4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
5EJFA 2BONA 4V24A 5DHSA 5EJGA 2JGRA 3PFNA 2I2BA 3VZBA 4HAOA 2I1WA 1U0TA 3VZDA 2QVLA 3V8NA 3VZCA 1Y3IA 5DHRA 5DHTA 2I29A 1U0RA 1Z0UA 3T5PA 1YT5A 3V8QA 3S40A 2I2FA 3V7YA 5EJHA 3V7WA 3V8RA 1Z0SA 2I2AA 4L02A 4WRRA 2Q5FA 2AN1A 2QV7A 3V8MA 5DHQA 1SUWA 1Y3HA 2I2DA 2P1RA 1Z0ZA 3AFOA 5EJIA 3V8PA 3V7UA 4DY6A 2I2CA 5DHUA 3V80A 4WERA 5DHPA
chains in the Genus database with same CATH superfamily
1DBRA 1R0WA 3K5WA 4MRRA 4U7WA 5B5SA 3TNFA 4MV4A 3EH2A 3D8NA 1WPQA 3JW8A 1KO1A 4MW4A 1T9GR 1I6WA 1JA0A 1N6PA 1G3UA 5CBPB 5HX7A 2EVWX 2QRZA 3UWOA 1ZM2A 3LPMA 1KPHA 1GDHA 1AN0A 4D6YA 1RMTA 2Q3BA 4JD5A 5JDCC 3TZBA 1YJCA 4X93A 1T3SA 4GXQA 1JDSA 3PPIA 3WIBA 1L5WA 1P4HA 1X9IA 4MJXA 5EI5A 3TG8A 1DP4A 1KA9H 2XMPA 4UD2A 6GPBA 1RCUA 2IT1A 4Q4AA 5HIMA 3AVQA 1VCHA 1VYUA 3Q8KA 1QG4A 4D8WA 4YMGA 4MVJD 1VGVA 3R3HA 4PHTA 4UHJA 2Q4TA 5A05A 1K5HA 2C92A 1JIVA 2JQJA 4B3XA 1XKXA 3RC2A 1FUUA 5F1KA 3HLKA 1XRSB 1Z83A 3O4VA 4GMHA 3HXOA 3QUSA 1SB9A 2J45A 2NQ2C 4I9UA 4O6VA 2C4HA 4ZDWA 4CR8A 5LSAA 3KYBA 4GG1A 3UKDA 1Z4KA 2ZKIA 1E1KA 3BWVA 1TXGA 3GQVA 4WXHA 4RIGA 1EK5A 1RWNA 4WOBA 3VX4A 2YNMC 1DEAA 1F51E 4RVUA 3TO5A 1AS0A 3E2PA 1H6DA 2GRAA 3NTRA 4K9LA 5MFZA 4MV3A 3RAEC 1NW8A 2R8BA 3B3JA 5DTRA 3ICCA 3SZ3A 4LJAA 3SHVA 4K40A 5FPHA 5JAHA 4IL5A 3ZHOA 1ORTA 1V47A 3CH6A 2BKEA 3NKFA 1QHEA 2QZ4A 1LB1B 4R40A 3E8XA 3K96A 3GLQA 4GYWA 2NYAA 5GM1A 3O8DA 4FYIA 1FFAA 2H1WA 4LJ5A 4ZT2A 3K1ZA 3PUZA 5DNVA 2YDYA 2FSVC 3NGMA 1C1DA 3S55A 1I7DA 2I3BA 1JBKA 4ZQGA 6REQB 5F33A 1DNPA 3TQHA 3WR5A 5J5VA 3LWDA 2J08A 4YCCA 1UT6A 3K0FA 1DD1A 3LZCA 4OPMA 4WKBA 1P4RA 4QBTA 3TPCA 4DMFA 1YRYE 3R5HA 4LXYA 4OUDB 1K4KA 3L8FA 2V03A 4HQ0A 1ACLA 2YX1A 4AX8A 2XMRA 2B1GA 3SMQA 5JVDF 3QE9Y 2G1PA 2QA5A 4JFRA 4JNKA 4ZEWA 1BFKA 1IWOA 1HTBA 3E05A 3U62A 2ZJ6A 1EYZA 2FEOA 2P69A 3MMXA 4B6OA 1HSZA 2I2CA 2QM0A 1U1IA 4YRTA 1NFFA 2O2DA 1AGNA 3BG5A 4OGFA 2VNKA 3UK7A 1NX6A 3L2OB 1KXJA 3VPAA 4OXKA 5KNDA 4BPBA 3NV9A 1YD7A 1M2VA 2OEPA 4R8RA 5EESA 5AKXA 2QXYA 5EIHA 2VUUA 3GRUA 1NDHA 2A0WA 1IN8A 3AESA 1BXGB 4WZBB 3IEKA 5F4ZA 3SPXA 6Q21A 1I0ZA 3BRWD 5IDYA 1KYYA 3BFXA 1X1AA 3I83A 3IQFA 4P5EA 5AESA 3HK2A 2GN0A 5ALHA 1GTMA 5I5GA 1KWKA 1C80A 1TIPA 1N9ZA 3PC3A 3UICA 2WVGA 3BM5A 5EEHA 5LA6B 1N0WA 3UN1A 1YIDA 1OQAA 1KC3A 2GTIA 3HCFA 1NVEA 1L5RA 1SJ9A 4N5NA 3CLRD 3W6NA 3NTXA 4ARSA 2DT8A 1YBMA 3E7FA 4YS6A 3DMTA 3NBXX 3UMYA 4MI1A 4N0DA 4QDUA 4PYQA 4TTIA 4CG3A 1NXSA 2AMFA 3BQ9A 2HRZA 3LPLA 3VC7A 3ZK8A 5CYOA 4YASA 3W5IA 1UBMS 3V2HA 4JL5A 2HLNA 2R2GA 3ZE9A 5EQTA 3SJZA 2ZVPX 1AKTA 2YIDA 4GICA 5IF9A 1NBHA 2ZZMA 2BGRA 3BQNB 4YC7A 3KKOA 4UXHA 2V7GA 1NMXA 4GRIA 4A1OA 1OBOA 5ADWA 4Z8YA 5BV7A 2YC2C 3N7AA 2OPHA 5KYKA 1NE7A 2Z5LA 3PIDA 2DRIA 2DHCA 3IBYA 1ZISA 1B1AA 3GLVA 4QBIA 5HS6A 3RWMB 1J2YA 4QYWA 4X90A 4ETWA 4EUSA 2QMHA 3NC1C 3BRSA 1OKKA 3BCUA 3HFJA 3TTSA 1GZ3A 1TC1A 1KMMA 1JT2A 2QTHA 5DHUA 1GILA 1E6EA 3AKYA 4Y6OA 1GYQA 1BMTA 1KF0A 4Q47A 1MG0A 1VJCA 4BYMA 3OTQA 3ZIAD 5BVHB 2W6PA 1AX9A 2OFFA 4QEZA 3KU4A 4WDQA 3RS5A 3U48A 4G5HA 1O4VA 1KEZA 1X7WB 5JHGB 1DKPA 3GGOA 1HG0A 3KTOA 3L8GA 4Q7MB 1XB2A 4Y2TA 1WNFA 3PRJA 3ERCA 3FTDA 4NZOA 4O5OA 2Y2UA 1JKJA 3T12A 3ZY4A 3S1SA 2NUPA 2JLVA 4Z7JA 1V25A 5TF4A 1WDMA 1DJQA 1JIJA 3EIHA 2I8AA 3CUVA 4G1EB 3DQZA 3IELA 5CH5A 5CW2A 5T4HA 4D9IA 2IQIA 2HIAA 3BCHA 1YS6A 4CKZA 3B48A 4OH1A 4D9CA 2Y1CA 5I4BA 3HZOA 5EUBA 2QN8A 2CBZA 1OWLA 1OV4A 1A9YA 3AU8A 4X45A 4MUKA 5A6SA 2FPGA 1QIIA 2VNAA 1IDN1 3U80A 4AG5A 3PEWA 2CHUA 3N2KA 2E4YA 2VDRB 1POXA 1TKBA 2PN1A 3A6FA 4KKXB 4RMNA 3DV2A 1BX1A 1WD5A 1FS5A 1PG5A 2WD9A 3GG9A 3GJ6A 4FS8A 4M6WB 3BE5A 3ORFA 1D5WA 2WD7A 2WZBA 2DUMA 3FOBA 4M0PA 3BK1A 2GRUA 3GEHA 1BDMA 1T9AA 2QB5A 3GJ5A 2ASVA 3OC0A 3OWOA 2GLXA 3HVUA 1BAPA 5TT1A 4FCWA 3ZXIA 3DBLA 4O4HF 1KQNA 1CEXA 5B58C 1ZL0A 5ANRB 1LPPA 2GTPA 4GLLA 1R0SA 4QDOA 4W99A 1F48A 3SKXA 3OE5A 1ZM9A 4CKWA 2ZYUX 5KJ1A 3LNCA 4CXMA 1E1YA 3JQFC 3V2GA 5JTUA 3HYNA 3QOYA 4LHVA 2PUEA 1IVNA 3VTZA 2CNBA 2J7PA 3FPJA 4V0RA 3RC3A 4G0VA 2M6LA 3K9WA 3OQIB 3A1EA 5HKOA 2Q5HA 3V4VB 5K8TA 2WI8A 2FFHA 2XZTA 4NJMA 4DNXA 1V9LA 4J3NA 4JODA 1DDOA 4KXUA 4YRSA 4Y2HA 3EZNA 3I2JA 3PT5A 1ZOOA 3BH7A 3OQJA 4CKCA 1V4BA 1E79D 4NQZA 1Q0ZA 3P27A 5TPWA 3LGAA 3V42A 3IPCA 2P75A 1EGHA 4W5HA 2P8JA 1UMDA 4A2PA 5HKKD 4PPNA 4GDMA 4DLXA 1RI1A 4L4SA 3TIGA 4MW6A 4P86A 3VU9A 1JNXX 1L5FA 2QRGA 4ERNA 4EUFA 1N2BA 5E1DA 1KYWA 2H7XA 1M1UA 3ZU4A 4F1JA 3H5IA 3DDWA 3LCRA 5TV2A 2EJTA 1XL0A 4E5MA 1EM8A 3WHIA 3A05A 4E88A 1PT5A 4LHZA 3SF8A 4C3OB 1SBTA 5D3QA 1QV6A 3IMKA 3QFTA 4Q01A 5E2IA 4TYWA 3IESA 4URYR 2L42A 2P2DA 4KRGA 4CT4B 5AQ1A 3RVOA 2C7QA 1XPUA 4ZVNA 2X2FA 5DN6A 4F8JA 5BN5A 3U7FB 1NHWA 2P7IA 1XF1A 1R4ZA 1JPVA 1YZNA 2RGCA 4IILA 4GMDA 2A5YB 2RBGA 3EDMA 4PZDA 3UC9A 3SQOA 1O95C 2Q46A 3DEIA 3ZZMA 2B8WA 1NQVA 1E59A 4JQSA 5B2EA 2J9XB 1UKYA 3TLCA 4YLYA 4D4MA 2CLSA 3FTCA 1I13A 2J30A 2O2SA 3GHYA 1OIXA 4WY8A 1RHRA 2GEDA 1A76A 4G41A 3RODA 3WL7A 2XUZA 2OV6A 3A7EA 2AOXA 2WVHA 5CT4A 3U44B 2IHKA 3AW8A 4GWLA 1G8PA 4KQFA 