XMOB 1NYRA 1O9BA 1MFPA 3CLVA 2QTTA 3DTVB 1TQ2A 5JC1A 3RADC 1VC2A 5CIQA 1I4WA 2H85A 3HCEA 4GBED 4BKOA 4CIXA 1L7NA 1R6DA 4N5NA 3NX4A 1DARA 3IIMA 3OY2A 2Q5FA 3CUVA 4Z3OA 3OO0A 1OB5A 5DNCA 4H2DA 2XNHA 4NVRA 1OGIA 3CVVA 2OORA 2OLEA 1IY8A 1XQ9A 4DRZA 2ZT6A 5CXSA 3FM8A 3DWGA 3O73A 3QUAA 4P6VF 3FUVA 1F2VA 3SN6A 3WLHA 1Z4IA 2NU8A 3JARA 4IUCS 1KI8A 4OL0A 3FH0A 2W6ZA 5EIAA 1ADCA 4ZV7A 3IUMA 1BXZA 2C7PA 4XVRA 3UT6A 4D2IA 1VPTA 1Y4ZA 2REBA 1PYGA 2C5HA 2VKTA 4RM2A 4P3NA 2R8EA 2AR7A 3W34A 1RLMA 5KJCA 1N33B 1PZFA 1QO0A 1GG9A 5JAIA 1SVOA 1NV9A 3AEUB 4LQLA 4RF2A 4UOQA 1GPBA 1PW5A 2ETVA 3A6LA 3C3BA 3QJGA 4G63A 4UZEA 4E14A 1LB1B 1P74A 1PJZA 4N5DA 3QPCA 4QT0A 3KYBA 4KO2S 4JIGA 1HFKA 5A4JA 2KX7A 4EW6A 5L6LB 1NI4A 1ULZA 2GPWA 2FVYA 2FW9A 3NLLA 1KARA 1M0TA 4JGGA 1JZTA 2A5GA 2A9OA 2ZSBA 4NBTA 3G8YA 2J5XA 1JXAA 1JDBC 4RMJA 3U26A 3SJBA 3T12A 3K70B 2COEA 4EY4A 4DUGD 4JASB 5B3KA 1QGAA 1LQTA 1W35A 1I7NA 1WS6A 1IPHA 2VXCA 3DMRA 2AXPA 1RZVA 3OOHA 4GLBA 2H2DA 1GCAA 4QEDA 1FXWF 1JPVA 2G4LA 3MT7A 4B0PA 4CETA 1OFTA 2WAXA 4R8MA 4YCJA 4D8VA 2R8XA 2A59A 4UDNA 4B5KA 3D2CA 4LPKA 1DSSG 3WGOA 4IMPA 2XVAA 4ESOA 4PG8A 4IKOA 5EJ9A 1Z9BA 1IXRC 4EHIA 1JXMA 5LNK6 3Q7SA 3T61A 1N5IA 2QR3A 4DSAA 4RQTA 2O0LA 4YMTA 3C5WP 5JI2E 3CW8X 4EHKA 2QN6A 2ODAA 5FO1A 1HRDA 3H7IA 1GT91 1MB0A 3QY9A 4NQZA 1WXIA 1Q57A 1MC5A 4PRKA 3DEYX 4XGRA 3E2PA 5EERA 1WKCA 2ONCA 4RZ3A 3L4EA 2VEDA 1X1AA 2O1XA 1P4GA 4MICA 3KQUA 2PSDA 3JRNA 2ZB8A 5JROA 2VAVA 3PJRA 2O52A 3CX3A 5KQSA 1JQJC 5C1BA 1ECGA 1I3CA 2I62A 4QDXA 1YZUA 4I99A 2FE1A 4ALIA 2IODA 3CURA 3N2IA 4DZTA 3K6JA 5AOAA 2QUZA 4P7GA 2WW8A 3T1TA 1CEYA 2G6BA 2OV4A 4N5LA 3PZBA 3VDNB 1BCRA 4B74A 2WU1A 3X0DA 4E21A 5GZ3A 4ENUA 1NM5A 1PK9A 4REQA 3EA4A 4YJFB 5AHXA 3N39C 4GXRA 1J2EA 5A62A 3MCUA 4JGBA 2YMPA 3Q72A 1FFXB 1KAQA 4JJAA 1JG1A 1TT7A 4ZZ2A 3F1KA 3SKVA 1XEXB 1DJLA 3FCOA 3N8HA 3QBTA 2CLSA 5TRTA 5IDVA 3H8VA 4LQ4A 4R9NA 5ERYA 1QWOA 2QGFA 2EC5A 3ZIUA 1N2GA 1F7VA 3WK8A 1AF7A 2E3JA 1H2HA 3PNQA 1CR0A 1PNOA 1UZNA 3A9VA 1SCIA 3NUZA 2OQVA 4YUZA 4ANFA 3AYXB 1IHXA 2ACEA 3VTFA 5REQB 2C92A 3QF4A 3EMDA 3QVWA 5AYVA 3SZ3A 1PT8A 3KYCB 1R16A 4NCJA 2J5RA 2VHVA 1C3XA 3TB6A 4IAOA 3W5HA 4AX8A 2Z58A 2MYNA 1FJHA 1P9NA 3G0OA 3KXPA 4HUQA 2WG0A 4LK2A 3C5VA 4Z54A 3TOXA 1XTTA 2Y93A 3NB0A 1W2WB 3LSYA 4DR3B 4UPDA 4DA9A 3VDQA 2WSMA 3ETEA 1LK0A 1U7DA 4NIMA 5ICCA 1RZ3A 1J97A 3ROZA 5T6MA 3TR6A 4OBEA 4ALKA 2NO6A 2VUSA 3CB2A 1YNSA 4EP1A 5FNVA 3TKLA 3QYAA 4GM0A 2WNIA 1SKBA 4B4VA 4JP8A 2IVZA 2NU9B 5AVJA 2G1PA 1BXRA 2PV0A 4Z7JA 1QSGA 3VU1A 4I5FA 3IHWA 3WGLA 2PR7A 1UKAA 4EYEA 2JH3A 1VLLA 1KQGA 1NG9A 3F71A 4JB3A 5HFNA 2F3TA 2BKVA 3WKAA 1DKUA 4HZUA 2QQ5A 1R5NA 3KHTA 4ER5A 2HL6A 2SNIE 2GAAA 4YWJA 3KBBA 4M89A 2PO7A 5F3WB 4DDKA 1L5OA 4LDAA 1O0BA 2QQFA 4B7CA 2AI3A 1EQ2A 3EVFA 1UKVY 2NTEA 1EGVB 4TLEA 2VDKB 3UIEA 4CL2A 2P6MA 5G4KB 3DHVA 3ECCA 1LZLA 2PVSA 4WL0A 3VTAA 2Q6OA 3EZLA 1SGWA 3BIWA 4KEAA 5FOXA 4PNZA 3RIEA 4DQKA 5L3QA 1S1CA 1L4BA 4HDAA 4R1MA 4TMKA 1T3TA 1D4OA 3FI0A 2TRSB 4WKNA 4ZHQF 1QIJA 1M1YB 4K8RB 5LQRA 1MAWA 1ISFA 2OLJA 2OXFA 1X8XA 3AWIA 5I3ZA 5B2FA 5K9ZA 1JT9A 2FFAA 2BDEA 1SWVA 4LHZA 4XSGA 5DOVA 3ZD9A 2UUBB 3GOHA 1ESMA 3LUFA 2FFQA 3GEPA 5ANRB 3RT1A 4HFMA 2ERCA 2JFYA 3A05A 3DTYA 2K4MA 4M1MA 5BYAA 3RFUA 8GPBA 4URUR 1P1RA 1V1MA 4IHQA 4DIOA 2CHFA 1C3EA 4DQXA 2FG5A 2VPZA 2CKMA 4EZIA 5LXTA 1PZEA 2YWFA 1DFIA 3IGFA 3EEBA 4F11A 4G85A 1PQ4A 2C7OA 4D5GA 1C9YA 1CNEA 1UIRA 1ZN8A 2BEVA 4PICA 4IRMA 3FDIA 2XA9A 4D9EA 4PZEA 2X3UA 1EXMA 3HLTA 1BYUA 3I01A 3IVCA 2JIZD 3GRPA 3LGXA 1ENYA 2YZMA 3PQ5A 4K9PA 3ROQA 1EFRD 4U2CA 5T64A 3HEAA 1A2KC 1E5QA 2EOAA 4R69A 3ZDCA 2BGMA 3ZHYA 4OKIA 4GG1A 3LKDA 1L6RA 2V6JA 3GCDA 4IRUB 3JQEA 2GB4A 4K9RA 1Y9EA 2IWRA 3W77A 3AFOA 4EJFA 3R5SA 4LN1A 3TR5A 4JUCA 1QF6A 5ETJA 2QZJA 2K6GA 1EJ2A 2VDNB 3BFPA 1AQLA 1C8LA 3QA9A 2VJNA 3HH8A 4RPIA 2F43A 2XD4A 4TSFD 5C4GB 2NGRA 1L3CA 4LHSA 5HTOA 1NLZA 4BE9A 3PUKA 3KB1A 3H8SA 1ZD5A 4I1UA 4IIJA 4WOPA 5LMZA 2C97A 1JIIA 1ZUNA 4TS9A 4EZEA 4DE5A 1ZN2A 3ZHSA 1N2ZA 3LHSA 4C4OA 2YVLA 5E1OA 1VZ2A 1EDOA 1KIAA 4NMWA 3MN1A 3KZ1E 3PR1A 4O0MA 2JLQA 4FU0A 1DBVO 1QB8A 4KPGA 1N8SA 1Z18A 2FSUA 4G9GA 4INZA 1YS7A 3I53A 4PLVA 1KXJA 3RVLA 1F8XA 2UUCB 2Q3DA 2F67A 4WLEA 1Z8HA 3THYA 3HKCA 1F6WA 1G7CA 2A67A 2RIPA 4RJTA 4LZNA 5J59A 4HJRA 4X54A 2NVUB 1T3HA 1E1KA 1YIDA 2BFCB 1TK3A 4DC1A 3VO2A 3U3OA 1TEHA 4BWGA 3Q12A 1OX5A 4OEHA 4JLKA 1EDBA 2IFTA 1G66A 2G9VA 1F4PA 4IS2A 1VMAA 3P19A 1T36A 5ES3A 1F2TA 1E9VA 1DWOA 2XGSA 3BF7A 1QTRA 2YHUA 4W7IA 4EI2A 2G5PA 1MRZA 1ST3A 4XWKA 4AMVA 2AS0A 1C41A 1ZOIA 2AOUB 3G2OA 4L8VA 4KI7A 3GLKA 2B8EA 1RBQA 1AIPA 2JARA 2YQZA 3R40A 1D2EA 5IDYA 4A26A 1BS9A 1U3DA 2TECE 1N4AA 