4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
1U0RA 5DHSA 4DY6A 2I2AA 3T5PA 1Z0SA 2I1WA 5DHRA 3V7YA 2I2FA 4WRRA 4V24A 2P1RA 3V8QA 3V7WA 3VZBA 3V8PA 1YT5A 5DHQA 5EJHA 1SUWA 1Y3HA 2I2DA 1Z0UA 1U0TA 4HAOA 5DHTA 2JGRA 2Q5FA 2I29A 5EJGA 1Y3IA 1Z0ZA 5DHPA 3V80A 3VZDA 2AN1A 3PFNA 3V8MA 2QV7A 3S40A 2QVLA 2BONA 4WERA 2I2CA 4L02A 2I2BA 5DHUA 3VZCA 5EJFA 3V8NA 3AFOA 5EJIA 3V8RA 3V7UA
chains in the Genus database with same CATH superfamily
1AQLA 2IY7A 1X0VA 1UP6A 2GSWA 3N74A 1VCNA 2A9OA 4FSDA 2XXAA 2ECOA 5CFPA 3FZEA 8LDHA 3ZW8A 2XQGA 3QUBA 1GR0A 4AYTA 3RF7A 2ZITA 2BISA 7YASA 4JYZA 1N6RA 2FP4A 1MO2A 3U16A 4LJRA 2JPEA 2ZB2A 3WMEA 4B80A 1L7RA 2OO3A 2QW1A 2Z2ZA 5E2BA 3T52A 1Q14A 3R8XA 3CSDA 1W2HA 1J70A 3G2NA 1FXWA 5FBQB 4LXTA 2QUAA 1ZCZA 2H18A 3I23A 4J90A 1E9FA 2PM8A 3C87A 4FQ5A 4GBJA 4RADA 4KMSA 3R7WA 2E4VA 1ZITA 4I5FA 2B5VA 2V9PA 4DT1B 3VGPA 1V7QA 4H6VA 2G1LA 2VAPA 2XCIA 1TJNA 4FS8A 3S2IA 4CMCA 3FOFC 2V58A 3B1VA 3U31A 3ABRB 4JBGA 4BQRA 3GVPA 3RYFA 2FFHA 4OGWA 2R1VB 3GJ4A 2OV3A 3GLGA 2ZYHA 3II6X 4UATA 1E79D 2VATA 3R3ZA 3NJ8A 4JCCA 2XRFA 4LXYA 1FRNA 3FIJA 1GCGA 1RVDA 4FFVA 2QGNA 1XDBA 5F73A 4QODA 3D0OA 3OE1A 4M0DA 2C00A 3WS7A 3ECSA 3ILHA 5A4FS 3F46A 1S9DA 3MELA 1ADGA 3JQ8B 2AD1A 4TT3D 3IIJA 1QVRA 1PUJA 2FSFA 4KHZA 4EHJA 4ZZ1A 1V16B 3DHYA 1YL5A 4ZEXA 4K7JA 4J16A 2BEWB 4NIMA 4DSZA 1ZMTA 5DM1A 1K98A 1QBGA 2FA9A 4JJAA 2WLTA 5COQA 3T4XA 1M3SA 4DG5A 2I7TA 1I0ZA 3MRTA 4KQKA 5J2TA 1NVDA 3I0MA 4BASA 2ZP1A 3K8QA 1Q1NA 4KE8A 1ZUNB 1K4YA 1HSZA 1XJ5A 2BGUA 1FZQA 4AO8A 3FCAA 5IW8A 3VYUB 5JQWA 4PFJA 3ZHUA 2F6RA 2YYZA 3VJMA 4MAFA 1EU1A 1TF7A 2FNAA 4NJEA 1YSCA 4DV6B 1LDEA 5B2EA 3JS5A 1R12A 3A1FA 3PI6A 3HEMA 2QG6A 3B78A 5AKJA 1E58A 2H17A 3OIVA 3AQ4A 3RVPA 2OHXA 1WDWB 1U5BA 4NDZA 3NHRA 4DZTA 3CGWA 4Y9DA 4Z1MA 5F51A 4E22A 2Q3BA 1Y0BA 1FP2A 1ZWKA 3PJGA 1TPYA 2VC2B 1Q91A 4TGLA 5CK4A 3Q41A 4XOIA 4X1KB 1CQXA 4HO1X 5KJEA 3WRYA 2PUWA 4QDKA 2JGEA 1JA9A 4PZZA 3VVMA 3PTZA 1R6UA 3OPQA 4LSZA 5F1KA 2NUAB 4Z5XA 5LQRA 3GJ0A 2JCXA 2B8NA 3OA0A 