3H18A 2ZI3A 3I2YX 3L7LA 4FGKA 8ABPA 2EKQA 1WY5A 3AB3A 3B89A 4TM8A 4HZIA 5HKLA 3RJMA 2AOUA 3VKFA 3JQGB 4V3BA 2P4QA 1RMYA 1XXLA 1V37A 3ETJA 3TCXB 3CH4B 3KT3A 4FSDA 2G9UA 4CMKA 3R8CA 1YF3A 2P6MA 5T4FA 3UV3A 3MB5A 1LZKA 1UDWA 3IAS1 1P81A 1N6OA 2Q4OA 1RWMA 2ZJ3A 3Q9UA 4Q02A 3T1TA 4B84A 3Q7TA 2Q1YA 1CR4A 4M1TA 4ZI7A 3ANTA 4KACA 3WLKX 1QZXA 2VNIA 2PLAA 4X1YA 1FRVA 2JGJA 1D4FA 5FH9A 2XMBA 3FZQA 2A88A 1XQVA 3JCZA 5KSPA 3TIFA 2AW3A 3A1NA 1POWA 2BRFA 3C6MA 4K81B 2OB2A 4NCKA 4J7XA 2EJUA 5J63A 3FR8A 2HT1A 1ST2A 4P9NA 1PJQA 4PLVA 3JAKA 5KO2A 3V2IA 3MS7A 4EW3A 1DC3A 2R8OA 3EZ2A 1OKKD 1XVIA 1GSOA 3OFNA 3F1LA 5FR2A 4V1CA 2GXQA 1W581 2FGKA 4LWOA 1L5LA 5B7QA 2PJDA 3AFOA 1WR8A 1BVYF 3UUEA 3PNQA 4LJRA 3UVEA 3NBUA 2C99A 5HJ2A 4FFMA 3KKQA 3NRCA 1QR6A 3DSRA 1XNJA 3N2GA 2IYTA 3MWEB 2I78A 1B8PA 2ZATA 2LBPA 2JGRA 4KIWA 4OFWA 2FUEA 5U4QA 5L6MB 1GUYA 2JHCA 4RM2A 3TQQA 2QJWA 4TKUA 2PUAA 2YFKA 4I46A 2VWHA 4DMHA 2QPOA 4H27A 1YB1A 2ZYWX 1HQDA 3A6HA 4XQ9A 1NP6A 5DNUA 1C3OB 1CIVA 3H9GA 4XPZA 2APJA 3ZKWA 3AQ4A 3WLLA 5FDFA 3K0SA 1ZJWA 4EY4A 3CO5A 1Z07A 3BZUA 4XWWA 3B6MA 2AUNA 1AA9A 2XUFA 3HP1A 1J4AA 1HDXA 2VBGA 4LHEA 4MXDA 4QTUB 1QGZA 3BE6A 3EEFA 3HMKA 4WT7A 4DIOA 5IEJA 1HE2A 1L5YA 1RT9A 1K7EB 2C8VA 2W6OA 4G97A 1G41A 3GUCA 3DLHA 4QLOA 4WLOA 4N4AA 4YRIA 1X9HA 1GSAA 1O08A 3OT1B 1T4CB 3OQOA 5EIXA 1R5NA 3QE3A 2Y4OA 4J1SA 4Q3LA 1YR6A 5TQ0B 1E96A 4LGYA 3TQRA 1JA1A 2O8CB 3C5HA 1J1ZA 1N8NA 1FP2A 4X8LA 3HKCA 2EEPA 3ZWAA 1DMRA 5IANA 4DIBA 4OI2A 5CX1A 2HT6A 4OREX 5BN5B 3VR6H 4IRUB 1TGYA 3ZY2A 3GLIA 3PJRA 1YL6A 1DLJA 1ZUD1 3GVPA 2H7VA 1X8XA 1PJZA 4RZUA 3ZHSA 5FO1A 4QHYA 5DI3A 4H3VA 4CVNA 1JHMA 1EB9A 1CLUA 1F0NA 1ZZEA 4J0CA 3BGDA 4KPUA 3PHLA 2V5UA 4XOIA 2Y1FA 4DQVA 3L0OA 1DWOA 3MJDA 1DAMA 1AKMA 4UBIA 5IH3A 1L7VC 4JC0A 1U3CA 4RDHA 3TOVA 5KMGB 3IURA 1S2OA 2Y0DA 3M34A 5C8YF 3SR3A 5ALPA 4G0PA 2C97A 3QG1A 3SS8A 4QYTA 3WWOA 4CEHA 2QNRA 2A7QA 2JRCA 1YBVA 1VMDA 1ZS9A 1PZHA 2JVJA 1GZVA 4C07A 5TX7A 1J07A 1IATA 4N3GA 4AULA 3ADKA 1R5BA 4E7PA 5A9SB 1FXSA 5I3ZA 2B1QA 1NI5A 3P9QA 4JT9A 4QDZA 3P9RA 4OB8A 5D00A 4ZOCA 5TEVA 2VTBB 1ZU4A 4X1IB 3A26A 4IZHA 3R6LA 4HO1X 3W4JA 5JROA 4JLWA 4KK3A 1D4AA 4OAQA 1VLLA 4EJ6A 1AUOA 4UM8B 1JDJA 3KKPA 2J5QA 2RGYA 1SBQA 2EBUA 4N7BA 4IQ8A 1JDVA 5KYWA 4KCGA 1EZ1A 5ALNA 3BREA 1EK2A 1J8MF 2MSKA 2MSDB 3KZ1E 2Q5OA 4J90A 4KOAA 3L92A 4L5BA 1HFJA 1FRNA 1XNGA 2OGUA 4RJ2A 4H6VA 3WNCA 2A9PA 1JQ3A 4ABYA 3VSEA 1E5VA 1QXSA 1QWOA 1PLKA 1T5TA 1JXOA 3VR4H 4BX2A 4F46A 3BF8A 2QTCA 1DHTA 1CDDA 4KQJA 3OTIA 3G8BA 1ESCA 2GRJA 4JMPA 4PG7A 3WG9A 2GZ1A 3EGXA 4D9HA 1BDJA 4YJDA 3DS8A 2AFFA 1KAEA 1NTRA 2HUNA 4ZEVA 2OV1A 4DNPA 1FQKA 1SK8A 1EAYA 2GHQA 2I71A 2V3VA 1AXEA 1I4TD 2BMFA 3BERA 5JCOA 5KCMA 1QV9A 3G49A 3TRFA 4JI4B 4F38A 5EKDA 4NMMA 2ILVA 4YJGB 4QFDA 1W44A 2X0RA 2JFWA 4PGHA 4AWBA 5JC8A 2RC6A 4MJ7A 2N47A 1YUMA 3OCVA 3I76A 3PX2A 4CPDA 3E8MA 3ZJTA 1XK7A 4LF5B 1HGXA 4NU6A 2XI4A 2H4YA 3HP7A 3QEBZ 4U02A 3T1YB 1H2ZA 4UUMA 1QGED 4JB3A 2O59A 2QZJA 3DHYA 4IICA 1EVYA 2C9MA 2RB4A 1HQCA 3LWNA 1KHTA 3PEUA 1K75A 1JJBA 5EKSA 1P2DA 3RVLA 1VXOA 1DWQA 3JYOA 2G5GX 4DEXA 5DHFA 2HNBA 4PWYA 3GB9A 3OLQA 5GINE 1Y6GA 5I7FA 3SQXA 4L72A 4RTJA 4EHDA 2IKQA 4PRLA 1WPGA 3H1FA 2HK6A 1Y8ZA 1U1DA 1YQDA 2BJWA 4YPOA 3LKVA 2Z6UA 2FPKA 1D6NA 4Q12A 3M0EA 1KTIA 3LDUA 3L7AA 2ZT7A 4HFNA 2QX8A 1YJMA 3W6PA 4BNWA 5KTRA 2PR2A 2P6OA 3ZJUA 3UY4A 2KE5A 1NF3A 4HX5A 4R0NA 1NN0A 2FR8C 3K20A 4C0JA 5KOIA 2ZWVA 4FQ5A 4M22A 1OXXK 3RU7A 3MQ4A 5H0IA 3SIRA 621PA 1YS4A 1ONNA 4IQGA 1Z5UA 4XLZA 4EY6A 1WV1A 3DDSA 1NUUA 4LPSA 2WU8A 3EZ7A 4IDOA 5K6RA 1FFXA 5AVXA 4CODB 4L2IB 5LNK6 2VUHB 1SC9A 3E9NA 1ORDA 2EU8A 5DISB 5LQMA 1QYXA 1NFQA 1DQZA 3IPRA 2V3CC 1Q44A 1CSEE 3PJEA 1UKZA 1Y7TA 2QVBA 2UUAB 2BFBB 4BNZA 3KBBA 3ROZA 1CV2A 2P4UA 3O38A 4NOJA 5KQMA 1ORRA 1NOJA 1C9MA 2XUPA 5KOHA 3F5FA 4NTZA 4EQ6B 2NYRA 1A7JA 1PK7A 1U8FO 2P2ZA 4PBRA 1GZHB 5HWSA 2MINB 3HUFA 1Z3IX 2DFDA 4HXYA 4Y2RA 5TMDA 1NG1A 2DG2A 3QBJA 4YECA 3NVAA 1F8GA 3I1FA 5KVAA 1M8KA 1QNFA 4F86A 3IIKA 1HNXB 4XARA 4ZVSA 5AJZA 2VZ9A 4ND5A 3LFUA 1KQFA 3E03A 1N34B 5HDBB 1UADA 1H6CA 5TS2A 2PAAA 2GEJA 2A0XA 2EF0A 3OCJA 4G0XA 4NU5A 4MCHA 1DAFA 3KEFA 3MBKA 1F0KA 3DFMA 5LVAA 3CLUC 3OIWA 1J5EB 4FMDB 2FWMX 2XT6A 4Q3BA 5ESDA 5HPYB 1XTKA 3OKAA 3CJQA 3O73A 1FFBA 3V6MA 1J6UA 4EY5A 2UYOA 3H4MA 3V34A 5CG1A 1Z0FA 1KY4A 2ZXUA 3C3WA 4YRAA 1PG0A 2ODPA 2HU2A 2IUUA 2OHXA 4BVFA 2CLMB 5AHOA 5MGNA 2XTNA 4RKYA 1RRVA 1KI6B 3GDWA 4AF8A 4A0SA 2PO7A 1F2TB 2D7JA 3PFKA 2XUHA 4HXFB 2ZB7A 3HDTA 4XB2A 5AUQA 2B2XA 2NV2B 3PNSA 3S40A 2AHOA 2O7RA 3AHFA 4GC5A 3ZV3A 3T3MB 1EWTA 3I3OA 4DRXA 2OV8A 5ALRA 4PEVA 2ZBVA 2ZYSA 2XOKA 2FP3A 4GZ6A 5KJ6A 4RGBA 2FSSA 1MJSA 1YMUA 4RMIA 4A4YA 5FUWA 4UUPA 1BWRA 4OF4A 5H1YA 1MO3A 4FJ0A 5LZ5A 3T1OA 1T10A 1EQ2A 1YTUA 3V4OA 1HBJA 1WU7A 3V8BA 5L3VA 3U4GA 3PDIB 2BR5A 3T7RA 1X7YB 4LPKA 5FL3A 2ZAIA 3FCOA 3SM3A 4AVYA 3JYHA 3T7CA 4BN5A 1JG4A 3SC3A 2QX9A 3F9IA 1TZ2A 5E1OA 4LSGA 2CMKA 2Q2OA 4TLAA 1PTJC 1V8ZA 2VF7A 3F96A 5DDIP 1JAXA 3R4VA 2DHDA 3IBSA 4Z3OA 