5JYBA 2WYIA 4PZYA 1N2SA 1DLJA 5H83A 4Z4HA 4RLQA 4GBMA 1M2GA 4M7OA 4UM5A 1Z5OA 1QZXA 4I19A 4C29A 5JASA 1DOZA 5CM9C 3SNHA 4N4AA 3P9IA 1RHRA 4P2GA 4GLOA 4O4HB 2P5UA 1BCSB 4MS4B 3RYFB 4BZPA 1X80A 5T67A 3ESCA 1XT6A 1QTIA 1QQAA 1FFAA 3T5TA 1F1JA 1QFZA 2XNDD 4RL6A 2FOLA 1T1EA 4LKOA 4X1OA 4XEHA 1I01A 1P7ZA 1ZU4A 4MS1A 4NC9A 4LJAA 3SXJA 2DUJA 2HIHA 3MUFA 2XR1A 1H0KA 1T8WA 3ENWA 1NOJA 3ESZA 4FI3F 1U99A 2IYSA 2ZSJA 3IHKA 3QVJA 4HDRB 5DULA 2CLDX 1LCIA 2I7TA 4MV5A 4NCBA 2CLFB 1PK7A 1KDOA 3L4JA 1V2HE 1X6VA 2G4VA 3TI9A 1IUKA 2HQSA 3FYSA 5ALOA 5DXFA 4KBFA 2ZJ8A 3VSEA 3GBPA 4MDEA 3HFJA 1PJ2A 1A96A 1NF9A 4Z8YA 2I6TA 3GCXA 4Z0PA 5AICA 5A4DA 1WEKA 3NI2A 4OX9B 5SY9A 4CV2A 1ZVQA 4NZPA 4QGFA 4YIKA 2R6CA 1QANA 3BB1A 4CCYB 2D4AA 3PE3A 3BH0A 4Q19A 3RS5A 4RVSA 1B00A 1L4FA 5KU7A 1RADA 5F12A 2Y1XA 4FCCA 4M49A 3FTNA 3QKSA 3HYNA 4DMRA 5KQRA 4EMSA 5D3MB 2UVPB 3UUWA 4KMMA 1VI5A 2JLVA 2ZZKA 3UH0A 2GZ1A 2UZ3A 4QEKA 2ZWIA 2J6HA 2XOKA 4KX5A 4MQ4A 4MVJP 3C6MA 1VXOA 1Q74A 1GJRA 2OHFA 3TSWA 2H4FA 1YZYA 3O0DA 2YWEA 3TRFA 3KJGA 3LY8A 2PZMA 4G07A 1IZZA 1E6LA 4OF4A 2Q46A 2WF7A 2ZUDA 1DWQA 3NDJA 1N25A 4I55B 1U98A 1U8XX 3KG2A 4ZU6X 2JA1A 5E2BA 5L3VA 1R5JA 1TC2A 2H29A 4UHCA 1X77A 2H4HA 4D9BA 3ZLBA 3GP8A 3OZ7A 4U0JA 4E51A 4Y7DA 2PQMA 1PGNA 5K0FA 1RQ7A 3HBMA 4US2R 5LFAA 5IKOA 5BT9A 2YHIA 1AZWA 1LF5A 1ACJA 2IXFA 1W581 3VHQA 3VPCA 2EJTA 4OHFA 4TVKA 4WY2A 3D8NA 4MKGA 1SNYA 3G9TA 4RK7A 2VBIA 1LI4A 1M2OB 4K9SA 1VMKA 4JLOA 4M36A 4DDHA 1KYXA 2VZ9A 4CHTA 5FHRA 1S6YA 1EEXB 2I03A 1NUHA 1LJUA 4KIFA 4L0CA 4LMRA 5IZCA 1RM0A 4J4BA 2C58A 5HRCA 1K27A 2IL1A 3THWB 4GMGA 4PSAA 2XUHA 1JSLA 4AYXA 4IO0A 3ABQB 5CEFA 4TM7A 1IY0A 1K66A 1WSAA 4FCVA 4ZMBA 2JFXA 1YS9A 3RFVA 1WCWA 2QVXX 4LF7B 1BFDA 2Z2KA 4MO2A 4FT4A 1WLNA 1XMXA 2IK8A 2NX2A 1NL3A 3CU5A 3EVEA 5D8DA 3GRYA 4GECA 3UQYS 1IEWA 1S4QA 3QPAA 4EJ2A 3UTDA 2WA1A 1E2IA 2WNHA 4L50A 5A0FA 1NUPA 2WV7A 3DF9A 5FUVA 4EHFA 4CNQA 2Y6UA 3DZJA 5LDGA 3RCBA 2Q6VA 3AR9A 1F2UB 3M1YA 1WUHS 3STWA 1XPJA 4A15A 2DERA 1ZRNA 4MEBA 4HNSA 3ZKAA 4JVLA 1N0HA 3R3ZA 1XVAA 5FI3A 1EH5A 4Y6GB 4TVOA 1WY7A 3LUJA 3Q6NA 3A6PC 1RPAA 3PK0A 5EJ8A 5JJBA 1T0IA 8MHTA 2QLTA 2EQBA 2ZJBA 1JDBB 2X9NA 4QJIA 4HNTA 4X65B 1TCUA 4LAFA 1Y7PA 1NURA 3GMDA 2JJ8A 4ZQEA 3CX6A 4YT2A 3K0FA 1D3AA 4GW3A 2QRHA 1RACA 3GRUA 3NGXA 3NANA 1OYOA 2HMAA 3AEKB 3P2KA 3PGVA 4KKXB 4ZEXA 4D9MA 2ZRIA 4B8WA 2XE6A 4GT1A 3OQIA 4TWIA 2FQQA 2FZCA 1MX5A 5CU7A 4CLOA 2LR0A 4ND5A 2GGSA 5CFRA 4A2PA 1TECE 4HEA1 1TO6A 5D3ZA 3WZ2A 1RJFA 3JYQA 3PFNA 2VYVA 4Y7CA 4KWEA 3RRZA 3OURA 1ORVA 2VBCA 2NZWA 1II8A 3PUIA 1DNPA 1O5IA 3A2MA 3W6OA 4EUFA 1KDYA 5INTA 1IDOA 2XWBF 3ICWA 1SHUX 4LYAA 5EIEA 5KWSA 5MFPA 4JBWA 1UKBA 1YJAA 3BE5A 1UWCA 4TRRA 2FP3A 3H6KA 4WFJA 2OP0A 5ARCA 3GBVA 3FMOB 3H11A 3TX6A 2W2KB 4UOEA 2BCJQ 4MRPA 4RETA 1NG1A 1MA3A 2D0IA 5BRAA 1H23A 4XWAA 3KSAC 6ADHA 4PLTA 2HUPA 1SUPA 4I66A 3HB7A 4X93A 3FOZA 2HLNA 4D6XA 2OV3A 4HGQA 2PD3A 4WBSA 2QI9F 4KSYA 1W4ZA 4UDXX 2HH9A 2C9OA 2QOEA 2YCBA 3PUWA 5H3CA 4Z1OA 5T8KA 1BW9B 1DDIA 2PVPA 1OU4A 3DAPA 3HCPA 1YO6A 4L4YA 1V0JA 1S7CA 5BURA 1TYDE 4OAOA 3UICA 4HYQA 2B1IA 2DPGA 3ZCPA 3TL2A 2QRZA 3T1YB 2C7GA 2QTFA 3QPBA 1BQEA 5DK4A 1C7QA 1Q19A 1IMOA 1GXSA 3L0CA 1T26A 5L53A 1W1WA 4AL4A 5BOSB 3V8PA 4P92A 2ENWA 4TWAA 1I6MA 3MILA 1JIVA 2CC2A 1OIVA 4QFBA 5BQPA 5T4BA 3ZX5A 1H9AA 4TKVB 5DW0A 2BISA 1HOTA 1Y9JA 2QN7A 3GJ8A 3HDGA 4HRYA 3DBRB 4Y1EA 1XI2A 3W3AH 1USUA 2JGDB 3AGQA 3PNPA 4HWKA 5G0VA 1P0PA 1RJDA 4WZAE 2DCUA 3RQSA 1D4ZA 5GJWC 2AOXA 3SIWA 3ZDEA 1BVUA 3KD3A 2IHBA 3G9XA 4KE8A 4KQIA 2R00C 5JJCA 2YQ4A 3E9MA 2XYQA 3G5AA 3KPVA 5J2UF 2B69A 2QTZA 3DBVO 2NVOA 2IF0A 4OU5A 5TMEA 3O31A 1KQFA 3K1TA 3HN6A 1KAOA 3A0UA 4CLXA 3MSCA 4GPD1 4YR9A 1HG0A 1QCZA 1QV7A 2ZEJA 3H8WA 1YE8A 3T5CA 4RH3A 5F51A 4YMUA 4OSEA 2JCBA 4BNFA 5TNXA 3FKSD 2A9FA 4LMBA 1UBJS 1FP4A 2EZ9A 1QNLA 2Q41A 3ETLA 3KRTA 1W46A 1AQJA 1LPOA 3TTWA 2GK7A 1U9IC 2RJOA 5FBZA 1SXPA 1KHHA 1LSUA 5JYEA 4B3SB 2JFUA 1LW6E 4GX2A 5KJ1A 1Z4NA 2I3AA 4G5RA 3QKRA 3D8UA 3CINA 1V43A 3R9KA 3OD1A 2GAIA 2J41A 2QRPA 4II7A 1L5GB 3HRKA 3X43A 1GPUA 4FN4A 1PWHA 5BV8A 3T1VA 4RELA 3JAMA 1HT1E 1YZFA 3S1AB 4LXGA 2A3NA 4DLXA 2VSYA 4BKPA 4K9OA 4DUPA 2OAQ1 2R1TB 4OBXA 4F4FA 4EGAA 1E1LA 1K8YB 1AK1A 1CZHA 1E66A 4UHBA 3BTVA 4HLUC 4ZAFA 2BBOA 4L02A 3VC7A 1ZSNA 4GNRA 2D1TA 3KE8A 1GTL1 1T6BY 1MNQA 2QPOA 1L8AA 4IDAA 4IJ5A 4QASA 3WYFA 2QRKA 5I8ZA 4B73A 4CKWA 1Y1KE 3I6QA 4E70A 1P44A 2BFEA 3DOOA 2IYTA 3OPXA 4L07A 4R1QA 1GUYA 1U65A 2JRLA 3EZ7A 3MTJA 1E6WA 2IXAA 3A6FA 2Q2NA 4GZMA 1EM6A 4CCAA 4BUJA 1V6SA 4O0LA 4J3FA 4BFXA 1TVKB 1XNGA 4O8ZA 2E4WA 2MIIA 2OSVA 4IUYA 1JLLB 3MGAA 3O93A 3RSQA 3CF2A 2C0QA 3CIFA 4YUWA 3COWA 4KTTE 3DOUA 