2AVDA 1GUFA 4XEHA 1W59A 2V1XA 3T7SA 5KJCA 3TQRA 3KXKA 1FRFS 4KYTA 5FPTA 5GQSA 1X86B 1MGOA 2D2FA 2I7VA 4FMDF 3F1LA 4AQYB 1F8GA 4DKXA 4UMEA 4FOTA 1L7OA 1Y6JA 2NZXA 4FR2A 4KQWA 4TL6A 4FS3A 3VAYA 1NMEA 1G0OA 2VDNB 3EPPA 1X39A 3OEED 1WHTA 4MWCA 1M7HA 2IKQA 3GGSA 2XCSB 1RZUA 3QI7A 4AJ2A 5D6OA 1Y6FA 1WKVA 4G37A 4Q3KA 4LPSA 2EG5A 1GRQA 2X58A 3D0QA 4FVTA 1YHYA 4JUFA 2YV4A 4R1LA 4BEVA 4YCCA 3AM1A 4BMVA 1MG0A 2ZPAA 3MINB 2Q1SA 4CWAA 2A9VA 5JEOA 1OOEA 3E58A 1XCLA 1YDWA 4IQ8A 4EQ6B 2WQ6A 2QSJA 1YAHA 4O1MA 1XPUA 1VL0A 1JIKA 2FN9A 2B25A 5HPYB 2EP5A 2PGLA 1JFTA 3CNHA 2F1IA 1YQ9A 2I91A 3FHCB 3IMFA 2IPMA 2X9NA 3HQ4O 4A8HA 3S1SA 3B48A 1GVNB 4X8LA 2P6PA 4M1MA 4W63A 3BWVA 3B7WA 3IGFA 1GRVA 2ERCA 4XI9A 1M8KA 1UEJA 2KS6A 3HBFA 2XB4A 3REFA 4N6NA 2FQWA 4EY6A 2BHNA 3WWPA 4F3NA 2GWRA 2GPJA 1R4ZA 3DMPA 3GF4A 4FE7A 2IV7A 1RYMA 3U17A 1R0ZA 3IVRA 4BDSA 2ZDQA 5I7RA 1OC2A 4FYJA 1B8PA 3CWCA 5T7BA 3ZG6A 2NTEA 1IUKA 4NONA 1XTIA 1QRDA 1PHPA 1TRHA 1XRLA 2CCKA 2HF2A 1JEEA 4MLZA 4QRDA 1JR3E 4R71A 3MXOA 1QOZA 2H29A 4HVLA 3PCTA 4DBLE 4EZBA 1DB3A 4AKGA 3E9CA 4O2LA 1JB1A 3N8DA 4TTPA 1RZRD 3HY3A 3ONVA 1NUHA 4D79A 3K5WA 2DTEA 1ADYA 3K0HA 3A9WA 1JFLA 4FOPA 4ZHQF 2ODEA 2ANCA 4DIDA 5EVJA 1AVTA 4ZCLA 1BMDA 1OHHA 2R60A 4LDRA 1ZNYA 1J8YF 4FC6A 4ZAXA 3N6RA 3UAZA 3T1QA 2UDPA 1VMAA 1CRPA 4EB6B 4P4TA 1E6CA 2X22A 2QYTA 3KNZA 1W88B 3CX4A 4KBYA 4C0XA 3MFYA 4S2UA 5DSTA 4EO7A 2Q45A 2QSYA 1EG7A 1F9AA 1GTZA 1NXOA 3I01A 1E1QA 2W4QA 3FPCA 3UG6A 3W3AD 4B3IA 4Y2UA 3G79A 4NMXB 4K0KB 3KKQA 5IKOA 4B3CA 2CT8A 1HBJA 2YH2A 4ZU3A 4CIYA 4KREA 4KRGA 4ZYZA 1XZNA 4G85A 4DJ5X 1XDSA 3CX3A 2CUNA 3WL3A 2RH4A 1YVRA 1FFEA 2P27A 4Q47A 4X95A 4OLJA 1TFUA 2QL9A 3G2IA 2WWYA 4ZO4A 1KS9A 1NF8A 1Z7YA 9LDBA 4II7A 4UJ3A 1EUQA 3HFJA 2HJ9A 2VDLB 4RZIA 1ZINA 3ND7A 1W4AA 3EZ9A 4QT0A 4ZT4A 4A5SA 2INGX 1GZ5A 1UJ4A 3M34A 2P9FA 4RIIA 2QKYA 3EXG2 4R1NA 5AKLA 3LP6A 4CF5A 3GRAA 1HM5A 3CE9A 1TPZA 2QY6A 4BBPA 1ZJZA 1FY2A 5IH3A 4YUVA 1CNEA 2FEKA 4RGVA 1V71A 2XUKA 3GAAA 3MJEA 4B3RB 3ZLVA 2XWQA 3AZOA 4GOXA 1MOPA 