3SSOA 3RT9A 4Q3NA 5EJIA 3KS9A 2B3TA 3GL9A 5DXJA 4BKUA 2VDVE 3PEEA 2FKNA 1X87A 1Y7PA 4N49A 3REOA 4DA8A 3L7KA 4KUHA 3QQPA 1ADJA 4EELA 3AVUA 3D43A 3CXRA 3HN2A 2GEUA 1MC4A 2D1YA 2JBWA 3GROA 2WWFA 2PGAA 4ZT5A 1SCUB 3QKTA 1EFLA 2P2CA 3EF0A 4CV2A 5EJ6A 1USVA 3SAJA 1N0IA 1V5FA 1QVZA 4TV9B 1W5BA 4BC1A 2HZBA 1J06A 4IV5A 1T2CA 4ZV7A 1EFHA 4C6TB 3TW4A 4LMBA 4X94A 4Z4EA 2HB6A 5EXSA 2YJ6A 5DMHA 4PRZA 2EOAA 1R18A 3ZUGA 4ZXFA 1ILEA 5JNTA 3NI2A 1AGPA 2NU7B 5DTQA 3QWHA 3HN7A 1H2XA 4LW8A 2YV2A 1QVAA 1FMCA 2FE1A 5JIBA 1YZHA 1Y9ZA 4IRXA 4BU0A 2SHKA 1JSXA 1YASA 3O0DA 4MDFA 1HLGA 3EQZA 3RK1A 1PUIA 4GSLA 1ZXLA 1FSPA 2QLMA 3W3ZB 3MUNA 2Z58A 3MWFA 4QOHA 1YCDA 2UV8A 4H6WA 2IV2X 1FMFA 3OLCX 4XFDA 1CUEA 2QTVA 1P0FA 4EUHA 1KO8A 2UUPA 1GXCA 2YOHA 3R5JA 1W85B 3QBDA 2HLDA 1MXHA 1SC3A 1ABBA 2Q6LA 2AJLI 4J4HA 4ME6A 4JR0A 3FDZB 1GTL1 1IY1A 2QHXA 2QVGA 1KYQA 4YPVA 2P1ZA 2WPDD 3E4CA 1BTOA 3L6OO 5AOCA 3TLGA 1Y3HA 4WXRA 3WY9A 2HSWA 1ZJ5A 2NOAA 3ZWWA 2J0UA 2ON6A 4RV9A 5TARA 1I3OA 1E9DA 2A9OA 3CM0A 2A14A 3WRYC 5F4BA 4JX9A 2F1HA 4YCBA 2P3LA 5DRTA 5T3YA 2XEXA 3NKLA 4M53A 2HWWA 3UPTA 3M5PA 1RFGE 3QLUC 5CIWA 3SBOA 4A16A 4DQXA 3TUIC 3BILA 2G25A 1Q2XA 4YV1A 4ONEA 1T2VA 4XWOA 2WHPA 1Q1QA 3GFGA 4LK3A 4B3JA 5K45A 4I5GA 1UDBA 4RXUA 5F9MA 4WNYA 4WUTA 3TQTA 3L5KA 2R65A 1WCIB 2ORIA 3GLKA 2Q4EA 2JIMA 3I0ZA 3ZNPA 2OUIA 5HUJA 2MYPA 4EGCB 1AKVA 2ZZNA 2H06A 1SQSA 1YKFA 2JIZA 2EW1A 4IMJB 2ZUUA 4L7QA 4L8VA 4ARZA 3QNWA 3H5NA 1E8MA 4O2LA 4GR4A 2DPHA 3HWX1 3VR2A 4WKOA 3VR3A 4B3IA 3PUWA 3WRXC 4EF5A 1E4YA 1WMBA 2Z1DA 3OWXA 1YCFA 3REGA 4BN0A 4X92A 1AB6A 3COPA 3A1UA 4X7BA 2AQIA 2GYWA 4NBLA 1L7DA 2VJNA 1L7PA 3OLYA 4N6OA 2WF7A 3A1SA 3OIYA 1Q12A 1JE0A 1TM7E 2IUFA 2IU4A 3LV8A 1DEXA 4II2A 2LPMA 1HLDA 2BKUA 2HCBA 2AS0A 2NSJA 4EEZA 1J33A 5J2UB 2NTNA 1TE2A 5H81A 2ZE6A 2X15A 1NHGA 3OEWA 2RJNA 4FYVA 5GONA 1DBIA 4X71A 2SBTA 4IXMA 4OV6B 4CYMA 1ZEMA 1PS0A 5F2KA 1Q11A 4C01A 5D3MB 4NG5A 5JZBA 1E0SA 5D8DA 5CH8A 5K8IA 3DNMA 2KSQA 1KU6A 4FQ7A 3ID6C 1RE1A 3LP6A 5DP2A 5KPJA 2H5IA 3KWFA 3HA5A 2DFTA 3ZV4A 4GL2A 1JLSA 2IXEA 2X4IA 1DC6A 3OAAA 3QUQA 1BX3A 3MHTA 2NZUG 3H3FA 4TRJA 4X3OA 2OGSA 4RTNA 4RACA 4X64B 2RGBA 3E9MA 2W6JA 3GFBA 5K3BA 4DHWA 1S9HA 1EWQA 4YAIA 4BPRA 4FYHA 3K0EA 2QTAA 3LFTA 2I6TA 5AKGA 5GGXA 4XYLA 3JR7A 4CETA 3V7YA 1M73E 3HCPA 2OY0A 3LT5A 1Q74A 5ALQA 4BFLA 4J29A 1V9SA 5KNLA 2C7VA 2A86A 3DOUA 3M1YA 4XLTA 4KAFA 3PITA 7ADHA 1FB5A 4KTVE 4G4IA 4U2GA 4BY9E 2XVMA 4QQNA 3L8YA 3DKPA 1XTUA 1Z6AA 3KM0A 4YHBA 2F00A 4C0SA 2OESA 1JSRA 3CWZA 3BIWA 1QCCA 4FOTA 4MWZA 1WMEA 3IAEA 1FDUA 4IDFA 4IIJA 4S1TA 5FAXA 4F84A 3LIPA 5A5VA 4TV8A 5T4BA 3E3LA 1VGQA 2JH9A 1F12A 1ZRNA 2ES4A 3FROA 3UMJA 2ATXA 2NNLD 1KI9A 1MABA 3NBKA 3CT6A 1G5RA 5FT9A 3STTA 2B5OA 4FIZA 3AI1A 3UCFA 3GLHE 3KDAA 1ZIDA 3NUQA 3P9XA 4MWGA 4RJIA 4N5DA 1W59A 3UJCA 5CD9A 5L3SB 5IZCA 5L3RA 2AKAB 3CFYA 1PK9A 3G79A 3I72A 4UDYX 4QUJA 4H77A 4D82A 3GLGB 5CTAA 5KWIA 2O7SA 2XJ4A 2ZB3A 2INGX 4A0FA 4AZ0A 2Z8ZA 4LVNA 2GZHA 4NZ9A 4RVFA 2C00A 5ADHA 5JO0A 5ECWA 1TUIA 1UANA 4WEQA 2YWDA 2H4XA 3NFYA 4Q16A 2N3ZA 4P7BA 2ZP1A 4BC0A 5HW0A 5IASA 4WFJA 1D2NA 1FJGB 3SNHA 3DEFA 1A27A 2EYUA 5KX5B 2PWZA 2X19A 4WCFC 1TTHA 5KBYA 4CMHA 2AJ8A 1JAZA 5LDGA 2ZJ4A 5CB0A 3UJPA 1YJAA 4UU0A 1UP7A 5CJJA 3CVJA 2HHAA 2VYNA 3AEUA 3F6PA 3KJZA 4BUZA 1V9CA 3R76A 1WKVA 1XZAA 1VMAA 4MEAA 1TAQA 3WMXA 2O1EA 2PLRA 2YR0A 2H1CA 3QEMB 3QI7A 4MA4A 2DGDA 4W5TA 2PA3A 3ETHA 3F3YA 3QX7A 4RIHA 1FTYA 4YYEA 1CR2A 2XWSA 2J3LA 1EUDA 2QLBA 2R4QA 3LP8A 3E27A 5A2QA 3HRIA 1L8AA 3T3DA 5BSVA 1RBMA 2VQ3A 1X9GA 4IH4A 2JIOA 2ODAA 1C1XA 1IRXA 1KKUA 2J41A 4RD0A 2UVPB 5JMWA 2Q3FA 4FD2A 3HU2A 1H0RA 5FBRB 1KK1A 4I2VA 3UAYA 2O3RA 1S2DA 3CGWA 4TVBA 2PJUA 4OJQA 1KS9A 4RY2A 4CM6A 3IIEA 1DMZA 4OK5A 1P0PA 1C29B 5ILOA 3ABZA 1S7CA 3WMEA 1G21B 3VH1A 2H1VA 2LW7A 2CEAA 3KTAA 1XQXA 4QBGB 3COJA 5HRAA 1VKOA 3H05A 3RM3A 2AUMA 2FPIA 2G7MC 2OO3A 3DD1A 1DELA 5J58A 2NWQA 5BOSB 2BFAA 3O3MB 2QL6A 1AHNA 5HK9A 2HFKA 3VNUA 4H6PA 3CN7A 3ZYZA 4MYHA 1MR3F 4Z0NA 3TZHA 3R8XA 3FTFA 4G36A 2AMLA 4ZDJA 2PH7A 1M34A 3TVTA 1QRUA 3DO6A 5ALEA 1RXCA 1QLWA 2VJOA 4ZC1A 3ZGLA 4B4OA 1PQYA 2I29A 5C3MA 3DOIA 3RVSA 1AG9A 1E2JA 3WKEA 1DAIA 1NNUA 1T9HA 3KT8A 2AYZA 2F90A 3FMIA 4DDUA 2C2XA 1HZZA 4DJDC 3C24A 3OFJA 2PZKA 1IBMB 3ZHBA 4DR5B 2ZRIA 2OK7A 2O54A 1V1JA 1KY2A 3EBOA 1SGWA 3KWJA 1MAVA 3JVVA 1DAKA 1C0KA 2AEMA 4DLZA 1E7RA 1AZLA 1H1LA 1VOTA 3JWHA 4PYMA 4YGXB 3SLKA 5FNVB 3V4ZA 2I7XA 3R3UA 2WU3A 3B85A 3KLPX 1NP7A 3UYLA 1FXUA 4RFSB 4JEMA 2J33A 4Z53A 2Q7XA 3FYDA 4ISCA 3HRHA 3OF2A 1YZUA 4NPHA 2DVMA 4QO8A 4QX6A 4U3JB 2B34A 3KJHA 4LE1A 5HBGA 5AW8A 4FYKA 4Y1FA 1E2BA 4JXKA 1KHXA 3DHVA 1O0CA 4U8HA 4QKQA 4O4LA 1DJLA 3LPCA 4DJAA 3QFCA 4F60A 1I1NA 4B76A 5CBKA 3PQCA 5K0CA 2CVHA 3ZCXA 2XMZA 1DE0A 3DZDA 3M6FA 1W52X 4JWTA 3UJ8A 4P0PB 1RADA 2XCIA 3MGAA 1YTLA 3HZRA 1LVGA 1QS0B 2M6RA 3OAAD 4DIDA 4YR7A 3CN9A 4YMVA 2HL6A 3L6UA 3PL5A 2MIIA 4ZV9A 5A03A 2CFTA 2FXIA 2YRFA 2FFAA 5JR3A 1FZTA 1KFKB 3VFDA 4X44A 1QAOA 2G82A 1YBHA 2R1ZA 4OU5A 3TKAA 4CLRB 3TGLA 