4M2LA 2FG6C 4I3HA 2LW7A 3K8OE 4HNVA 2ERXA 3EQ7A 1WPGA 4IJWA 1MN6A 4ODIA 2I6XA 3ZJYA 4QTZA 3BWVA 3CLTC 1KAHA 3KT6A 3IKJA 3KQLA 1OV6A 3DMTC 3A28A 2ACVA 3L07A 2I1VB 2VDPB 3H16A 4R54A 1H4VB 2DE0X 3JSAA 3JASA 4K7JA 5HEKA 2ZYVX 1HLFA 2AJ8A 2FCAA 3WS7A 4RANA 3TRJA 4A0QA 3OUTA 2QJTA 2WJ4A 5KAPA 4YHBA 2C04A 3KSRA 1DTEA 1PLJA 4B4KA 4QGSA 3UM9A 2JLXA 3PQDA 1WNTA 4QYWA 3UK6A 2GD1O 3ZG6A 4NFHA 2JEZA 2H06A 4DNOA 1I7QB 1JEDA 3OCXA 4HMOA 2EHJA 3GNTA 4RYLA 2VLBA 4Q1CA 4J0GA 3D5EA 3FJ1A 4LGMA 5GJBA 1JHMA 2OD9A 3EF1A 3KVRA 5F78A 2O1EA 4BFCA 1YJBA 2Q28A 2XXBA 2AD1A 3PC6A 3WB9A 1APBA 2MSEB 5KNCD 2V0CA 4L4SA 1H42A 1WMEA 2HLPA 1OA1A 1Z5WA 4I9UA 1QC5A 3U80A 1BKDR 3JQ9A 2EU8A 3ILVA 2LDBA 1UXKA 1TAUA 2ZYIA 3ML1A 2I0FA 1F51E 3P9KA 4ON9A 1KKMA 3PPWA 5DMXA 4RVHA 1W85B 2JH8A 3ICVA 3D6MA 4X9XA 1EWKA 4IVNA 2LRHA 1FX0A 4GRDA 3WIUA 4PPGA 1IWOA 1EUCA 4HB4A 5IAAA 2IOQA 4J2OA 1V71A 1T5BA 2IHTA 2QJOA 3AETB 4NE9A 1DRVA 4V0MA 3TBFA 5BN3A 4Q4LA 3NHLA 2XE4A 5AXBA 1VRCA 4DYVA 2X0NA 5K03A 4EGJA 1F5NA 2QU7A 2CEAA 3KUKA 3AR8A 3PE4A 1TF5A 2I2FA 1E3EA 4G2TA 4ZPXA 2VQ6A 1K6MA 3ZIAD 4D4IA 5JAHA 1Y8AA 2H57A 1G5TA 4BUZA 3D3WB 3IKTA 1TMYA 1TMKA 1C1DA 1E4EA 3OIVA 3KZNA 5EY5B 2FUG1 4OHBA 1JFFB 1V7CA 3L4BC 3JQAB 4JIMA 5IJ9A 5DHFA 3ICPA 3WL8A 1XXHA 5TPZD 2P2DA 4LX8A 4BX2A 1LI5A 1M83A 2GCEA 3OLYA 5AJZA 5L3RA 3PE6A 3EVBA 4NYJR 5AHOA 3CQ9A 3TW8B 4OKNA 2OXEA 3JY6A 4NE2A 1UXJA 4J1TA 4JVMA 5ALFA 1GTJ1 2JLRA 2ZIAA 3BFXA 3BK7A 3OBIA 3FDXA 2Y2UA 3OZVA 4QHYA 3B1JA 5DCLA 5E9JA 3WDKA 3ZXUB 1YRQA 5LQCA 4RTMA 3TNYA 3ADDA 3S28A 1H2BA 2RHTA 4DSNA 1P19A 2XMCA 3C87A 4G0QA 4LEIA 5B1DA 2GN4A 3ZQKA 1QLWA 2A9QA 4KRFA 2HLDD 2O1WA 3HU5A 2HWWA 2XGMA 1Z2DA 3O8QB 3GG2A 3P4UA 4C0SA 4DLKA 4CFZA 3G13A 1Y80A 2Z3VA 4HHEA 4KN9S 3ETHA 4LY6A 1X1BA 2AFFA 1XCBA 5G1NA 2R85A 3VHRA 2OBLA 3BRQA 4O4IB 3LY9A 5A1TA 2WSBA 1JZQA 4YH1A 4P81A 4BDTA 1GRCA 3WGGA 3U31A 1FXSA 2D3TA 3MYYA 3P4XA 2RHMA 4E5KA 2IYOA 3MWEB 4ISBA 2AUTA 1AKNA 5F9FA 1QRDA 2XYRA 4FHGA 4Y9UA 5IUJC 5LZ7A 3GFFA 3R8FA 4UTOA 4EB6B 3G6WA 1ZD2P 1SXJA 2ZSIA 3D4OA 1JLMA 3VPYA 1QYIA 2HWYA 3E03A 3ONEA 3Q3IA 9ATCA 1SHTX 2E21A 4L15A 5HOQA 2RBEA 4XOUA 1N7GA 2W83A 2CF6A 2CFOA 4J16A 5FUBA 1O94A 2FZ5A 2JJMA 3H9GA 2KBEA 5E6UB 3SWWA 3ZZ1A 4OYYA 2J31A 5KC9A 2R8OA 4MMYB 1XU4A 2E49A 1JDNA 1BXKA 2GETA 4HQKA 4AN1A 4MGYR 3GFOA 1C30A 4OU4A 3AINA 1WHSA 3WWPA 2H9IA 3FHTA 5AVYA 4WXHA 2HDHA 2Y9PB 3FKQA 4HWTA 4E07A 3CGGA 4HT3B 1JKFA 2HJHA 2I2CA 2I2WA 2W11A 3LMKA 1B3BA 3V33A 1Z6AA 1O5TA 3GN1A 3IPAA 3PYLA 4IGFA 5ENZA 1BKSB 1A8HA 5EIBC 1MFZA 2VJBA 2E85A 2JANA 3WXMA 3ZCVA 1ISHA 1NUUA 3I9JA 2FEZA 1PSZA 3UAZA 1R8QA 2PRJA 1EGMB 1JE1A 1K98A 2EL7A 4HQOA 5EWLB 5H4HA 3W5BA 1ZGGA 4UEWA 1JWBB 1Z6PA 3BGDA 1SN7A 2VLIA 2PKEA 3QU9A 4JBYA 2OYRA 5H9VA 4MHSA 4N5MA 2O3JA 3OQJA 4OJYA 1HT0A 1MPTA 3FSRA 3ZI0A 4QU8A 2CBGA 1UKYA 4KSBA 3GARA 2VQEB 1DHRA 4OQZA 1FDIA 3KQOA 4ZVQA 3HKEB 2JHPA 1SEPA 3GJXC 3B3AA 4WKPA 4OQNA 1K97A 4ZVMA 3SK0A 3B3GA 1XFDA 5JNTA 2O8EA 1GKYA 1Q15A 2VTKA 1T3ZA 4TL9A 3WKEA 2QI9C 4L78A 3S1SA 1QHYA 5IHXA 1I2AA 4MQEA 1PEAA 3IO3A 5IJZA 5EOVA 3P2EA 4L5AA 2BSQA 1JHAA 3TSOA 2X5NA 3CX4A 4EHHA 1GR0A 1KEWA 1TU4A 1VL6A 4ZEWA 3X44A 1FPMA 2CE2X 3NCTA 1PJAA 3LKZA 3OFVA 4W5HA 3HGQA 3BRWA 3E9DA 2QG6A 1KY2A 4P54A 3QSYA 3IMCA 2NPFA 3GGSA 3I6WA 3C7AA 3JQ7A 2ODQA 3UAOA 2BP7A 3ZVLA 3K9CA 1M7GA 3D6TB 4BU0A 4MARA 3LDGA 4CF7A 1KPIA 3NHWA 3LQYA 4QDKA 2IDMA 4CCWA 2XZDA 3FGPA 1USGA 5ESRA 5HQTA 1GTSA 1RC8A 5A06A 3EG5A 3SM9A 2RGNC 1Y42X 3DC7A 4JT8A 5A3QA 1V7ZA 1GWNA 1X0VA 1UC5B 3SF0A 3B13B 2BGUA 5JATA 5KTTA 1Q14A 3G2IA 3M89A 4B6RA 4LHEA 3IDFA 1T43A 3KZMA 4EHJA 1EDEA 5CGZA 4MVXA 4ZMRA 4NJEB 2APJA 1BMTA 3L0YA 3BCHA 4X64B 2NUTB 1BNCA 4C05A 2I8AA 4Y6OA 2QN2A 1SD1A 3AESA 1MO6A 3AOGA 4HF7A 5H81A 1UZAA 2XX3A 3C3MA 2DLDA 5IC4A 3HQ4O 3IAM6 4EX7A 2EGGA 1S2MA 5HS4A 2XEDA 5BXQC 2XOXA 1K6JA 1TCBA 4EARA 4CTNA 1QOPB 4FFWA 4JBLA 2A0KA 2ZXUA 2X8WA 5CB4B 3BXXA 3MJRA 5IZ4A 5THXA 1PVOA 2CXTA 2RAFA 1YFZA 3HDHA 3DULA 4M37A 1CEQA 4WZBB 3TF5A 1NVVQ 4V03A 5HVNA 2O3QA 2D1SA 3VOTA 5BUCA 1PS9A 5IMBA 3AJDA 2KB3A 5HBGA 4DUGA 4NYIR 2WUFA 4B5LA 4YRZA 3Q1KA 5J47A 4YQEA 1DKMA 3PQ4A 2OESA 2EX0A 2ZBDA 3BJEA 3QFCA 3T9FA 3SDZA 2VQSA 1EBFA 3BWCA 3MM4A 1PR1A 3KOWA 1G98A 1P31A 3W4KA 3NTOA 5MFZA 1RZRD 3TJZA 2BMAA 2PT5A 3L40A 5IP5A 4IDFA 2ZW9A 2FPMA 4OI2A 1EG7A 3U56A 3NMUF 1CRQA 3WK7A 2H92A 3D2BA 1PJTA 3MOSA 2VF7A 2Z4TA 3PD1A 4J9VA 3RYIB 3NFRA 1Z07A 3H9CA 1FP7A 2HSJA 2G08A 4PYQA 3B1KA 2WM2A 2Z04A 3D5TA 1XJ0A 5FTKA 3UAGA 3BMCA 4C7VA 2D1YA 1WDTA 2JVIA 1IZ0A 1YB7A 4JITA 4URZR 4FZ5A 1F12A 4O4JA 5KSPA 4M98A 3M6MD 1UPTA 4EBBA 1CJUC 3QI7A 1IM8A 4C0LA 1UODA 2BGRA 2BDTA 1N3LA 3I73A 3BB4A 3ZHTA 