2XRFA 3HKEA 3QXGA 4NDZA 1IZ7A 1UM9A 3AIMA 2RE8A 1A82A 2IHTA 3RYFB 2X0KA 1M2GA 1P44A 1KH2A 1SWWA 3AR7A 3RQSA 3TRKA 5AVTA 1C14A 3IMEA 1SUFA 4QXPA 1OTXA 4GSYA 1VJRA 4JGBA 3G0BA 1K2VN 2GAIA 2GPNA 2WA1A 4PG6A 5LJLA 3OZ7A 5E4FA 2JZNA 4HJRA 3UHAA 3ABQB 4BOYA 1ZCBA 4D8TA 2F4NA 1RWOA 4DCTA 4OFZA 1SHTX 1W88B 2DERA 4CMEA 1VPLA 2A1TS 1J7KA 1X2BA 3NR2A 1J4OA 5JU6A 4EYOA 2BM1A 4LBYA 4DV6B 4TWBA 4D8YA 4U0KA 1F4VA 2AXQA 4LC9A 3ENWA 2CYAA 3FTQA 4HQLA 4U39A 1ZHFA 2HCTA 4GUDA 4X41A 1C8LA 3UOGA 3PCXA 1G8AA 1RRFA 2ET6A 3KALA 4H2DA 4ML3A 2XMCA 3MJRA 5F7OA 3UJAA 4AUKA 3HB5X 5JAQA 1L3BA 4HFMA 1NW6A 3FOFC 1IN7A 3L7BA 3RC7A 1ZNQO 5BWNA 2J0SA 1WZ2A 7ABPA 5CA0F 3EPKA 1K5PA 4PRKA 3X44A 2ZB4A 3A31A 3TNJA 1FVHA 4DDMA 3SEZA 4ZT7A 5HJ7A 4E08A 1U90A 3KEOA 3I6UA 2WE8A 4XEHA 4B4WA 4PSAA 2FW0A 4R2LA 3H9BA 4Y2XA 4RJKA 5LZ4A 1YHNA 2GPWA 4MPPA 4FYWA 3AR8A 1Q0RA 4HWRA 1NA5A 4ZC8A 1DC8A 1E62A 2WWHA 2YJTD 3QE0A 4Y1RA 2GZRA 3QVGB 2B99A 2GWRA 3IUBA 3HTXA 2QAGB 2YQ5A 1G5TA 3AX6A 4GR5A 4TQUS 5BSUA 3UAXA 3HPRA 2DQKA 3JQAA 3D7KA 4OQQA 4Z7NB 2WUVA 3D3WB 4WNCA 3WL3A 3AEKA 3OQPA 2VOJA 5KTNA 3M81A 2GCEA 4PHFA 1XTZA 3TG2A 1BCSA 1U9JA 2FV8A 5CD1A 4AUNA 2W4QA 4JGIA 1P3Y1 3AHHA 3MYRA 3ZIDA 4ZYUA 3T5BA 4PU0A 5HYVA 4UTZA 4RTOA 5CRIA 4FGWA 1MEJA 3RK4A 2Z5GA 3BS4A 4KN6A 5IYZA 1FQOA 4MVJM 2BFDA 3AF2A 3CUKA 1QZ3A 2FFBA 3G2JA 4R16A 1R21A 4ZO7A 5ARDA 4RVDA 4Y9SA 5L7TA 5IM4F 2EKPA 1U2EA 4JC8A 1OA0A 1XDSA 2PS3A 2WSSD 3JS5A 3Q6MA 3QWFA 2Z08A 3G3EA 4JP3A 1KAHA 4NE7A 4NZZA 1D6MA 3U9SA 2YBEA 1TEZA 2OV4A 2R1TB 2W4IA 1XMJA 3OZVA 5DB4A 1OZFA 1L5VA 4YLEA 1YC5A 3DB2A 3WLQA 4XKJA 4YWHA 8AT1A 3ETCA 3OZEA 5DI9A 3BWBA 2PUFA 2JFPA 3N05A 4RVNA 4CTNA 5ALXA 5JV5A 1OT5A 4QCJA 3K32A 4GLOA 4KLNA 1T5LA 3KEGA 2REOA 2PZEA 3EC1A 5CJPA 1EIWA 2G8LA 2D2XA 4PG8A 4H7IA 2H63A 1ZMXA 1YI1A 5KC8A 4K3UA 3VJKA 4PANA 1XKTA 2GAFA 4LY3A 1Z16A 4PO1A 4AF7A 5E0KB 4TTRA 3U19A 3NATA 1XEWX 5HJEA 4ZYXA 4JWKA 4AP5A 3HWRA 2RGWA 3CLRC 3V4SA 2EWWA 2YXBA 2UKDA 1Z5WA 2W6CX 4AJJA 1UBSB 2DPMA 4NICA 4DCMA 3NVKI 1EHYA 1FYDA 4XLLA 1V16A 4FZ5A 1ODCA 1NUPA 1ZD1A 4RULA 1Z4OA 1GVHA 2FZLA 1H6AA 3G2LA 5ALSA 1Q22A 3SLGA 1NM5A 1HRDA 1Z5VA 2ZI6A 2BP7B 3JATB 3VVMA 3PFBA 4QE3A 3D4OA 1WUJS 3FBTA 4KE6A 5JJ5A 2WIGA 5JAIA 1DAEA 5JMOA 4Z5XA 3F6YA 2YTZA 3QF7A 4JUCA 3WFZA 1E9RA 1X1EA 5CDFA 2A2ZA 1JA9A 1AUVA 3TYXA 2GEBA 2EFEB 3EZFA 1E58A 1U8ZA 2PUVA 1Z2EA 2R6GA 1UJ5A 2GBFA 1CUZA 1Z37A 1ZFNA 2YJ5A 3M4ZA 4M99A 4YCLA 1PNQA 5ULLA 2Y0CA 5EJ2A 3Q0TA 4YR9A 1T5SA 3PGKA 1K63A 3UMVA 3UMGA 1RXWA 1MA3A 1NMZA 2ZU6A 4DMLA 3D54D 3PKZA 1SHLA 2NO6A 2VAPA 2DBYA 3FNIA 3MMSA 5T5QA 4BMDA 4UBOA 3ROXA 3TKYA 1JDPA 1GGJA 1XZNA 2GJAA 3CLKA 1B1CA 4KN5A 4NS4A 4PZAA 1B4DA 3S6JA 4UE2A 4URUR 1I2BA 5K6TA 2ADMA 1F1BA 4XM1A 2XH8A 2P3SA 1XRNA 1P91A 2VZLA 1QH8A 1TZBA 3LQ1A 5GV7A 3S27A 4CLHA 4NSNA 3PGLA 3AFMA 1YOVA 1B8NA 3U16A 1KIAA 1OGJA 4M9RA 3FMPB 2HNKA 2RHCA 3A2NA 1M8GA 1VP3A 2OXTA 1V0JA 3CVUA 1XTPA 4XH9B 1B00A 1Y8AA 4J7AA 1CJKC 3SYKA 1RKQA 4U4AA 5AW5A 3ZWBA 4IJ5A 2FPRA 1AHHA 3B1JA 3HU1A 4M4SA 1UPUA 3HNOA 4LSWA 1ADFA 3S3TA 3TN7A 3MIIA 1LX6A 2IHVA 3H1PA 1Y5NA 4ZOLA 4RAOA 1Z4PX 3BT7A 4RDCA 4HV4A 2GDJA 1J8QA 1XN4A 2J48A 4NDNE 1R0LA 4R6WA 4WLVA 3L7JA 3ZYCA 2VDUE 4CDNA 1E2PA 3GA7A 2RHHA 3OF3A 3SZLA 3PFCA 1GU7A 4EX6A 1J2FA 2V4ZA 2Y0PA 3DVRX 4HAVA 4JP2A 4LS3A 1CY1A 4OO3A 4UXIA 4KVFA 5CB4B 5JNSA 3ZJVA 2QT1A 4CNQA 3CRVA 3VHLB 2QRNA 2ZR7A 2QAIA 1NVVQ 1CUWA 1RTTA 1Z8FA 5I7EA 5GIOE 4EA9A 5L7WA 3VR1A 4I4NA 1QHFA 2PS0A 3I04A 1BHQ1 4V0OA 4CKEA 1K7YA 3WAKA 2FPSA 2EERA 4YMUA 4UMDA 1I3NA 2ZE5A 1TUBA 3MELA 1H2YA 4NATA 1P4SA 5AM5A 1SUCA 3PCTA 2RAVA 3GT4A 1N3LA 4MO9A 3CH5A 4P4SB 3ZZUA 1D9ZA 1GOTA 3E9RA 5B6IA 1XZCA 1X7HA 3RSSA 1QDEA 1A97A 4LYJA 4DR1B 4CF5A 4QD3A 1E0JA 4Z0TA 3PXGA 1Z7EA 3D6NB 3H8WA 4CMCA 3QBTA 4A8TA 4ZJUA 5BNTA 1QQTA 1KJ9A 4S2UA 4JUAA 1WMSA 1Q3KA 3V8RA 5FWXA 1DB3A 2EZ8A 2J59A 4KQ6A 4BHTA 5AI0A 2IYRA 1UPTA 2YXPX 2R68A 1OZHA 2DULA 4RBNA 3RSQA 1IEVA 4S1OA 3S2EA 1FTNA 3ETLA 4TX1A 2ZTUA 2ANBA 4X7RA 2GCOB 5SZKB 1CNMA 4Y2PA 3BXZA 4MX8A 1XZGA 3DZBA 1ENPA 3A6LA 3MG9A 1PR9A 4YONB 3OIFA 3OG9A 4FDVA 3FZEA 3RFVA 3J7AC 3DBRB 4UTXA 5CFPA 3K5PA 4IFTA 5KDDA 4ZK6A 3CUUA 3EZ6A 3BDVA 3OQBA 1YBFA 1IIRA 2Q1UA 3ZHRA 2MR6A 1C4OA 2GVNA 3FRIA 4NJOA 1YIAA 2OILA 5FEUA 3TUZC 1SA0B 1CUYA 3DOFA 2ZRMA 3UT0A 1OB2A 2JJ2A 3ZD9A 2GM5A 1G3GA 4Q00A 3VAAA 1NVDA 4R5HA 1CYDA 3ND6A 1GKLA 3G5UA 5ECDA 1VJGA 3WGYA 3OJCA 3CSDA 1I36A 4I55B 3X1ZA 4DMCA 5T8KC 3LQ4A 3PWKA 3H5TA 3ORSA 3RI3A 3RO7A 4UNRA 3EWIA 5H70A 1J39A 3TTUA 1FXWF 4DIEA 4EHHA 3RC8A 5EJMA 2AG8A 3H9EO 4TSFD 4PIVA 3W5UA 2P9YA 1GFWA 2XXBA 3GJ3A 4I8DA 4WK4B 3VYTB 4Y3UA 5JI3E 4IIUA 4BCDA 5EEGA 1DIRA 1KJJA 1G60A 1VFNA 1K5GA 1N9KA 1H42A 1R0XA 2FCRA 3H8VA 4KQHA 1O5IA 5JTTA 3DMTC 3KTFA 2A9VA 4R1LA 3EOBI 4ZHQB 4EG6A 1P0CA 5ALJA 1IBLB 1PLLA 1FFCA 2CCKA 3KFXA 3KR0A 4KC0A 5IDVA 1HA3A 4HQ6A 4QXRA 3WGTA 3L0ZA 4H7PA 3S2IA 5E6UA 1EFKA 1LEHA 1RPTA 1OBCA 3BCRA 3KFVA 5CHYA 5EP2A 1X19A 2AEJA 4EFMA 1DKLA 4NYIR 3PUHA 5DGDA 4ARIA 4EHBA 2HJ9A 2AMVA 