5BPHA 4N9QA 3ELSA 4TKUA 1IAVA 4D4JA 4X5OA 3DOIA 3IVGA 1TNDA 4ALJA 3L77A 1LGYA 3OP1A 4HAXA 2J67A 3HA2A 4ZVOA 3TRDA 1JFLA 1XWFA 4Y2SA 3GLTA 3WKCA 1OJ7A 3O8OB 1MH1A 5LLDA 3M4XA 3RVSA 3AT1A 3KTAA 5HE9A 4KPUA 3NVDA 4ZDIA 2WJ3A 3W7AA 5DRYA 1JR4A 3X1KA 4RS4A 3QMMA 1EMDA 4G97A 3AQIA 3IBTA 4RY2A 5FI5A 1SU8A 2PZKA 5LA6F 5AW4A 4PCUA 1TM2A 5JD6A 3VGJA 5C1DA 3G7UA 1NQWA 2W2XA 1PQUA 5CD1A 2WFAA 1XRMA 3KEGA 1KEEB 2H18A 4J6EA 1NUSA 2NV2B 3HJTA 3OKFA 4GP6A 3DE1X 4YLEA 2ZB2A 3BULA 3RU2A 5CIYA 1OQAA 1M8JA 3F74A 1MRSA 2YH2A 4YTEA 4C89A 4XQCA 4NENB 1OE0A 2QGZA 1JIXA 4ZC1A 1JVSA 4RDIA 1DV2A 3MLEA 3U16A 1G0NA 4KZPA 1OVGA 1OKKD 4B47A 3QOXA 3ZCTA 2VF2A 3OZCA 2FMHA 1YA8A 4KAFA 4LTNA 4PTYA 4DEVA 5C8YF 2XKKA 2O3RA 2HZBA 2WIJA 1LVGA 2JFVA 4Q6WA 3WGKA 1I4EB 5FUXA 3VR5D 4DYDA 3PTLA 4IDEA 1JYEA 5JQGA 4J0EA 1P0IA 2XCOA 4L0QA 4NU5A 3FCAA 4X8OA 3ZTTA 4BZWA 4LFAB 5P8WA 3JATB 4EJSA 1W9HA 3S99A 3CF4A 1BKYA 4DY6A 2F2TA 3HS3A 3SSAA 3VO9A 3IT1A 4YP9A 5CCDA 3NHYA 4RK4A 1AHHA 4L6AA 3WDMA 3ZR4B 4RQBA 5J4LA 1KY4A 1FF9A 3WGNA 3OQNA 4WACA 1KP3A 3H2BA 2P2SA 5DTQA 2VC2B 3BH6A 2Y1LA 1CZNA 2YWRA 4IOKA 3M6UA 4TMXA 4V0RA 1JVNA 5CX1B 4ALLA 5KIAA 1XNQB 4PYRA 2A57A 1QH9A 2D0PB 4PHTA 4PPYA 3SJCA 4B82A 2GJ8A 1OB2A 4DABA 3V8VA 2XVZA 1CY8A 2XWQA 4CMCA 2X6QA 4WJKB 5CX4A 1FBNA 4R2IA 2FUKA 2DHCA 3LXUX 2GXAA 3U44B 1IN4A 5K0TA 1E2HA 4RD1A 3IEIA 3RG8A 3N58A 4NCAA 5K4HA 2V7UA 2MSWA 2G70A 2V6GA 4JDUA 4CFSA 4E5SA 5JAZA 1UH5A 1FMTA 1V96A 4DZZA 4BB9A 1Z4QA 2O4CA 3RARA 4MYUA 2E1PA 2VHJA 3Q6IA 4Q7QA 5CXXA 1KI3A 1U7VB 1EP2B 2WMOB 4CKBA 1EWVA 4ETWA 1GNQA 2G6TA 5JEJA 4N40A 1M34B 4QXAA 3I6MA 3RH0A 3S68A 1GSAA 2XAUA 2CHVA 4ZVNA 3ZNPA 1J7JA 5K3EA 3OZFA 3THXA 3ESBA 3P8ZA 4EGQA 4BXOB 1LF0A 4EUEA 2SICE 4AW9A 5KHOC 5TQJA 4UNNA 1QGDA 3QE3A 4RE5A 4RD6A 2JAPA 1KHXA 4O2AF 4P4NA 1DKRA 1RLIA 1NOIA 3NPMA 3W2IA 4CF3A 3QFFA 4YJGB 4WRRA 2NP6A 2YHAA 2R9VA 5EHNA 5G40A 3GDOA 1QK5A 3IAS6 5BYBA 4RDXA 3CVYA 3F1LA 1HT3A 2PWBA 4HLCA 4YRRA 5FTNA 2B20A 2JIZA 4RY9A 3MWFA 5KYKA 1EFRA 2PS3A 1Z6ZA 2ZYSA 1C50A 3B5IA 1T15A 1S2OA 3LUAA 2REQB 3WJ2A 4MVYA 9MHTA 1W8DA 3ZE7A 1HE1C 3UYKA 1DQPA 4X6XA 5I7FA 1YTUA 1YSCA 2D2EA 3IEKA 3QW4B 2PE5A 1NXWA 3Q9UA 4UUQA 2B61A 2CLHB 3HV2A 3PQ8A 3KJZA 1W96A 2QJRA 1O6GA 4MDHA 3QLVA 4PC7A 2VYCA 1P0QA 1MXFA 2O0MA 3BGVA 1B93A 4YS6A 1U7TA 1GCUA 2AQHA 2VCHA 3HGTA 3I5AA 4MWOA 4TSFA 5D2CA 2KMLA 4A10A 3D0QA 1CF4A 1R4MB 2ZBRA 4YBRA 2I65A 2EFYA 4RZ2A 4FOSA 1E7SA 1I3KA 2OD2A 3D3NA 1X2EA 3I6IA 2EF0A 3NPAA 1CZLA 1NT2A 5AI5A 5JPCA 3OQOA 4ZO6A 4OX9Y 4IR7A 1S2GA 3A4YA 3FLMA 3O90A 4JOBA 5AH0A 1FJXA 2CLCX 1IATA 2JGJA 3SS9X 4J1NA 3CRRA 5EYPB 2OM2A 3A58B 4JC0A 4CQLB 2O0KA 2UUPA 5JHGB 1H94A 5FPQA 2PGLA 4HQRA 5AHRA 3UK2A 1W76A 4EL0A 3LT0A 5DM70 4UEQA 5IDXA 2QNRA 3C4QA 3V97A 3SOZA 1XRQA 1WBJB 3DC2A 4DARA 3WA7A 3BSFA 2Q0QA 5DNAA 4EZBA 1QYDA 2ZYUX 2G76A 2W4QA 4WTOA 1XO1A 3BS4A 4YT5A 6PFKA 5ED4A 2NSDA 5JY6A 2AG8A 3L7BA 2J4FA 3NFYA 1H0SA 2J3JA 4ND6A 5JJLA 2P4UA 1YXMA 3FWZA 1Z39A 4W7SA 4KFSA 4AF7A 4XH9B 1QWSA 4XD7D 3V1NA 1J4LA 2IUTA 5D6OA 4O3MA 3DOHA 1C0PA 2OXCA 5DLPA 2G0NA 2AHRA 3BMQA 1XEAA 3FCUB 4LRXA 5CGQB 3EF0A 2BFAA 3WK9A 1T8YA 1XTZA 4O1MA 3HB0A 3WMWA 4DRXB 3CZ5A 4F5EA 4HY3A 3AW8A 1KHTA 3VX3A 4B09A 1XKXA 4OKSA 2J0UB 3STYA 3EVTA 1TD1A 4HAYA 3ZN2A 4H31A 4NZYA 3GT3A 4X3CA 3CT4A 2VDUE 4R0NA 5H9WA 3CVJA 5F3DA 3VNVA 3T7DA 2FPIA 5ES4B 2AZMA 2X19A 3SVLA 2GTPA 2OLKA 4D8UA 3PNVA 2ZPUA 5HF6A 2D06A 2OHGA 2P0YA 4ZN6A 3EEQA 4GOOD 4MUHA 4I5GA 2C2BA 1V48A 1ZPDA 2W2LD 2CZCA 1AUVA 3IODA 2XNDA 1I5EA 1NZJA 1CWUA 1JQDA 3ICCA 4PGHA 2B7LA 1SCUB 1LSOA 4H0NA 1TUEA 2ON6A 3DHYA 3IR6A 1GPLA 1NMQA 4HEHA 3EQZA 2DUWA 4JYMA 5KHAA 3A2NA 3SJ7A 5CFQA 2PO5A 2Q29A 4TV9A 1I2BA 1O54A 2OYSA 5EEHA 5JADA 1UXOA 5EZSA 4PZAA 5FV4A 4YRQA 5JS2A 3NYRA 3PA6A 5DIZA 2QVYX 2DBZA 4F2GA 4JOQA 3GP3A 4O5OA 2MYTA 1WR8A 4QD3A 5E50A 1KKUA 3GUHA 3RVNA 3C7KA 3GLVA 3VC3A 1G6KA 1ZS9A 3PQ7A 5ECGC 1T1JA 1T4CA 2PT7A 4LHVA 4PR0A 3VVMA 4BFWA 4AUEA 2B30A 1IAQA 3TS1A 2H59A 4BO0A 2DB3A 1ZUWA 2GCOA 3V55A 4IEIA 1ZGHA 4LCBA 1YK1A 3CX8A 4HQNA 3DFMA 3VH1A 4UE3S 1VP3A 5B5SA 3DT6A 5BQ5A 4WZ6A 2FPGA 1XCGB 3MQFA 4P7JA 4Q3OA 1Z83A 4JLJA 4OP2A 4UDYX 2E5LB 3VR4D 3B3QA 1U2DA 2JFQA 2DFKB 4HDKB 4R16A 1NSTA 2V7GA 5EJGA 3D4NA 1EVEA 3K5IA 2HIMA 3PPYA 3NTXA 3A6KA 1J90A 4LWZA 3K9HA 4KRGA 4KW7A 5AVUA 2P6NA 3KLBA 1SUIA 2C8VA 3DAFA 1FMCA 4NMHA 1N2XA 1IUNA 3DZGA 2P91A 3KWLA 3LQFA 1XAJA 3NM5A 4TTPA 5BRNA 1PV4A 1R4AA 3AF4A 3KELA 2ZBGA 1QP4A 5EKXA 4X1IB 3KEMA 1MIOB 2CB9A 2WHXA 3CWQA 3PIRA 4IH9A 3HZRA 3PLAE 1TF2A 3U40A 4OP3A 1WV1A 5GPBA 4QPZA 3OE1A 3TD2A 2XXAA 5DEIA 4F85A 2P3SA 1LLFA 2NYVA 5K3BA 4UFPA 4OYRA 5JSHA 1L5WA 2C7VA 1YBFA 5CEJA 3BQNB 