2QTRA 3DGFC 3P2KA 3OY2A 3NIBA 1OV6A 4L28A 2PX3A 4PZ9A 3ZCRA 2FF7A 3M3PA 3IJEB 3R41A 4M1EA 1A4IA 4YACA 1GL9B 3NORA 1B15A 4FHGA 3ZWNA 3CNBA 5LCXA 1R4MA 1K7SN 3NVDA 4N0PA 3C6BA 2P5YA 1OASA 5E1MA 2DJIA 3KQOA 3R3JA 3DZ8A 2QLJA 2EKLA 1ZW6A 3GIDA 4YP6A 1XA3A 3GEIA 4JY7A 4P2GA 1PGOA 1FSSA 4B73A 2FZCA 2X8JA 4MAAA 4RHFA 4PN7A 1UFKA 2P2YA 3AR4A 3AF4A 3DAPA 2B82A 3CSUA 3NETA 5A7HA 3B5EA 3OZAA 4CCYB 2BI8A 2V96A 2PWYA 2E49A 2FX3A 4DB2A 5B64A 4YHHB 1NWHA 1JFRA 1FA9A 2AFIE 1YKGA 4BWFB 4X62B 4JHLA 1LSUA 3PGA1 4F9EA 3DQQA 4IX9A 1EUQA 5DBOA 2ZTVA 2AR0A 2DPGA 1KHUA 3AM3A 3HPQA 2DZDA 2VQSA 1JEQA 5ESXA 3IOMA 3VXKA 1R0ZA 3PQEA 1YMVA 4G07A 3R0JA 2NT3A 5IUKC 5FWYA 3DP9A 3LXUX 2ZPTX 5I9MA 2C0QA 3HB0A 2A9QA 2XGOA 1WVGA 3DVSX 1ADYA 4NYMR 2HCFA 2YXEA 2CUKA 3UM9A 5BV0A 3RFFA 1Y1LA 9GPBA 1U0FA 1XNHA 3WHPA 1OXVA 2XODA 3C2QA 4LOHA 4AJ1A 2G28A 4UASA 2G77B 3KVVA 4R1OA 3U0BA 1ABFA 1C3JA 4HLQB 1U5BA 2D74A 4GLBA 5HUHA 4QJ4A 3L8ZA 2YY6A 5CM8B 2Q07A 2X9GA 3KL2A 4XYGA 5JSZB 4YMSA 1PJRA 1SAYA 1J2EA 4OQFA 4KFRA 2C61A 4QXOA 3R20A 1N6KA 4KLCA 1QHGA 2MCFA 2BE9A 3FCAA 1C8KA 5G53C 1DX9A 4QATA 4IG4A 2C31A 2IU3A 2SICE 5T7BA 1UBUS 2HDHA 1A50B 3S8YA 1OX6A 4CEJB 4MLCA 2AG1A 4FT4A 5EJ7A 1UOPA 2GN2A 3BL5A 5GMOA 1U31A 2WPNA 2OQVA 4AO8A 1BVRA 4F3RA 1O0SA 4O2BF 1LNQA 3WNDA 3ZWDA 1QG0A 3P32A 1F6BA 3K72B 3FDXA 2VLIA 1COWA 1U0LA 1JJAA 3WSVA 4BDTA 1T36B 3CS3A 1CHNA 3D7MA 2FCAA 2ZAOA 3M6IA 4BBJA 4RH1A 3ED5A 1GRRA 1E3LA 4FGUA 4M9SA 1E1DA 4EMTA 4LGVA 5KKNB 1MOPA 2O1WA 3SFZA 2VSNA 4FKZA 1E4VA 2FOXA 3B7PA 3N8DA 3QKRB 3U7QB 3IP7A 2H4JA 5TQ2B 1MAUA 2WW8A 2XMSA 2O8EB 1P1BA 1ZSYA 3M4XA 1B73A 1QWTA 1FJ2A 2Q3EA 5SY6A 1A9SA 2C9BA 1IQ0A 2VJMB 3W0LB 2XSZD 2KMLA 4J3FA 1VL6A 1NNLA 1Z36A 4D9GA 4DEVA 2W2NA 1YQUA 3KKMA 2CE7A 1BQ3A 2WF9A 4U6NA 2B7BA 4HVAA 5C37A 4LYGA 4O02B 3DHNA 4RSRA 1TPYA 5A4MS 1DTWA 1EG7A 3AHJA 1S0UA 1E3TA 3L9WA 5EJ5A 3IODA 3PD1A 5KNBA 2GBIA 4L8WB 4U5QA 1KK0A 1ZBQA 1RWBA 3L8MA 1LPNA 3V8QA 4EJ0A 4LVOA 5AJUA 5JJLA 2BMDA 1M1ZA 4ICIA 5CXSA 3VRHA 4OYHA 3TBFA 2YRXA 4ZAWA 3RQIA 1IVSA 4A0RA 4D74A 4UATA 1OXBB 3KYCA 3PVSA 4BWGA 4DM4A 1XR3A 4OLAA 2FFRA 3IMFA 3FYUB 4JBIA 2LC1A 1GGEA 2OCGA 5D5PA 4FWBA 3GI1A 3ES9A 4RK5A 4YUYA 3RSZA 1TQHA 1IN5A 1B74A 3MJTA 2VC2B 3DE2X 1BYIA 1TAGA 2KLHA 2YV4A 1AKRA 4FNAA 2JQLA 1SKAA 2L0XA 1AMOA 2CB9A 1RYMA 3BMOB 3C1AA 3SC2A 2KI5A 2RC5A 2IUEA 3M6XA 4MGKR 1MO6A 3VC1A 3ZWCA 4RQBA 3ZU3A 4C0BA 2BHNA 4FX2A 2Y71A 3U37A 3HV2A 1VI5A 2NP6A 3H9CA 3IQXA 5FJJA 5CX4A 5ETJA 4RE6A 3DR5A 1RP1A 4UULA 5G1PA 4JCCA 2XF2A 3ESBA 1R8QA 3FFXA 4B8WA 3WL5A 1ZGJA 4J4BA 2NVUB 1FFSA 3BB4A 4UCWA 5FULA 4D26A 1QDLB 2J0EA 1KEWA 4HPJB 3LX6A 4EJMA 4ABTA 3DE1X 3TTXA 4C7MA 1QVVA 1UJ2A 2HA7A 3LT0A 4PV7A 4TS1A 3QEJA 4BQNA 4ZTZB 3KAJA 5MN6A 4KITB 2R6AA 3SFVA 3WJ2A 3SK0A 2EBHX 1KI3A 3H83A 3TRIA 1X1QA 5BSKA 4GOXA 4YJHA 2LDBA 3WKCA 1YA8A 2TMGA 4F2HA 4X6UA 5JXWA 2BGWA 1EX7A 3H5OA 1V6SA 1A5TA 2HA0A 1PKEA 1RQ2A 4R83A 4BNTA 3C6KA 5ICSA 2FPXA 3N28A 1LGPA 1WHTB 1YJQA 2WM9B 3LLVA 4OMDA 4XVUA 3W5CA 1QP0A 1IDOA 2QW8A 4TMYA 1II8B 1IXKA 1SZCA 2HWYA 3EGWA 1DOZA 3GELA 3OQVA 1VXRA 4P98A 4GOKA 4J0GA 1LLFA 4QDTA 5SZHB 4CUKA 4DNQA 3GXBA 1E3SA 1LSJA 2C58A 4UAVA 2ZSJA 1DOHA 2HC9A 1SUAA 1DT3A 4EECA 4IF6A 2NO9A 4ZREA 1UXKA 1WDLA 3T99A 3RE1A 4ZGGA 1SR8A 4ID3A 4F4CA 2E5FA 2X8BA 4ECEA 1LSOA 4COOA 1KZ6A 1G5IA 3V1LA 4YMLA 5K05A 4WXEA 1RPNA 1S8FA 1FPMA 4I1OA 4WNAB 1Z8DA 1Y3IA 2OFPA 2VDQB 5KTOA 4CM9A 1L3CA 1XZDA 1P5HA 2OL4A 5JNLA 4LJ6A 3JSAA 3Q1KA 1C9KA 1K0FA 1O03A 3F71A 4JDUA 2CL7X 5GGYA 4BNGA 1YQWA 5ECYA 5E6SA 3VYWA 3VNQA 2H3HA 1W73A 1UBHS 1IJKA 2VF4X 4D25A 2ADFA 3I34X 3PX3A 2Y92A 5LUAA 4C5CA 4JIVD 3EUAA 4CL2A 1BYUA 1PR1A 1LX7A 3LX5A 1NQ5A 5KYYB 5LB2A 2XUOA 1CY6A 1VE6A 1ZONA 2IPAB 3UANA 5JBQA 1N5IA 3X1MA 4K2HA 4DARA 2PFSA 3MINA 4PYNA 2I1WA 4F9TA 3Q12A 3L4BA 1I9GA 5A4AA 3OZXA 2B8TA 4KN9S 1X14A 1GNLA 3N39C 1OUMA 2Q50A 4QVKA 4ZRDA 2BZGA 2FMFA 3E8SA 3VISA 3VQTA 3FNFA 4DLAA 4A8JA 1R4AA 4X1KA 5GY7A 2IE0A 1CJCA 3B1KA 1KYXA 1ZWKA 3M6WA 4IHJB 4NK5A 1KDVA 4D3FA 2LRHA 2CXOA 1F3LA 1KVRA 2P8SA 5ILQA 3ZVNA 1VMKA 3IMGA 4N0MA 4W1RA 2A1UB 4EYSA 4YXWD 4NXNB 1INLA 1J0CA 5IW8A 5EFZA 1RWVA 3ICQB 1TJPB 4P32A 2WMDA 4X3CA 2GD0A 3KUUA 5G3YA 3EDOA 3T7EA 4EB8A 1DKMA 4ZK2A 1VIYA 2OENG 3P2OA 1KI1A 4F4JA 1YRAA 3CEJA 2I6FA 3T5TA 4YQZA 5GAJA 4RY0A 4Y6QA 3A7DA 4KLZA 2J9YB 1OAOA 3KKNA 2XUGA 1I3MA 1SBZA 5BSTA 2QBYB 5GPBA 1KZ4A 4CLOB 5JZOA 3MWGA 4G0UA 4B3TB 3HX1A 1COZA 2R84A 5EUCA 4AMGA 1RW4A 2F6RA 3RU2A 3PDJA 3WB2A 3Q8MA 3NTVA 3P8ZA 3OMWA 2PE5A 1RM5A 3EEOA 4JBYA 1JSCA 3CZQA 1AB5A 5EE1A 1AOXA 5BSMA 1TVCA 3RS0A 3MTDA 3K6SB 1RZRA 2E5LB 3RJ5A 3H2JA 1H2EA 2BH9A 3TL2A 1FNCA 1EFTA 2ZUCA 1ZZGA 3A9UA 4LYYA 4AROA 4CF4A 2YIVX 2YC4C 3TZQA 5JWRA 4EZIA 1XXHE 4G1FA 5E7QA 3OZRA 3WDKA 1U2DC 5IBRA 1R6VA 4ESEA 5GIPE 3OE4A 1Q77A 1NI4B 1Z62A 3CPEA 1ZD5A 2PY6A 2Z2YA 3AV0B 1GRNA 1MX5A 1BEUB 2P1DA 2YRWA 3VR4A 1RIIA 2X9QA 3LLMA 5CDHA 5LP6B 5FOWA 3RHFA 5IJ0A 5H80A 4QDJA 1RFLA 1U6JA 1MFPA 4BNYA 1P2UA 3D8SA 2FLVA 4LDRA 3CZPA 3MEQA 5DYGA 1X1TA 