3MTDA 4Y1GA 4PXYA 4R6XA 2AOWA 2O6LA 1CKEA 3KU4A 5DOZA 2Z6UA 2P9JA 5ITZB 2Y6VA 3PSHA 4DIDA 3ZVMA 1PJBA 2V58A 4RCYA 4Z9FA 3VJLA 4CKXA 3P0EA 9GPBA 2FGJA 1GQYA 3O8DA 5IRCD 3HMKA 2R8PA 3N8IA 2GZDA 5EP1A 1T4GA 3LYLA 3TM5A 3UCXA 4K6MA 4MRRA 5EHGA 4WHMA 1R10A 3A10A 3P9QA 2XMPA 3WLQA 1H9CA 2BFMA 2D5AA 3RSGA 1Z28A 5J2UB 4QNNA 2HU2A 4BB6A 5KVAA 1ZR2A 1C8KA 2IOFA 5CW1A 1GDTA 3EW9A 2Z6AA 1CEXA 1CU1A 1LDBA 3GQVA 4I14A 4TKMA 3INYA 4G5XA 2QNBA 5AOCA 3R8CA 4KXQA 4EO4A 4BX9A 2JI8A 1GIAA 5FUYA 4N8DA 1RBZA 3ANMA 3W8NA 3ONNA 2X6TA 3EW7A 1L1EA 4RVGA 1XSEA 3TYXA 1PJLA 4MHOA 2OM6A 4R8RA 3QOWA 2JI9A 4HNAA 4X91A 3ZWNA 3I30X 5J3JA 1ZM7A 5BSHA 4C7JA 2CDCA 1GL3A 2XZOA 2D1FA 4QBKA 2Y8EA 1HV8A 3GU3A 1I1HA 1N6RA 2OCLA 3P0FA 4IOJA 5F98A 3LPMA 5F76A 1UJ2A 1AH2A 2H7CA 2J3HA 2R7NA 1V3QE 4H15A 5AMXA 4YR7A 4G1EB 4TKLA 3R41A 2LUOA 1J5PA 2JK1A 4FTWA 4NAVA 3UAWA 4M1EA 2I29A 1PR2A 2WQ6A 4J0HA 4FFBB 3N2KA 4FC7A 4KE6A 1JQLB 4RV5A 1E7YA 2JA2A 3L7KA 3CPHA 3JU3A 3ZWVA 2R7AA 2WWWA 4NH4A 4WOKA 2DKNA 1ES9A 1A69A 3V1LA 2AD5A 3I1JA 3MWJA 5EZYF 4F60A 4Q34A 3MOGA 4PQEA 1X19A 2UZ4A 1H65A 2WTUA 3GPIA 2FW6A 4DHWA 1JDPA 4CV0A 2H7XA 1ZINA 3X1JA 2VXBA 2QM0A 1G8PA 4RLFA 2IEAA 3E48A 3Q87B 4F56A 3QH4A 3R9WA 1DWUA 4TV8F 1JNXX 1M9NA 1N2JA 3EQ9A 1AQNA 1D9ZA 4W99A 3DBIA 1ZH4A 4Q9AA 2VAWA 4P7BA 4JQCA 2Q7DA 4PQRA 4ZC8A 4ZO7A 1Q44A 1EE1A 3UOTA 3D7RA 4NCHA 4E0BA 1KORA 4ZCPA 1E98A 5DW3A 3I09A 1SUAA 4QXPA 4ER7A 4FQ8A 2WJJA 1W5FA 3V1TC 3EK2A 4CM8B 2PSJA 1E6EA 3C15C 3KPUA 2C3UA 2RIRA 2FSGA 3L1UA 2ATIA 3QFTA 5G1PA 1O08A 1QHHA 2B92A 2G1AA 3HYRA 4AZ3B 1OZ0A 2CUTA 1EIWA 3IKVA 3O91A 4UHHA 4AXXA 3ZE2B 1OXMA 1D6NA 2BKXA 2JPEA 3IP3A 3QBDA 2PJRA 3ABRB 3UA3A 4J0KA 1D5CA 1LW7A 5LZ5A 4RC9A 3T7RA 1J8MF 2C61A 4P4LA 4G23A 4RSHA 3LGSA 1O6ZA 3PC3A 4WY8A 2W6OA 1T35A 3CH6A 4YAOA 4BMZA 1CC1S 1MAAA 3B5EA 3EVNA 4LE0A 1GVNB 4R9RA 1ENPA 4B2LA 2R4TA 4L2IB 1EUYA 1N6HA 4JN6B 1N1MA 3K92A 4BGUA 4X95A 2Y3IA 4UTVA 1VPDA 2PIEA 4URVR 3RJ9A 2FN8A 3OOEA 1ZISA 3PDUA 4TTQA 3VSAA 4HMQA 4YV0A 2ZLBA 1AXRA 1DAHA 4M9SA 4ND7A 4G5OA 1SOAA 1UDAA 1X1DA 4BECA 2PCJA 4V38A 4WA8A 2IZOA 3T4UA 4DBLC 3M2PA 2R68A 1I9GA 3G2LA 5B1YA 2FLVA 4DL9A 1A76A 3B1YA 5AKGA 3FKSA 1R64A 5DNDA 1HZJA 4RULA 1RRPA 2C00A 3I4CA 1YULA 4JNKA 2HWKA 3BGSA 4UM9D 3R4VA 3MIZA 2VDLB 3GA0A 1T6NA 3OZRA 2Z2XA 3Q6MA 4KG7A 3UA4A 1EUDA 4RZIA 1R9GA 4ZVVA 5LYJA 5EJ7A 2XODA 5D00A 2VSXA 5E0KB 3QKWA 3PDHA 4TWRA 4B7XA 2WF9A 3SIPA 4OREX 2PUWA 1TTQB 3EDYA 4YIHA 4L7VA 4ZCSA 1O6BA 2NZ2A 4FZ3A 3U1BA 4TQ9A 2XT9A 1NJ8A 1ZONA 4DBVO 1U3VA 1Z62A 3OVMA 1UZLA 5C5CA 3EC1A 2A5DA 1E5VA 2D7DA 1KMHA 3PPXA 4OGKA 1JQBA 1P5ZB 3LX6A 4QHTA 5EWMB 1KDRA 4ZVPA 4B3DA 3VMMA 4HLQB 4EFNA 1YUBA 3AB8A 2W0MA 1GU0A 3DEZA 2OBXA 4W5NA 3LHIA 4ND8A 4V0ME 1C7ZA 5T57A 1U28C 1E5LA 2WHEA 4EA7A 2BRUA 3KWJA 1O58A 3OZUA 2RC5A 4PGGA 3RVPA 3PENA 4LDRA 4DQLA 2LZ0A 1M0EA 5JD4A 4HVLA 5CDTA 1PR5A 2G07A 3U37A 3V34A 1MGPA 1UDWA 2WPNA 3L6UA 4PZUA 4WJZA 1VHQA 4BWFB 4OUKX 4DLPA 2J0QA 1ID8A 4V3BA 5EUCA 1WUTA 3I04M 5DNVA 1ZH6A 3BAFA 5BSTA 4JH0A 3OQ1A 1CDEA 3E6AA 2E89A 3NDIA 3KV1A 4KV9A 1IN1A 2HDWA 2P3LA 2Q62A 5C8VA 3F4KA 4GX0A 4N39A 3L6BA 4MI6A 1U6IA 4HGRA 5JQWA 2C9CA 2EERA 2GKOA 2Y2VA 3SXUB 3WIEA 3INNA 3SMQA 1FEZA 1IDN1 3IUBA 4X41A 5G0WA 4BMDA 5CB0A 2I9KA 3H86A 4UD6A 4PQFA 1W52X 4EG5A 2R5NA 4CLRA 2XTNA 1G42A 5GWXA 5F52A 1TVEA 2Z3ZA 4KQ6A 1W1IA 4LXUA 4PLPA 3IBGA 4LXHA 4KVZA 2AN4A 2YZKA 1GILA 5TQ2B 1FLVA 2V5UA 1NR7A 3MEQA 3OP4A 5CM8B 3T4PA 4DTCA 5IKPA 1HXHA 2ZBPA 3L79A 3HP7A 2WE7A 2VJMB 4PAWA 1YZKA 4RTSA 3ESDA 2PWAA 1S8OA 3TK1A 2DQZA 1X74A 2ZI5A 2I6GA 3AR7A 2FG7C 3IRUA 4QQFA 2A0WA 2WTXA 3BD9A 3EGDB 3NP9A 3UK1A 4AC9A 1H5QA 2PX8A 4TWBA 5CUQA 5FA8A 4NX2A 1XZDA 5T41A 4B3BA 3F0TA 1ODLA 4D41A 2NXEA 4F3YA 5KNCA 1ESCA 5M04A 1A7KA 2I76A 1Z13A 2QMQA 2Z5FA 3DTVD 1TA9A 3JR3A 4IZHA 3QMWA 2UUAB 4OQLA 3HVHA 5K0NA 2GBCA 2GHQA 3N5CA 4W5WA 4XQGA 5K4AA 3E7WA 5KNDH 5CVVA 2AG0A 2O9JA 2XVMA 1ABEA 2L82A 4XCXA 1LQ2A 5IXJA 2QL9A 3CZQA 5DXAA 4X1YB 4X66B 4D26A 1TFRA 3L4KA 3OOYA 4M9ZA 5K7SA 2BBWA 1OV4A 1H5NA 2QRMA 2OCGA 3D8TA 4N9WA 4AYWA 1W0KD 2NOAA 3PFHA 3MRXA 3UHFA 4BEJA 4RFVA 3RUAA 4DCTA 1VCIA 4UNIA 3ZWWA 3HDJA 1ZICA 3PQ3A 5BUZA 5KQPA 3EEYA 3DVAA 5IM4A 1HYQA 1ENOA 4RIIA 5D7BA 3NTQA 3LM8A 2C2HA 1O95D 4A8JC 2ZIEA 3VZPA 4N7JA 1Y4AE 1MT0A 1U1GA 4UBJA 2CBXA 3IMEA 4JR0A 3DD5A 3WO0A 3ZIAA 2X14A 1EZZA 5KTRA 2B6HA 1WEHA 3CRNA 5DM2A 5F1OA 3RRBA 3JQFC 1PTJC 5E8JA 4D79A 5IFKA 3QX3A 2AW3A 4D81A 1NDQA 2PUVA 4LRTB 5F73A 5TPZA 1HYEA 4AJ2A 2I54A 3G2JA 4GRAA 3ROEA 3BE4A 4MROA 3JYPA 1MABB 1MJFA 1UT6A 2AYXA 3RE1A 5BR4A 1T29A 2FEKA 4TYNA 3BGOS 1VL5A 3IFSA 3IUQA 1ONBA 4WCDA 1YBAA 1JG7A 2UYYA 3OCCA 4TXJA 3P94A 5CK5A 