5FTKA 4C4RA 3R6WA 5JCOC 2QUJA 5LYJB 4I08A 1LJUA 1JHDA 3H65A 2XV1A 3CF0A 4LYEA 3LL4A 4RJJA 5DM1A 4K03A 2F43A 4NKRA 3KETA 3AIIA 2UXDB 5IJWA 4NZYA 1P0IA 3OUZA 1RYEA 4IEIA 3R6GA 4ENVA 1CXZA 3JARA 5D1NA 1WULS 5TVGA 3TTVA 2E5WA 4YJ3F 3LCVB 1E2GA 2P91A 2TMYA 2Z04A 1SN7A 3L3BA 3DKVA 1OLUA 3Q7IA 3O1JC 4L57A 3TQFA 1ENOA 1S89A 2W3OA 4OH7A 3PRYA 4PBSA 4TL6A 4IIBA 4GQBA 4I99A 1Z56C 5YASA 1FPQA 4CBVA 2JGIA 1BWQA 1B3RA 1SUEA 3FMFA 1U7WA 3HB4X 4NNPA 1JPJA 2WJIA 5E1BA 4O2AB 3K1YA 3FX2A 4JOQA 5AKLA 3PQDA 1BN7A 1XVLA 1XAGA 5EZSA 4M49A 2NYVA 2G67A 3IOCA 4NI5A 4NC9A 3SX4A 3WO0A 1JHZA 3QTTA 1GDDA 3RARA 5A5EA 4AKSA 5AKJA 3K0AA 5GP1A 5JYCA 3LUBA 1YGYA 2YVUA 3H9UA 1UT8A 1QFYA 3DPUA 3UGQA 2YHIB 3A6ZA 3D9QX 3EG9A 4C4SA 5ALLA 2IYAA 1JH8A 3IXLA 4KG7A 1UKAA 2GJ4A 1BO6A 1DIOB 1PEAA 1FX0B 2FP4B 3BHJA 3IJPA 1OVGA 4HXGA 4CIBA 3THWA 4HZUB 1HDIA 3O8BA 4Y0AA 4HEHA 2A9KA 2DWPA 4GMXA 4QU9A 1BHO1 3NPMA 2W6ID 3HM2A 3K5IA 1M8PA 2PCJA 1NQWA 3L1HA 1CZLA 1GAJA 4ZVUA 5G0VA 5HUQA 3UT6A 1WB6A 3HGQA 3KJEA 3FPAA 4EARA 1RQXA 3SSMA 3T54A 3FFTA 3GK3A 2PMEA 1SUSA 2DT5A 2I3AA 3A25A 1SG6A 3S1AB 3ASVA 3TZEA 3S99A 4LXXA 2AW5A 4FZVA 3H11A 3PFHA 5I5EA 1GAXA 1VIVA 3NAGA 3ZGOA 3FHTA 1CKEA 2DUNA 3IT0A 4BYGA 1V4NA 3RUPA 5DX8A 4INJA 2NZWA 5EHGA 2ICAA 3ZCVA 5BMVA 2MHCA 3G2MA 821PA 4PG5A 2O3JA 2QNIA 4OD0A 1RXVA 1N7HA 2X9VA 2GCPA 4KR7A 4IDNA 3DOOA 4LZAA 1XLTC 5KYUB 5LBTA 3M6LA 3UJDA 3GH1A 3B8EA 3UNXA 2A7XA 3DEKA 4OK6A 2MOKA 2VRCD 4IP0A 4LSZA 5IJXA 3L49A 4MP8A 5AXBA 4AL4A 3CW2A 5F51A 4GPIB 1LY1A 4PPQA 2QTNA 1W30A 1JF8A 1U7UA 1KMHB 1RWQA 3PNLA 3D4BA 1KFEB 1G6OA 1NVBA 4G9GA 4Q34A 2VTEA 2VJKA 4R1PA 4ASUA 1HV8A 2E4VA 4CZ2A 3R7DA 4JVNA 2WHXA 2QD4A 4IGIA 3JQ9A 4JLVA 3AC0A 5CA1A 5B6JA 3G5TA 3OFSA 3FYCA 2FDRA 3IQHX 1GL3A 2NXEA 1RI2A 3QWAA 3R0QA 3WSTA 2GCGA 3CZ5A 4ND2A 3WB1A 3CQ9A 1A8SA 1G7TA 2LTAA 4B4VA 3SQDA 3P2YA 1ULBA 4RANA 2H48A 3BGIA 3RIYA 4ZN6A 1SCDA 4JLJA 3BE8A 4DV4B 1Y42X 4BECA 2C1EA 1S1MA 1I7NA 3N8NA 2V58A 4LUCA 3KDPA 1FX1A 4QARA 3O21A 1BOOA 1FLNA 1TEXA 2HTEA 4KWCA 4UVHA 1TIKA 3RYIB 4DDHA 5FEMA 1T9KA 4NY1A 2DBQA 2VSOA 3KZNA 4BMPB 1P75A 5BV8A 3OTOB 1WV3A 3PUIA 3QYFA 4HDMB 3NT2A 4RF4A 4XJSA 5AVVA 1MENA 3A9RA 5DASA 2W8ZA 1Z0AA 2Y1EA 3MAJA 1RZRD 2FW9A 3QE4A 3OESA 2C5LA 3O3CA 1XWIA 1SPXA 4P8RA 5D51S 1PZFA 5CH3A 1BH2A 2VHUA 5ITWA 2V1XA 1OROA 5IDQA 2EQAA 2XYRA 5JALA 4MIEA 2VR1A 1U0JA 3DDNA 4WY5A 4C0HA 3FHCB 5DP1A 5SYAA 4A73A 1GNPA 4KHZA 2IF0A 2YS6A 4LRQA 2XBUA 4F8EA 4H1UA 2XNDA 1PAUA 2BMVA 4OAPA 2CJXA 4S2EA 1KEEA 3UK1A 1DGQA 2ACEA 4KRXA 3ACCA 3D3NA 4KXXA 4CM9D 1VG0B 3DEYX 2ZXFA 3BOSA 3ZDCA 5FI3A 1I24A 2VXCA 2AC4A 4U2BA 4CWAA 1NSFA 3IT2A 3PNMA 3KQQA 1JPNA 2C5BA 4PX5A 4ER6A 4TLDA 5I7UA 5KJCA 5F1YA 5IXJA 1LJ8A 3IEUA 2IP1A 5F64A 5JNUA 1GTJ1 1N2JA 1M6NA 1NXXA 2QD3A 1N57A 1N2CE 1M1YB 1A7UA 1LQ2A 1C50A 3L4KA 1RZVA 4MDYA 1EESA 1Y80A 4L7VA 3O9VA 3RTAA 4PNEA 3THYA 1NJFA 5C81A 1BFDA 1DTSA 4P92A 2LD4A 4BQSA 3IVAA 1T34A 3JQRA 1O6CA 2Y1GA 3DE6X 3II6X 4W1QA 4YJ2F 5DNDA 2PT6A 3C6QA 4PLYA 4TL7A 3X0DA 1V5WA 3CCCA 4HEQA 4KYIB 4I4TF 4KQMA 2ZSKA 2CMHA 4BEVA 5BW8A 5FPKA 1AVTA 1JR4A 4LISA 1GG9A 1N8SA 2MSWA 2FF5A 5CVEA 2O7QA 1WXDA 1YVUA 2PWBA 1YJ8A 3DULA 3GD7A 4FUQA 3JALB 4F2DA 2PV0A 1RTKA 3ILVA 3IAUA 3WKDA 4H7KA 3V33A 4MS1B 5EP4A 4GP7A 4QUIA 4D4IA 1N1MA 1Z2DA 3HDGA 4F45A 4CCWA 1GQRA 5JEDA 2XYHA 4NE2A 4IVRA 2PUCA 2YFHA 5DBFA 1QO0D 4MLPA 4H7HA 4AX4A 3RYCB 3JAMA 1XZKA 2ODNA 3ENZA 3LMKA 5HFNA 5LQCA 4B7CA 1DKQA 2QTLA 3HKBA 1ND5A 2O3UA 2UVDA 1G0NA 3LBIA 4IS3A 4OKIA 4WA7A 5BQOA 4CMGA 1Y6QA 2ZIXA 5CLGA 1T35A 5AYVA 2FK8A 2HEIA 2HO5A 3EQ2A 4QECA 3F7NA 1GRVA 1XAIA 2P9JA 1H8HD 1RIFA 2BFCB 3D81A 3OOYA 3QJGA 3TTTA 1W76A 2X5XA 1KVTA 1HEUA 3CV3A 2SKEA 5HQ3A 4IQ4A 2HZ7A 3CXUA 2YWHA 3GMSA 4FT2A 4MICA 4D57A 2Z57A 3IR6A 5JELA 3A3OA 1B43A 3JAWA 3ZXXA 3EVZA 4X8HA 3CUYA 4OI0A 4B09A 3C48A 3FZGA 3O1LA 3QMPA 4MVJF 4PSDA 1HYBA 3LC7O 4RJLA 4DKXA 1C3EA 4O1MA 2C4VA 2I22A 4GE3A 5AOBA 2CCGA 1MF7A 4PNPA 3JQPA 7REQB 1YFLA 1YU6A 2ATVA 4KR9A 3QF4B 4PX2A 3C4VA 3KKLA 3E6AA 1PD1A 1F1JA 1Z39A 2WWIA 3MCZA 4XX0A 3HN6A 5THKA 1OREA 3IUJA 1VL2A 3EUEA 4FUTA 1MEOA 4NDAA 4ZYYA 5F35A 3IB6A 2HQOA 4O59O 1QMGA 3G85A 3X2FA 5JDIC 2OO7A 3WYAA 3UFXA 4C7BA 2DFVA 2IYXA 3AZOA 3C41J 3CNQS 3P5SA 3M83A 3SJUA 4E2ZA 4F5EA 1WXWA 4O4IB 3Q7RA 3ZUPA 5FFFA 4V24A 2JGFA 2C98A 2IXDA 2LDXA 4HGYA 3BMXA 3O94A 4CQMB 2D1FA 3I5MA 5C1OA 1HLFA 1ECBA 2QDKA 3NNNA 2YJGA 3B60A 3GJSA 4N7MA 3WP1B 2DLCX 1ZR4A 2FUG6 4F5ZA 1KYIA 4PXYA 4G5XA 1OBFO 2WYIA 3OETA 4LI0A 3U3OA 1EJ2A 1Q91A 3GXOA 3WLSA 4D98A 5EZYF 1KSFX 1V41E 3VTFA 1PL6A 3I1JA 4WBNF 3U4IA 1C9NA 5EAIA 1Z0IA 2V7WA 4I1IA 5ERGB 3OLZA 2DH6A 2FEXA 4DG8A 2I34A 1F6WA 3JZIA 4WK0B 2DE0X 4DWVA 2QP4A 4NQRA 5L7YA 3W8RA 3R7WB 2HRDA 5CDUA 1TL7C 4XXHA 5TIIA 4BNXA 4X84A 1ATZA 5CA0A 3S7ZA 3QKIA 2PLWA 4JJAA 2ZWOA 4TVOA 5DCLA 5BN3A 3HQ4O 2JI8A 2WUWE 3P71T 2F1JA 4Q37A 2ZJOA 3QMWA 4R1NA 1TF2A 1BXRA 3NIFB 1SKMA 2YWRA 4H1TA 2OGWA 4DM7A 2BEWA 1DOAA 4U8GA 3W5AA 1HF3A 1WMDA 1JFFB 2A5FA 2XF8A 3LK7A 4MIKA 1IJEA 3BRQA 