4YGXB 3SBEA 2X9GA 2CXHA 3GFVA 5H68A 3SY8A 4PWYA 1EFTA 2WY2D 1F1BA 4GYWA 2WOOA 1EFVB 4JS0A 1PG0A 2FPLA 3UUGA 3RUIA 4HH3C 4D74A 2HLDA 1U4SA 1NATA 3J80A 2AT1A 3RRJA 4WBNA 2JHCA 3OA0A 1G4HA 2FWMX 3O5AA 2PNJA 4DCSA 1PS0A 4JR1A 2GK4A 4DR4B 2C5FA 1VSUA 4MW6A 3KEOA 2HNBA 2H54A 4HWPA 2H1IA 4G81A 4PLFA 1B6GA 2OC9A 1VIVA 3OESA 3C3JA 3OQBA 4HTFB 5JCOA 1Z26A 2KPOA 4M3NA 2EWWA 1N7IA 2R48A 1BGWA 3FFTA 3ROMA 1OWLA 1JKJA 2GHIA 2H1RA 3LQKA 3NCHA 4QQ8A 2QX4A 4OO3A 2ID7A 2C0PA 4URWR 1ZA2A 2OR3A 3BCSA 1ODIA 2EKLA 1MAVA 4KQKA 3TLMA 1UWLA 3M6VA 2PY6A 2Y0CA 1ZC3A 2J6IA 5TGDA 3UMMA 4N5HX 4P3KA 3OKPA 5EMNA 3L8EA 1Z37A 3SZLA 2R6HA 4ROSA 2QXTA 5FFMA 4C6TA 4BQIA 2AQ8A 4XSVA 5A2GA 1P39A 4LXIA 1AXEA 3NBAA 4YRAA 1AF4A 1E0KA 4IQ4A 1T4BA 1CUDA 1T5IA 1T9GR 2NYRA 3HP4A 5EZQA 3RF6A 1FVFA 3LT4A 1N34B 2DECA 2O8DB 4AVYA 1ZHHA 4AZTA 3RJMA 4WMLA 3K0BA 3CBQA 1VIYA 3IE2A 4ZDKA 1T2FA 2WP0A 3UT5B 4G0OA 5L8VA 2QN1A 5IJXA 1XA4A 3IBCA 4UZFA 4OHMA 4P4SA 1WZUA 4UNSA 2HMSA 1Y9ZA 1LNQA 1Z2CA 2IC5A 3PGXA 1O6FA 4HFNA 4MQBA 1WTAA 3WLKX 1NVWQ 4HS4A 5BW4A 1IXYA 2VP0A 4DJFC 5IC6A 3EFHA 4BNNA 5BSVA 4Z7NB 2N0SA 1CUHA 1OFHA 2I3GA 1WV3A 1TJNA 2I71A 4ATNA 5DHAA 3H2HA 3FVWA 2R1ZA 2VCYA 3UBTA 1DEXA 4BWVA 1TUGA 2YWXA 3LAWA 3ZK9A 5JUWA 2OILA 1FUYB 4CIAA 1GZ6A 1VGQA 4LF9B 3F2VA 1DWPA 5K45A 4K9NA 4O1IA 2H3HA 3FVTA 3M1IA 4UVGA 3BICA 1DV1A 5KKNB 4WCVA 1EDZA 4RAOA 2AIRA 5EWJB 1LPBB 5AW7A 4E1AA 2EGUA 2ZANA 4PC3A 4HUTA 3O2QB 1Y8RB 3UHOA 4BOYA 2XCRB 3GLIA 1B2LA 1HE4A 3E5NA 3R0XA 2UXCB 2QT1A 4PW0A 4LV5B 4EUNA 4H7IA 4M6WA 1W36C 2JB9A 2Y76A 3DOCA 5CLHA 5EFZA 3M70A 3NQ41 2P3OA 4KHZA 4CGYA 1J06A 1TW2A 1ZJZA 1CQPA 1U0OC 2P6UA 3BXPA 5FULA 5CJPA 5H3HA 3IEVA 1DXOA 1OXTA 3QTTA 3QWIA 4RS3A 4YRGA 1SVUA 2QYTA 3IESA 2C5AA 5GVSA 3CUEF 4I4TA 2YWJA 5COAA 2E55A 2W8BA 2XMRA 4RIGA 1SG9A 1Z0DA 4P4UA 5TQ0B 3OFNA 2JGEA 4ZO8A 3RRYA 3NH6A 1T5HX 1QB7A 1GUAA 2X1VA 3UMCA 4COOA 1I7LA 1P6UA 5GZ6A 4BQSA 2BTEA 3JAWB 4C3ZA 4ASUD 1YQEA 2Z57A 3LTEA 4QFDA 4J9UE 4RNDB 1U8AA 1NE2A 3C6ZA 1XCLA 1V1RB 2CCKA 5E7IA 4GKBA 1QIEA 4H3VA 1JILA 3RF7A 4MKFA 1ZH0A 1HE5A 2OHJA 3SAJA 4O8CA 2WIKA 1CXZA 1LFDB 2FZLA 2LKCA 2NAFA 4I4LA 2IP1A 4N3GA 5C8YB 2X41A 1FW8A 1PX0A 3BREA 4CIBA 1GGHA 1WDKA 1XZHA 1SOMA 1VBNA 5GIOE 3MHPA 1HWYA 4AU1A 4CKYA 1YA4A 1Z36A 1USVA 4QQNA 2XRZA 3GUYA 1J1ZA 4FIZA 1NMZA 4LYHA 4FXOA 3PKIA 1OASA 3CNEA 3CIOA 5AJUA 2BMFA 3EAFA 4BNMA 1M2FA 1X9IA 1R6BX 3BF8A 4O6VA 3PQCA 5LDHA 4UAGA 3FOFC 3QXCA 1MKYA 2IPXA 1GPJA 4EYSA 1WD7A 1IN8A 4GVLA 1QORA 3UC9A 2NPOA 2QHXA 2C5EA 3C1OA 1J23A 3ADKA 3IVRA 3HY4A 4BN5A 4CTMA 2WQ7A 2PN1A 4NNOA 1JHPA 5BOVA 4AI6A 3AVOA 3HN7A 3JZFA 1UDCA 4KGDA 3U3MA 2QKYA 2OFFA 3KQWA 4ARAA 5C52B 2HA0A 2ZRPA 1CY4A 3GGJA 3T9CA 3W4IA 4C6SA 5TR9A 3I6YA 4MEAA 4CIDA 5I9LA 1RZRA 3G0DA 4TYYA 2Y1DA 1Q92A 1JEAA 1Z6QA 3TW0A 1JLRA 2VRBA 3TGLA 2WJWA 4LZWA 4TWZA 4LIPD 1KGSA 1KO5A 4KL8S 2GTIA 4XUEA 2H11A 4YAJA 1Y1RA 3JYNA 3Q9LA 2QYSA 4MOWA 2WI8A 3CRVA 4BY9E 3FDZB 2CNNA 5GINE 3I28A 2HWXA 2WOJA 5JXGA 4E4TA 1X0XA 4YP6A 2DUNA 1NJSA 1ZSYA 4GC9A 5LUBA 3D4PA 4AP6A 4FEGA 2WKWA 3LC1O 2JD0A 4L4ZA 5KQMA 2AJTA 5KU1A 1F3LA 1P9OA 3DAHA 2H48A 3NHZA 4MR7A 4BO1A 4PN3A 3BT7A 1WRBA 4XFKA 1JJIA 2VHQA 4NP6A 4JODA 4UCQA 4KQXA 1DT5A 4YUXA 3GAAA 4E4YA 1QYWA 1YZQA 3RVOA 5KOHB 5HIMA 1GAXA 3IQWA 4EY3A 3RO7A 3W9UA 2OO5C 8OHMA 1UFKA 1YDHA 5E38A 2DLNA 1IY1A 4NBKA 3IV6A 3FUTA 4H59A 2BUBA 2IKSA 1VKNA 1JSRA 2WDZA 2HPHA 3AEZA 4O2AB 4RE6A 1UP7A 1FTQA 1LK5A 4K5QA 4XVQA 2BFFA 3BA6A 3RTDA 4TSRA 3FYDA 4ZQGA 1DKQA 5CNJA 1QS0B 5CBKA 4OMFG 3SC3A 3DVSX 2QSUA 4W5JA 1GZSA 1JA9A 5B6JA 1Z4PX 3BFVA 1LX7A 3LX5A 1RI5A 3B1ZA 2O7VA 1CDOA 2WIGA 1DCFA 4N3CA 1VG9B 5FNVF 1XVVA 4OPMA 2PUEA 1E89A 5ENVA 3V3TA 2KBFA 4YQZA 1F9EA 4JBHA 1K3NA 2I3DA 3CUWA 3HBFA 2XB4A 4A2QA 5A5DA 1UQTA 4KUHA 3G2NA 5IAJA 1HT2E 3QU4A 3LUDA 4D5EA 3DAGA 5EXEA 1RRKA 3U3JA 2HPZA 1Y63A 4YI5A 1M6NA 1N0VC 1WPQA 2VH2A 2VPQA 1QHNA 4FFNA 1OKKA 5DX0A 4FJ2A 3V8QA 1O03A 2WWIA 2UXBB 1TUBB 2ZIUB 1EX1A 1Z3CA 2SCUA 2XB6A 4E30A 4QVGA 3H4VA 2WZCA 1UFRA 1ZXBA 1BVYF 3OECA 3N5KA 3RC9A 2CJWA 3VR5A 1A5SB 5LPNA 1AA6A 3R7WB 1IUPA 3JQGB 5TARA 3PCXA 1YVUA 2YXPX 4G4IA 1VCMA 4IIUA 5M3BA 1G18A 3L01A 3CG4A 3RABA 5L45A 1PV1A 5TMDA 3LK7A 4AROA 4E11A 4RTRA 1C9EA 1ZIXA 2IV2X 3KVOA 2X4LA 1U8FO 2GJ4A 4F4DA 3WFIA 5L3QB 1FSPA 1CZUA 2ZRGA 3FBWA 1PVDA 1RW4A 3DMHA 1FFBA 4L6IA 1S1MA 4K40A 1XL0A 3TLAA 3ZUPA 4BC0A 3LTNC 3CZ4A 4LMPA 3UT0A 1Q0SA 1ESDA 1Q7EA 3PA8A 5HNKA 3WB2A 4I5IA 1RQGA 5LVAA 3EUFA 2A7QA 2FRXA 2HIAA 3A9RA 3K8QA 3Q1LA 2R97A 3TNFA 1XQXA 3MQ4A 3WRYC 2NUBA 1NC1A 5KEIA 2F3SA 5AKIA 4L9AA 4D4GA 4H17A 4UBKA 1BJKA 2ZP1A 1B0ZA 2I8LA 4BMNA 3DEIA 2E7ZA 3H2JA 2QJWA 3IBYA 4REMA 2GDZA 2BMEA 3GT4A 4AMBA 2A1UB 1JG2A 2J9RA 1A9ZA 4LSGA 2ODTX 1J9ZA 3NHAA 1EK0A 3PEFA 1D8AA 1JW9B 4FIDA 5B7QA 4NYJQ 3BM5A 4Y2YA 5LXTF 3I23A 5KC8A 1OFIA 4M38A 4X20A 3HCOA 1WZCA 2PX4A 3KHSA 2DWQA 3EA5A 3HWSA 2QQGA 1QYCA 2Z1NA 3H6GA 1KDVA 3WNZA 3GNLA 3WOVA 4BATA 3PDCA 1POXA 4JL5A 3S7ZA 5LB2A 4X0EA 4R8LA 1KI7A 4XYMA 2NQ8A 1K7YA 3DA8A 4LOKA 1LTHR 3H9QA 5CDSA 2ZJ1A 3HHEA 3TBHA 1M0SA 2VJPA 3DWEX 3IH5A 3WGZA 4YAFA 8ADHA 3Q5GA 1TTTA 5K3FB 4JX9A 4CMIB 1QX4A 1VKRA 2PNFA 5B3JA 3A1TA 3HLYA 3V4OA 3UWSA 5EFOA 5CG2A 4HRXA 4WNAB 2FSFA 2O8NA 5DU2A 3V2GA 1M7HA 3PNBA 1YUNA 1GLGA 1JJFA 2C1EA 3IJRA 2Q3LA 4IIJF 2GO7A 4JHXA 4OFXA 5H0IA 3TOCA 1CNMA 2R44A 5KMGA 3WLNA 1I4OA 2C59A 4BAUA 4IDDA 3ZLUA 1Q3HA 4CT5A 1Q0PA 3AF2A 5FEUA 4YALA 4CG1A 1FVHA 1E4VA 3MS2A 2O8BA 1JAIA 1CFZA 2G36A 4HEQA 3UHPA 2QV7A 5JNVA 3MWYW 1GTVA 3GVPA 4K8OA 3UJBA 1HDIA 2WAMA 1QH1B 4HN4B 2GNOA 4L22A 3FDFA 5DCWA 4E1BA 2DFPA 1YASA 2HHAA 1YUMA 3T1NA 1XR3A 5J1SB 1DJOA 5B36A 1GA4A 4IRXA 3BFKA 1KH3A 4A6DA 4B9AA 5LIRA 4KO8A 4EGCB 2I7VA 1K3UB 3CSSA 4G9EA 5B6PA 4XDZA 1KBZA 2PJUA 3CLSD 3T54A 1YC2A 4FW9A 4XDGA 3T7CA 3B1XA 3NGMA 2C2MA 2GJAA 1SA0A 2ODNA 1SQ5A 2YJ3A 2C9MA 2EJBA 1SXGA 2GAFA 4FHCA 3UUEA 1A9XA 1IVSA 1W73A 4LHYA 1HNWB 2JIMA 3GN2A 4I50A 2FDCA 3ASYA 1OJLA 3WOHA 5M34A 1L4EA 1OBHA 1W4BA 3KPJA 3LT2A 1CDZA 5B7GA 4QODA 4B6PA 1FE8A 1YJMA 4A8JB 1VL0A 2X8LA 1OLSA 1M76A 1P7YA 3JD4A 3P20A 4C2AA 4YN3A 1N2CB 4WFQA 1G9TA 3DFFA 1S2DA 4LOLA 3TVTA 1IWBB 3UQZA 1PGJA 3VXKA 1YS1X 4BNDB 1E8DA 1Z0JA 3PLRA 4NLLA 5AHKA 5EPUA 1SZPA 3TDNA 2OKCA 3WBFA 5B1HA 3CN7A 1KJQA 2XUAA 3FOWA 2O8CA 4IZIA 1RRMA 1JQKA 1K0FA 4BKMA 2HXYA 1M8KA 1DE0A 3ZDDA 3U5TA 4KVFA 4WEOA 2FJUA 3UGTA 1DCTA 4Y2GA 2HY7A 5EMJA 4FR0A 5TJ9A 1ODCA 4EKDA 3BJRA 5KNBA 1A7UA 4E4RA 1OTYA 3PLNA 4Y67A 3NUGA 2NSYA 2HN9A 1RXIA 2P2LA 3ILHA 2OORC 4Q1FA 5BNFA 1VE1A 4S0XA 4KO4S 1F3OA 1GKLA 4IOLA 3IOBA 5EJHA 2CXSA 4K46A 3HHPA 3MG9A 1KPGA 1BDMA 4XD7A 2CVFA 4DM3A 1QVZA 4GMKA 3A06A 5EJAA 3SBXA 4BFTA 2IUFA 1BRMA 5H5JA 2XMZA 5DHPA 3V8MA 1N3IA 2DWUA 4WPGA 4B3MB 2IS2A 5I4KA 5E6RB 3IV7A 2JCXA 2VZ8A 2O5CA 1MK2A 4BNUA 3COZA 4LV6A 5DZSA 3N2GA 3VZRA 4JYAB 4ACBA 3CKLA 1ZWLA 5BN5B 3UV3A 3JTMA 2YDXA 2HUNA 4MULA 4GLLA 4WV3A 2AZTA 3CUSA 1J2YA 3KZCA 4IVQA 1GPYA 2ACWA 1XTUA 2AA3A 1ZMRA 3H7AA 3MWDB 3OG9A 3OT4A 5CT6A 2GA9A 1RBMA 3GGDA 5HF8A 1S4MA 4JQSA 4JVNA 3OFJA 3DMYA 1K0UA 2HHCA 5KQLA 3O2JA 1Z7GA 5A5FA 1ZGAA 3P52A 1IBRA 4TUYB 5HWSA 3A9UA 4I1IA 5KYGA 3KSDO 1GZ5A 1WDMA 4O29A 1QGUB 1KDZA 1Z68A 3GRAA 4Z9BA 1P6XA 4E5PA 3Q8MA 1QOZA 2QL6A 3LWZA 3PX7A 3CF0A 2FZVA 4MCAA 3DUFA 3E61A 3ZD6A 3OIYA 3KQQA 2G80A 4OGLA 4C2BA 1ZJJA 3BILA 1NQ5A 1QPGA 2C3YA 3SE7A 4R9PA 1A5AB 5KWEA 3A9WA 3QPUA 1DRUA 5EZYB 3TNLA 3Q15C 3LT5A 5GGYA 3USES 1VE6A 2BR5A 4NYIQ 3VH2A 3CXRA 4OHRA 4J6FA 1KZ1A 1ZMXA 3OLZA 5JEOA 3BL6A 2YDYA 1U0JA 3L8MA 5KTPA 3HA5A 3A4IA 4C5AA 2IHUA 1IM5A 1HQYE 4XYEA 3MXTA 3ROTA 1V39A 3RUCA 5A6VA 2Y1KA 5FQOA 3VR4A 3GZTB 3DL0A 3ZHOA 4TV8B 4Q4HA 3GFBA 1W29A 3RFCA 1WXWA 2FK7A 3W1VA 5KOJA 1NMXA 4TXNA 4Q3NA 3TUIC 1CFJA 4EI8A 1DGQA 3MW8A 5KTMA 3A3PA 1BEUB 3DMNA 2GARA 1X8JA 4JLAA 4X60A 3UW3A 1ORDA 1L5FA 2FPRA 5FRDA 5DVZA 3TD6A 3KZXA 2CFTA 3V7WA 2A1IA 2FPOA 2ZWOA 3C1AA 4KJXA 1JFSA 2YWDA 2BKLA 2DQSA 3PD7A 2HSWA 1W36B 2PBZA 3W6PA 3NEJA 5K0CA 1TMGE 1IJEA 1SIOA 1ECBA 2ERYA 2J59A 2FMUA 2R8YA 3EBLA 5ALPA 2WRZA 2Y0BA 1J22A 3FROA 2ZR0A 3R3UA 3ZY5A 1T5SA 4DR6B 3W3AD 3WK4A 4BCBA 3BIXA 2AK3A 3RSOA 4BGEA 2HREA 1WSDA 2VHUA 4FDLA 4K2AA 2EQ5A 3ENVA 4P2BA 5E7JA 4ESHA 3TZCA 3DPUA 3WWDA 3AEQB 5DSXA 2OECA 2WUVA 3ONVA 1NVUQ 1XQYA 4PFSA 2AEMA 1VI6A 1YKSA 2WT4A 3GEBA 5BSRA 4HDCA 1RWWA 1WF6A 3UPTA 4Y18A 5FWXA 2EF1A 4WKGA 1FQOA 3CSDA 3CF6R 1A9SA 3QK7A 4C0WA 3WZLA 3K8YA 1XJCA 3N2NA 3DLAA 4JUIA 4PZZA 5KDDA 1U2QA 2AKAB 3R74A 3IDSA 2FQXA 4LSZA 3C3WA 4IIFA 3BTSA 3DYVA 3N3BC 5DM60 2J4DA 1GOTA 2JGAA 3AF3A 3B7PA 1P60A 1UM9A 1W9MA 3CLRD 4BEVA 5DB4A 5K6AA 1Z0SA 3O74A 4KREA 3PHCA 4F7DA 1KI6A 1FMFA 3NRJA 1E9CA 4GLFA 3JWIA 3F3YA 3WGUA 1CZKA 1D2CA 1YOBA 1MR1A 1NW4A 2MWMA 2ZR8A 2C94A 4BO6A 3INRA 1E2NA 2VPWA 3ELBA 5L51A 4TYWA 4N7RA 5I7AA 1MV5A 4YASA 1JEYB 3DR3A 1D2MA 5JCPA 2HHJA 5HM6A 2GM3A 4QC2A 1CJKC 3FOEC 1GKUB 1L4NA 3A2KA 1T0PA 4MQLA 3AK4A 1W48A 4FFSA 5CYPA 1ZVMA 2XUJA 2BD0A 2BEWA 2BFPA 3UAXA 2JQJA 3ZDFA 5COQA 1QUFA 4PLHA 1SOUA 2C4HA 4DADA 5JPDA 1ZVKA 2YN2A 4PCAA 1P2FA 3TW6A 1TB4A 1IFXA 1Z5NA 3F8SA 3QVGA 5KYXA 3GJQA 1MPXA 2DJ5A 4BIMA 2VHYA 5AW1A 1WKBA 5I5EA 4MXDA 4KN5A 3Q3VA 1NJ2A 3ZV4A 4R1NA 4F0JA 1VOTA 4AO6A 5HJ7A 4MWEA 4EKYA 5E2AA 1L1FA 1QVAA 4PLCA 1RYFA 3DQPA 1CJTC 3LNTA 3M81A 4FZJA 4I9HA 4YGYA 3UXHA 221PA 4INPA 2XAAA 1YZHA 3UMBA 1E3LA 3DHWC 1YMVA 2NTYC 3L8YA 4Z4QA 3R2JA 