1L5HA 4QOEA 2UDPA 4PQRA 4BV2A 3DYVA 3AEYA 3KEQA 1E18A 3NHAA 4P4UA 1ZMTA 2MYTA 3DF7A 1AQLA 4RA6B 5ALGA 3ZHYA 1CUHA 4WZ6A 1D03A 4O63O 2NU8A 4BQEA 1AQYA 2X8AA 1U2TA 5KTSA 2WFLA 3DL7A 3ELYA 3PB3A 3ZHZA 3LPNA 4EO7A 4ZI7F 3CLSD 4YRRA 3D7LA 1P5JA 4QG7A 4XYBA 3RUDA 4DAEA 2ORYA 2FSPA 1YZLA 2Q2WA 2XQVA 1XWWA 4Z3DA 1IZ8A 2FN7A 4URXR 2FX5A 4QSMA 4CMBA 1W25A 2RGEA 4XVRA 1W36B 4QPJC 2WAMA 4YRNA 3EVDA 2LWIA 3LP5A 3P2JA 4D0SA 3O2JA 4GZLA 4WHMA 1XZLA 3U40A 5ITZA 2WQ7A 4XJTA 4TXLA 1ZO8A 2QENA 5NLLA 1O5TA 3G1WA 3OPYA 4YI3A 1MIOA 4M9ZA 1GU0A 2PG3A 2CK3A 2VF2A 1OXKB 3AG5A 4V0NA 4WLFA 5E4JA 4ZT3A 3HEMA 4AG3A 3H5WA 5JH7B 3KYDA 1NSYA 2D0OB 2GJSA 4B3MB 4Z1OA 3ELBA 2YXDA 4AG6A 2HQBA 3UOWA 1SZJG 3G0HA 1VCIA 4K9PA 3KSDO 2XCRB 1L5SA 1GUAA 2WQ6A 4U7DA 1U7ZA 5CIQA 1G4AE 1KE1A 1B26A 4GLJA 2ECPA 4K0KB 4RK4A 5FOTA 2HAEA 4M1YA 4HQKA 1HFWA 3DLCA 1PO7A 2PA0A 3H7AA 4MZDA 1KH3A 4LHWA 1ACMA 4EUEA 4MULA 9LDBA 1TM4E 2PX5A 3H86A 2XCTB 3RKUA 3TEFA 1Z2PX 2EW8A 4D9MA 1UFOA 2CNKA 3FN4A 4XYEA 4QG3A 2A78A 5TPZA 2VP9A 4MW5A 3PQ5A 4B3BA 4BJ3A 5A3VA 5HIAA 4UXJA 5IVDA 1GQSA 4ZAXA 4EY3A 5I7SA 5F76A 2OG2A 2H2GA 1FS4A 2JLZA 4BNDA 2XQKA 3NHSA 1QHNA 2FK7A 4DJEC 3NBYC 3ICEA 1IPHA 3ANLA 2CHFA 5ESRA 4DLSA 2NQ8A 1LV8A 2C4WA 2R44A 1XQ1A 3MERA 4D3SA 7GPBA 1X13A 3V1YA 4BO6A 1JLRA 3DG9A 4R0MA 2FVYA 1HLPA 1QF7A 1VLQA 1I3LA 1PCXA 2UZ1A 3CF4A 4M7RA 3RRZA 3T5AA 2B9VA 4RTPA 1Q0TA 1LH0A 4IEFB 4HY3A 5F2EA 3M3DA 1NW4A 5F52A 2JGDA 4CU5A 1PGNA 1OX4A 2BTQA 1BQ4A 1MOQA 3TSYA 4MHTA 1H5NA 1T0UA 2CYBA 1N5OX 3L8EA 3USCS 3UK2A 2DPYA 1MA0A 3C14C 2OLJA 3ZHTA 4D0NA 1XPOA 5G0WA 3I52A 1AZWA 5KVSA 3QI2A 1L5GB 3TE7A 2DWUA 1ISPA 3MWDA 4KO2S 1ZJ4A 1NN1A 1GGNA 2VT6A 3DW1X 3L0BA 3OCYA 5CEFA 1C30B 1U4NA 1JEYB 4HN2A 2CLKB 1TLLA 1JHVA 3LW8A 1HZJA 1GXSA 3K9BA 1DHRA 3EVGA 4KBGA 1HKUA 1SCAA 3H0KA 2DP4E 1CTQA 3HWWA 4QOJA 1II0A 5EERA 5HSGA 1WMAA 4GI3A 1UAAA 1E1NA 2J9GA 3EGDB 1L4HA 1QVRA 5E7MA 2WYVA 3B3AA 4AFNA 5DYNA 3HVRA 1QH1A 4JUIA 3S44A 2OO5C 5TSDA 4M8NE 5IZ4A 5F3WB 1RYHA 1QYCA 2B7CA 3BDAA 3FFWA 3PZRA 2Z3WA 2IP4A 4BQOA 1OPRA 2BRUA 1I6KA 2MT9A 2ZG6A 3L93A 4HVLA 2Y76A 2IXAA 2Z8XA 5ADUS 3QOFA 3AIOA 4OA5A 1E1QD 1TMYA 1PZGA 4JLNA 4DN6A 1LCIA 4YQFA 4IMIB 2CHEA 4YAEA 1TT5B 4OMUA 3QUAA 4UM7A 1PNRA 1A5SB 3TIXB 5CFOA 1KZ1A 4MWCA 5DEIA 3HSYA 1MLDA 4O0MA 4BMCA 1E3DA 3JWGA 5J9FA 4GSKA 3K4PA 3Q85A 1RRCA 1R9NA 4KV7A 4MR8B 5B55A 1UZMA 3QG5A 4C6RA 1BS2A 2Z6QA 1E3EA 3VZBA 3ETNA 3ZDQA 3P9ZA 3G17A 3OEHA 3FUUA 1CRQA 3MGCA 2DWCA 5H02A 3S29A 3G8CA 2DF8A 3BSWA 3DWIA 3LYAA 3L6EA 3PWZA 4JH0A 5FA6A 3RCBA 4CDGA 2Y6VA 3HWSA 1DEKA 2P0YA 4L22A 3H2IA 3IQEA 3OQ6A 2E21A 1W1IA 2C1XA 4LX8A 1WEKA 4FGLA 4XRGA 3AUFA 4BX8A 5SV2A 1BD3A 1QGYA 1U0OC 3T3IA 4JYAB 2RFLA 1FY2A 4TQAA 1G0OA 3GNTA 3NHUA 4J49A 2RSLA 5CYFA 3ZE8A 4ZZ1A 4RDXA 5AVUA 5KYTA 5LB4A 1LBQA 2REQB 3HXTA 4OLHA 1HE5A 2O7VA 1UXGA 2B8EA 3GJ7A 4JJFA 4CKYA 5K8LA 2W2MA 3MMNA 4NWIA 3TW6A 1Z5GA 2YOFA 3U1VA 2AJCA 4IUYA 4K7JA 2XCOA 3KJIA 2XEDA 3OA2A 2OSVA 4RW0A 1Z15A 4TKVA 1R0BA 3AIKA 1KJIA 5LXTF 2JFUA 3ICPA 4BGVA 3U4QA 2H57A 5IKOA 4JI1B 1IOLA 2XQGA 2WTXA 5KSWB 3ILSA 1USUA 5A06A 1ODIA 5CCBA 1ESDA 3P9NA 4KXVA 1OWOA 2B3DA 4MVJI 1N2HA 5IX8A 2R6JA 1QK3A 2GH1A 2P9ZA 2Y2VA 3BH6A 1C4XA 4PCLA 4CL0A 3IYLW 3VA7A 3H19A 5HQTA 4FLFA 2Z4SA 1IAVA 2P78A 1ETHA 1NZFA 2J3EA 2K6GA 3GRFA 4I50F 2PJZA 5KYXB 1NYTA 5KHLB 16PKA 1SOUA 3CH7A 5F78A 2JFFA 2VYVD 5HF9A 2UZ4A 4CTJA 1H3EA 1U3FA 1NMYA 5FNZA 3RHSA 3SC4A 1CFJA 1P4GA 4WESA 1T24A 2BJVA 5DNCA 4NJEA 2X9NA 1FSZA 4ZVVA 3JQBC 3NB0A 1RYNA 5KYGA 2EFDB 1KNXA 2IPNA 1Y4UA 3ABRB 2HK7A 1GHTA 1H1TA 2VTDA 2XT0A 1OZAA 4WN3A 2XB2A 3WNBA 1QBKC 3R7BA 3AF5A 3BKXA 4B3DA 4I36A 2DR3A 3PPXA 5KU1A 3E22B 2J8ZA 2G06A 3G2KA 4G5OA 4GO1A 4HLUC 4ND8B 3R7NA 2HJWA 4CI0B 1RLMA 3LQKA 4YNBA 3T06B 4DUGA 5LZ2A 1GG5A 1K4MA 1W4AA 3KJQA 4BVLA 1E9VA 4BNMA 4G0QA 2Y1KA 4L4XA 2C5HA 4KQ1A 1KDZA 1Y3AA 3PA8A 3KZOA 1WUKS 3NHRA 4DCCA 5I8PA 2GUGA 2Z2ZA 2V74B 2VDOB 4QRHA 4DG5A 3LRXA 4UAGA 2BGNA 3HBFA 1UKCA 1FJHA 1XLWA 2FQWA 1ITZA 1BJKA 1E1RD 1U2GA 2NXWA 4MRNA 4CMIA 3U61B 2FWRA 3UMBA 1EAMA 4NMHA 3PVZA 1A8QA 3NHZA 2X76A 4NK4A 1EFRA 2IYUA 2R97A 3E1KA 3LA8A 1JMKC 1Z35A 1S1CA 3RVKA 1Y37A 4P2BA 4PR3A 4Q1CA 4B6JA 3NASA 3D2BA 3VO8A 2OAEA 2YWEA 3LYUA 2OZKA 4FE4A 5GV8A 5B30A 1JFTA 1UKEA 5EKXA 2XZLA 3Q3EA 4M1SA 1JG7A 1P2SA 3UAWA 2XADA 2Q3CA 2YZNA 2XRMA 3ESRA 3FPGA 3OCWA 4LMRA 4UREA 5B2FA 5WRFA 2BMJA 2JKDA 2Y05A 4RL6A 4QGHA 5GM2A 1XVUA 2VJCA 4N8EA 2JC3A 3B2NA 4RFVA 3SYMA 3PQ2A 1N7IA 5JWOA 3GA5A 1U3GA 3DV9A 5FO0A 4EDFA 3HE3A 3JY6A 1AUXA 1NJGA 2A0FA 2OCDA 3FOCA 3GARA 1C9JA 1IOVA 4DHEA 1VPWA 1KKLA 5JUWA 3EX7C 3B5IA 3ODGA 3CNNA 4UUQA 2X4DA 2VK2A 2B1IA 4U9HS 5TRTA 4N6NA 3FSRA 2AVDA 3IUNA 4IKEA 1YQQA 2CMGA 4X00A 2X13A 1OC2A 2WF5A 3C4QA 3TBKA 4OSOA 1Q0QA 2OP0A 2HYDA 1DV1A 4Q6BA 1AMNA 3ONWA 1H6BA 3CINA 2BUAA 3QITA 4MMXB 1FYWA 5L6LB 5I9TA 3H84A 3C8ZA 3PSHA 1D6JA 4PFJA 5L8VA 3E0XA 3UEOA 1W4CA 5K3CA 4GLFA 3VSCA 2F8SA 1G18A 2X86A 1WA5A 1ZM3A 2CVQA 1LDNA 3PFNA 2VO1A 3RT1A 3AOEA 3WYNA 1PHPA 4QDXA 2P9GA 