1RWNA 2ZI3A 5F7XA 3EXG1 5HMLA 5BW6B 4F6LA 3AF5A 5HP4A 1Y3HA 3C1UA 3ETGA 2H4YA 2ZSEA 3V3KA 4CEJA 1I7PA 5JSFA 3UMZA 1WDLA 2YINC 3MB8A 1IJKA 1EIZA 4A82A 2GWRA 2OG2A 2OOSA 1JI3A 4CBVA 1RHMA 3KKLA 4FGSA 2WUDA 3LVQE 4ZOQI 4RKFA 2LIVA 4PNEA 1YIAA 1DAMA 1E1QD 3KWFA 1XZPA 5JRDS 1B26A 1X8LA 4WASA 4GYJA 3T5AA 4P08A 1FPQA 3ROPA 3UCEA 1ZL0A 4YUAA 1EHYA 2RHLA 3J7AC 1YTLA 2FZWA 1YR8A 2O2GA 4Q01A 2IPNA 4XIJA 4J1SA 1WXHA 4LZJA 1YE3A 1IIRA 1MU0A 2RB5A 2WMYA 3K72B 7ADHA 3R20A 2FQWA 4MWSA 5KDLA 5K1ZA 3IIKA 4L8GA 4QBTA 2IOFK 4Z9XA 3VZCA 1AM4D 4JC4A 4GLJA 3SX2A 2NT4A 3C70A 1RYMA 5CEEA 1TZ2A 1ZDMA 4PC1A 3S2FA 1NRXA 3N70A 2VATA 3JVVA 4QELA 3W8RA 1JHUA 1GSHA 2F1OA 3JYLA 5JC8A 4NPAA 1PSDA 1WY5A 2HJGA 1JEOA 4PTLA 4Y9RA 1ZK0A 4G0UA 3LDFA 1JAZA 1J21A 2VL7A 1XTVA 2O06A 2X0RA 4K9QA 4P80A 3TLCA 4JGIA 1T9BA 4WXMA 1YZ3A 1E3WB 1EGAA 4C4AA 4GOKA 5FYQA 5AJVB 1VLMA 4HXFB 1GTG1 4OGFA 4CV3A 4N8SA 1EM8B 2RGRA 5IAGA 1SZCA 3FPCA 3UMSA 4BJHB 2Z98A 4XYLA 1E8NA 4UM8B 4W9NA 4AD8A 3GPLA 4EYQA 2CYCA 3D31A 1P6QA 4TKZA 3GDHA 2OWEA 2GSDA 2JLYA 2D3WA 1A27A 3TFQA 2HOQA 1QRUA 1MORA 2NZVG 1X42A 1IE3A 3CRMA 2DU8A 4GSLA 1G38A 10MHA 1UT8A 4GICA 2EKDA 3TQQA 4AS1A 1IEVA 3QNWA 2I4TA 1J2TA 1NVDA 1E5XA 1R4NB 2Y99A 5EQTA 3HJAA 4BLVA 2DR0A 2A94A 3FYUA 2VDJA 2QUIA 3NASA 4BV9A 5JDIA 4MVJE 3K35A 2IX3A 5GONA 3H8JA 2JQLA 1XL1A 4CQMD 1RKUA 3E84A 3MZ0A 1I6KA 4XW2A 3PR2B 4M0FA 4QQRA 2R2AA 4WXPA 1YRLA 2P78A 2PX5A 2UZAA 5A71A 1H2WA 3LP8A 1CB0A 3MLBA 4B1FA 4UM7A 2I1QA 1NUTA 1G8MA 3IOCA 2WYHA 4YJHB 5BW5A 2RHBA 2ZBUA 4AJKA 2WFZA 4CV1A 2VDRB 2OD7A 3FETA 2ZU0C 3IYLW 4RY8A 2X13A 2I91A 2E9SA 2WIBA 4I1OA 2J4CA 3EDCA 4UXIA 2RH9B 5JSUA 1QQ5A 4C0AC 1FJGB 2P0EA 4M86A 4OCZA 3BHIA 4ENPA 1U5BA 4Z1MD 4ZCMA 2O59A 4JNCA 4JP1A 3REGA 1CUBA 2L18A 1GZHB 2NUPA 2YJGA 3ADOA 1EDDA 4QUBA 1FFYA 3A1CA 2AXEA 3FGOA 4I46A 2HRBA 2PEYA 4KXNA 4MX8A 4DZRA 4D3SA 3PQFA 1JE0A 5CW2A 1A8PA 2Y0PA 1K86A 3HRIA 1CJSA 2QDXA 1EVKA 5JZVA 5K8IA 2O8FB 3RS2A 5JWHA 3K71B 4ZMSA 1J70A 5JNRA 3TL6A 1AGXA 3BGWA 4I5DA 4OAPA 3KOOA 4GX1A 5LNK1 1ZW1A 2YXBA 4RWZA 2ZZMA 4QE3A 1QU3A 4IV8A 3B9BA 1U80A 4YAEA 4BNGA 2OHXA 4C9BA 1XDWA 3GXBA 2JASA 3FYHA 1KYIA 2XUDA 5BN4B 5LKRA 3BCRA 1SELA 3S27A 1J9EA 1NKSA 3MS4A 4FWIB 5DNEA 2JAQA 1C8VB 2OHHA 3O4VA 4RGVA 4TTIA 1PEKE 1BG6A 5DLQC 3T7EA 2ZAOA 3CLKA 3VKUA 3DDSA 3ZOKA 4RADA 5C7OO 4HLNA 3K1AA 2HXSA 1V5WA 3ZQ4A 2WD7A 4Q3CA 2DG2A 5DEOA 2FXVA 2PYZA 3LF2A 2F7SA 2E4ZA 4EGFA 1PUJA 3D8SA 1JEQA 3AYZB 3ZE9A 1U2TA 5NULA 4CLHA 4FD2A 4HNUA 2ZVPX 2BJWA 1QF9A 1EA5A 2PPLA 1TT5A 1JIUA 2X4DA 3G2HA 4EG0A 4GQAA 2VXYA 4RPCA 2BFBB 3GGPA 1Z45A 2FPWA 2IUSA 1E7QA 2OV1A 2Y1WA 3DTVA 3GWZA 4HD8A 1NNUA 1NP7A 1L6IA 3LX4A 3LI2A 4MW5A 4PO3X 5LZ8A 3T7IA 3GLGB 4LOIA 3SF8B 2VJAA 5LBUA 4NDZA 3R8XA 1G2OA 2ZDHA 3ESAA 1CZOA 3PJFA 4MYTA 3GYBA 5ELLA 2JFOA 2GK3A 2I7CA 3KVVA 4ENRA 5A04A 4WD3A 3HVUA 1Q0LA 1W0KA 3FB1A 2ZUWA 2ZITA 4FYYA 2WYWA 3UY4A 3ORHA 3NH9A 3T99A 1MZPA 2X22A 5TPWA 3IPYA 5IZCC 4WVFA 1G8YA 4TTTS 1E6UA 3ZH2A 5LN1A 3F7NA 4S12A 1O95A 4LYGA 1NF8A 2ZRLA 3AEUA 3OCVA 4MW1A 2HMYB 4IDQA 4CG2A 1NV8A 2FFRA 3U7QA 1G1MA 1VL2A 5AK5A 4GO1A 1QJCA 1VCHA 3OI7A 3OU2A 2NU8B 2O2IA 3TRKA 3LWNA 1KY3A 3UWOA 1VRWA 5EPEA 4E5UA 3CNOA 3L0SA 5AXDA 2YVQA 2G88A 2OCKA 1H9BA 2PMFA 2MSCB 2XNSA 3GP5A 4XB1A 2CN1A 4BVKA 3O7MA 4OMUA 2OCAA 4HR7A 3DKKA 5LCXA 1OBVA 5C1OA 2C5LA 4JAVC 1UOPA 2AE2A 2D5LA 2LP4Y 5A4MS 1VGVA 3UJ8A 1BN7A 2H4WA 2JZNA 1OGYA 5FD8A 1A5TA 4QU5A 4K0KB 1NWCA 2GD0A 5DNYB 1E3DA 1EZ4A 2O5VA 3OPVA 1TDJA 2V65A 1Q6YA 1JHDA 4FINA 4EEKA 2QROA 2PZGA 2DF8A 3IBSA 3KOYA 4U7GA 5UKDA 3GVHA 3ZW7A 4EDHA 1FSFA 5I7SA 1NI4B 4PPNA 4F12A 3HFGA 4NRDA 4Z3DA 2G9QA 5CVDA 2EDAA 2ZQYA 2WFMA 3RM3A 1ATZA 4K0RA 2QMHA 3H75A 3ASVA 2X8BA 3EVAA 1AHNA 4R98A 3U3RA 3WXBA 4E88A 1R9JA 2P90A 4Q4JA 1GGMA 2ONZA 1E1CB 1DJPA 3BEOA 3IQHX 2Q3CA 1S8NA 3FNIA 3LS2A 1XKQA 2AL7A 2X9VA 5EHIA 3W2GA 4CQJA 4DAEA 2XLBA 2QVBA 1K7EB 3X3HA 4EPTA 2P79A 2W2NA 3RSZA 2NSJA 4FGUA 2WIDA 3KJIA 3FRIA 4CPDA 1L5HA 1L7RA 5FOUA 1DBSA 3T0GA 2A86A 3MGBA 3NKVA 1PT7A 4DG8A 4NXMB 1MRNA 2Q9AA 1T9DA 4FILA 2G63A 4GM4A 3V46A 4XUCA 1PT9A 1ECFA 4R1SA 3REOA 2EIXA 3RUEA 4E2XA 4PHGA 5JY1A 1CIJA 2PGAA 1TIBA 4WXYB 3ICEA 1Y48E 4YJFA 2ENUA 3JPYA 3TVDA 3G2KA 3DDOA 4I6EA 4YREA 5CLQA 4TTVA 4N49A 5JFTA 5IU6A 3GW8A 1QAQA 1WM1A 4QECA 2WTNA 4C5BA 1WMDA 4KDFA 5JMOA 1F8UA 1GUFA 2EBHX 2AFIB 3MWLA 2BR3A 2J9FA 3PB3A 3SLRA 3X1DA 4BUCA 4KXXA 1FRQA 3MTAA 3JX9A 5A2QA 1GTZA 4L1KA 2C4MA 3NJ4A 3DKRA 3GRCA 2XGJA 5TF4A 1BCRB 1XELA 1Z3IX 2XNJA 4OFWA 5IT9A 3GB9A 4YCBA 4MUIA 1FFSA 3I0NA 3IXMA 4D9JA 5CH8A 1I1QB 3JQDA 1F8YA 1M6EX 1FSZA 3NNSA 4MCHA 4R83A 2X15A 4QUEA 1RLTA 3U9SA 2Y0DA 1E4OA 3K05A 5HKKD 2VP4