1F06A 4O0LA 4EA7A 1L1QA 2IY8A 5KWVA 1KYZA 4XD7D 2C2KA 2KJQA 3JASB 1QORA 5TT0A 1CLEA 1J24A 1RXUA 4BLVA 3QX3A 3JQ7A 1WKCA 2ZSAA 4M0MA 1QHIA 5B1EA 2PUDA 1B42A 3PHIA 2PX0A 2ZR9A 3IRUA 2IX3A 3MWJA 1TYZA 2R6DA 3AHDA 1EDZA 1OHHD 1N2OA 3C5WP 4ILEA 3L1UA 1AO3A 1DUSA 1FUEA 1QE3A 2WJ4A 4RCZA 4ALMA 2GBLA 3PICA 3G88A 1DPFA 3W79A 3ON5A 2AXPA 1ZIOA 1OXUA 1GZ7A 4ALLA 1XRRA 5SYMA 5IK2A 1CB0A 3F49S 2K5UA 4HNUA 2IYWA 5AW9A 4EBBA 1TVMA 2J4FA 4NPCA 3PE4A 3GW8A 2AOWA 4G09A 1N8KA 1PYOA 3RFXA 1STOA 2VJDA 4ZI2A 1KDRA 2BC9A 3FNGA 3AFHA 4XR9A 3IA7A 4A23A 5K4HA 1NIPA 4W8OA 4BNNA 3J81A 1ZUIA 1YU9A 5FTMA 3LHSA 3FUTA 3OM0A 4L8LA 4V0QA 1QP7A 2O5CA 2OCYC 3DAHA 1JL3A 1H66A 2ZUBA 3T7IA 4UNIA 2YW9A 4IY1A 5KJEA 4J6FA 3LWZA 2B98A 5AI5A 2PMBA 3MAAC 5F2OA 3ODPA 4KYTA 3BL6A 5B58T 1CUBA 2IIVA 3TCKA 3WZLA 3H17A 1KSHA 4V0ME 3T7TA 5LKRA 4FFVA 4K46A 4TWJA 3MB8A 4UCQA 1TMOA 5CTJA 3GR6A 3TD9A 3FNBA 2I2BA 3E84A 4D96A 2W11A 2QYOA 1DFIA 1TZJA 1N92A 1I2AA 2PFGA 4AMUA 5E4TA 2CDBA 3BTUA 5LNK1 1PNVA 1WVIA 4FKMA 4JN6B 1IAQA 1GN8A 2JIBA 2C9DA 3PC8A 5J2TB 1NJSA 2BLNA 3I0NA 3DKKA 3OTWA 4XCXA 3AVTA 4DILA 1WTCA 2GASA 1FL9A 1EWRA 1HT3A 1L8QA 2HWXA 3BE4A 4MRMB 3D7SA 3CVYA 4PZCA 2FNAA 3CISA 3RVRA 1Y34E 1NYRA 3A6JA 4AT1A 2JHFA 2OGZA 3FFBA 3SJCA 3PD7A 3STVA 3QV1A 2E37A 1LXCA 2G80A 2QZSA 1PJLA 4L6AA 3UG7A 2EC5A 2HRBA 1I32A 3EG5A 3LO5A 3VHRA 2NV0A 4WJLA 1C7FA 2IBTA 3STWA 3NTUA 2AH5A 1E3WB 1N0VC 4DLKA 2ZYRA 1J49A 4O4JA 4IIXA 3HCDA 4L5AA 3A1DA 3RSHA 1GRQA 1U8UA 4IHAA 5B3KA 5JAOA 2XCSB 3CX7A 1VIMA 1Q92A 2JFNA 4BVEA 2VSFA 1NE2A 2IX9A 3Q10A 4X97A 4CFSA 7MDHA 1I7SB 1U7FB 4J0EA 3NIDB 3RNLA 4ZICA 1TM5E 3CZ4A 3EAQA 1OA1A 1GPAA 2BE7A 3GN2A 3AXTA 2YZKA 2PBLA 3IAHA 4RCYA 4BP1A 4AI6A 3LGXA 4MRSA 4BFXA 3HRKA 5FBKA 2WTUA 3Q7EA 2W5UA 2VCYA 3LLSA 3PC4A 4FYPA 1SCKA 4LKOA 2O8DB 1RPZA 1P4AA 3AVVA 2IEIA 3MMZA 4YJFA 5EJ9A 1JVBA 3U4AA 3RVBA 2FN9A 4GRDA 4AF6A 3CW8X 3LG2A 2ODWA 2Q5CA 1ARZA 4IIYA 3TR0A 3U7IA 1P7YA 4KYVA 4DOMA 3R9XA 5TE9A 1XDDA 3B3GA 2C2OA 3NBZC 4Z4CA 4OUKX 3ACDA 4PZZA 5KNCH 1M2HA 4OYLA 4TSKA 2VT7A 2RBKA 3RAPR 4RPLA 1OCEA 3R5FA 2HWUA 3GBPA 4BASA 5IVKA 2A5JA 1UBRS 1P45A 3JRXA 3LXXA 2H2IA 3P0EA 2WJZB 2E9SA 1K6EA 1XZ8A 2XE4A 2ZGVA 5CFLA 3K8YA 1BKSB 1XD2B 1YHZA 3DVLA 3KQYA 4UHFA 3ZHQA 5JCJD 3ASYA 3EXHB 5EWMA 5I7RA 2BL4A 3T9CA 3RBVA 3OI7A 5D01A 3TGWA 5C53B 2DQSA 4CM8B 3FTEA 1MPTA 3EIEA 2DQ4A 2ZJ0A 3UG6A 4BQIA 2EIXA 3TQIA 3RSFA 3SEFA 4DDWA 5DU2A 3GJTA 3FGPA 4NENB 2X6RA 2JLUA 3Q9NA 2CDAA 2O1SA 2R5FA 2O3SA 2X58A 4W9RA 1NC1A 1PR2A 2AOTA 1T1SA 1JZTA 4F3KA 2XPCA 1H4QA 3LX8A 1UDXA 1Y5LA 2V7UA 2WFAA 3EGCA 3K73O 3OEEA 1Z7YA 3R4CA 4WEOA 1A2OA 1Y9EA 3KHKA 5HM6A 5JD6A 1NTOA 1IZZA 4QT0A 2HW8A 3K1AB 5I7AA 3FCUB 3MD0A 1ECPA 1RKBA 1XJ0A 1U1GA 2I1VB 1F17A 1ICIA 3O3OB 3X2EA 1MN6A 1H3NA 1QRDA 2HBRA 2PUWA 4D9VA 1O94A 2O4UX 4P83A 1GPMA 3HCAA 3CR8A 4D0LB 2PMCA 3T7SA 5M2QA 1DZIA 1E0DA 3O90A 1GZDA 2H9YA 2P4EA 4EOGA 4IO1A 4W6QA 4HAYA 1E98A 3O7WA 4QM7A 4DLPA 5DGCA 1YDMA 2WOJA 4EKIA 4C78A 3SD7A 1GTRA 1WD7A 2OT3B 4PX3A 3DCNA 1JU4A 4X8OA 5KSZA 3W5HA 5L3QB 1M66A 4EGXA 4UUBA 3GGSA 1V1RA 3I6ZA 2OM6A 3PNKA 4HWGA 4LV8B 2C54A 5D5QA 5G02A 1KFCB 3QPDA 4XM2A 2EDAA 5AT1A 2C3OA 3TZKA 4DCSA 1ZVVA 1EGQA 3FAZA 4KFCA 2HEGA 1PBTA 4JT8A 1XPRA 4B47A 2EFJA 3IT1A 5CYPA 2ZSEA 1YS9A 4OQEA 5IM5A 1KL7A 4AAYA 4G37A 1RJ9A 4FFBB 3DTVA 2VKTA 1PFWA 4RKEA 4PPYA 4DR4B 3KE9A 4BMZA 4F5DA 1G19A 2ROQA 3A1WA 3L4EA 1SQ5A 1IL0A 4K1XA 2W7TA 1S3SA 2BDTA 2PXHA 4YUAA 1Z7WA 4OQPA 1J23A 1YS1X 3WMWA 5IU6A 3KQUA 1A0OA 4A6EA 2H2AA 2O20A 3CT4A 1H5QA 3L1IA 4MCIA 1GL6A 3SKYA 3TRDA 3C3EA 4JI5B 4AJNA 2ZRHA 4CQMD 4IOKA 1JT9A 2FB9A 3R44A 3GLHA 3LLUA 4Q7JB 4RLSA 1WW3A 3ADCA 3GN1A 2VPIA 4EGJA 5D1HA 4KRYA 4E70A 3AMVA 1Z8HA 5EP3A 3FSGD 1EWKA 1J8DA 2AUTA 4Q0MA 4R8SA 1BQEA 5DX1A 4ZVTA 1BRTA 1TKRA 4ZDIA 2BGLA 1VSUA 2FWAA 5J4HA 5LOVA 3P94A 4Q7EA 3FJYA 2Z3ZA 3DUFB 1MQSA 2QSZA 5FOQA 4W7SA 2AI3A 2ZXEA 3TOXA 4E1BA 2H1LA 4QQ8A 2A58A 4FMCB 1LU9A 3N0XA 4WECA 3UB2A 2I66A 4EK9A 1Q20A 5FAKA 3W3AD 1Y4AE 1G6KA 4MHSA 4GOJA 1G5PA 5AKKA 2H29A 3GQBB 5JSHA 3Q5EA 2NLOA 5GZ6A 1J0XO 5HFJA 5A0VA 1ZK1A 3BMCB 4K5QA 2J3DA 2OORA 3F8WA 1PFVA 3H1AA 1AK2A 3B3FA 4QAQA 2A35A 5REQB 2ZS7A 1SXPA 1N33B 4N01A 2FMIA 3HA3A 2NZ2A 1YUNA 1IBKB 3AERB 3LY9A 3GQSA 3GHHA 1XQWA 1W48A 4QUBA 4D5EA 4G2TA 5HS4A 5BW6B 1ECJA 2BFMA 1MX3A 5ENDA 4MQ6A 3BDIA 4AYXA 3L9XA 5J2TA 1ENYA 4PQFA 4HFJA 3ZQUA 1L5MA 1YHYA 2CWWA 4Z51A 2AZXA 1QFZA 2CSXA 3QY0A 3H4VA 1C0PA 3GWZA 3MS4A 1JQBA 2Y6UA 1Z47A 5LA6F 3T9EA 3TW0A 5FD8A 3N2YA 4I3HA 3ZI0A 2OZLB 2A9RA 1ISRA 5DM2A 2WT8A 1K88A 1IY2A 1CW2B 1QIEA 1XVTA 4QTTB 1GT6A 1Z13A 2QRUA 3QVVA 1YR8A 3EH1A 3RR2A 1DX4A 1NBMD 3BIJA 2ONZA 4QNNA 5IUNC 1MZPA 2NACA 1W36D 1MH1A 4LAFA 1FMLA 1PV1A 4TWZA 5JRDS 3HJFA 4DIFA 1LPBB 4JUBA 5JXIA 5FCDA 1KK2A 2BM9A 3QX9A 3ZW8A 4EIWA 5AICA 4G1UC 1ZUNA 2ADOA 2JRLA 3DE4X 3I6IA 2BHSA 4DCNA 3BBLA 5EMKA 3TJMA 3PTLA 1Z12A 3AR5A 3DBHA 3TQSA 1WXQA 2HXSA 2IDJA 2FG7C 1YJ5A 2N42A 3L8CA 5AK3A 1P33A 1XTRA 1RAFA 1WY7A 2X6QA 3U3JA 3JWEA 1WTAA 2PIAA</