1CBUA 1N5DA 4RD0A 2QTZA 2A5LA 1ACJA 3UMBA 1BOOA 1EA5A 2VYFA 3UMRA 3T5GA 2PL3A 2H0QA 2XZDA 4L3WA 4LV5B 4Q01A 2ZAYA 1LPNA 4V02A 3KRTA 5CB4B 4Q34A 1J99A 2FWJA 1NVTA 1NVMB 3K32A 1U0EA 4CTOA 3LP5A 2ZVDA 1GG9A 3FZYA 4WKBA 1ECLA 2WKRA 4Z4CA 4OHZA 2V7QA 1SXJD 1VFNA 2I3AA 1R4NB 3GJZA 3LQKA 2ZRFA 3LZ6A 3WC4A 2DBYA 4LC9A 2YN4A 4V24A 4MRRA 4HQ0A 1PYOA 3NRCA 4L5JA 1VI6A 2DPMA 5JBQA 3G7NA 3AIOA 1C1XB 1B26A 3OMWA 3QE9Y 3L8MA 1C3JA 4XX0B 2VJNA 5EXTA 1D2RA 2CJXA 3VSDA 4NOMA 4EW6A 1RM5A 2ET6A 3PTLA 4H7DA 5HE9A 3UN1A 2IP2A 5KQMA 3NWJA 5ITZA 2BRFA 4AWAA 4AFNA 1QU5A 1QHXA 4LFBB 2FEPA 3IILA 2I65A 1GNQA 3EEYA 5ITZB 5JQGF 2BUAA 3J7TA 1RRPA 1GO2A 3KTFA 4KWCA 2XTAA 4JDUA 4AKEA 1FS5A 2VHZA 4BO8A 1I7DA 2WV7A 3QA3E 4W1RA 4YREA 1L4UA 4B6SA 4CG2A 2IQIA 3DE5X 4I1UA 4LJAA 3AUXA 3PUKA 4RULA 1DIRA 3DYBA 4M9UA 4TL7A 4AN0A 2IYEA 1NYQA 2D8AA 4FPXA 2YQ5A 1AHPA 1R4NA 1MJFA 1PZXA 5FWYB 5AKIA 3NVMB 2FDXA 3H9GA 4FEEA 4Q4DA 1LJLA 2EQ5A 3D3KA 3GX1A 4HX2A 4X24A 5FNZA 3P9CA 3WJAA 3VU9B 2C4TA 2GKGA 5IVIA 2AN9A 4LF9B 4K9KA 5PNTA 3RANA 2REXB 5IDQA 1CUIA 1QG4A 2GHQA 1CZNA 1G21B 3PNSA 4PX2A 3LHKA 2REQB 1FLDA 1RQ7A 1RKVA 3DHWC 3ET5A 1HE5A 1QO0D 2X77A 3KSUA 2V8OA 3FRJA 3Q1KA 4LNHA 1NBWB 4MS1A 2XE4A 4PO1A 3AJRA 3OHMA 4ND6A 4V1CI 4F1KA 2ZZKA 4PXYA 1I9GA 2G4LA 3RV4A 1Z08A 1RPJA 2BFEA 4YCBA 3WISA 4IDCA 3HVIA 4BZZA 1VMKA 5I7EA 3ERCA 1MG5A 3REQB 1X1EA 1VJTA 5F64A 4EDFA 1Y1QA 1E4OA 4RFSB 1D2HA 4FHDA 3T41A 2W00A 4BNXA 3JV7A 3EC7A 3H1BA 4R7ZA 1BYIA 4AKHA 4IJMA 3UQZA 7GPBA 1U8ZA 3H2YA 3QY0A 2ECPA 4NG5A 1HT0A 4PONA 1N9GA 4E7PA 1TEZA 4CVNA 2FPSA 2RBGA 3T9BA 1UDCA 2AEEA 1XDDA 1QKKA 1SAYA 1TCCA 4X6XA 1CZOA 4NCIA 4A92A 4GI7A 2OFFA 2ZRQA 1W88A 5JEEA 3PQDA 4GDFA 4JGBA 4Y2JA 2J0VA 4KQ9A 1NJ5A 3VUFA 3EBPA 4JI0B 2NMVA 4P83A 5TMBA 2Q7DA 5AI4A 3H3FA 3H9CA 1ZJ4A 2EF1A 5A5VA 2CV2A 2YN2A 4NPAA 2O2IA 5CGQB 1XEAA 5CFLA 3P0FA 1CW2B 3MZ0A 3A3PA 4UM9B 5T64A 5LIRA 5DNWA 2A4MA 4MEBA 4I6EA 2VBCA 3REQA 1OMOA 1QH1B 1KK1A 2UKDA 3IEXA 3V3TA 1VG1A 4AUEA 1NC3A 1V3TA 4OK6A 4F1JA 2HWWA 2LIVA 4K1XA 4OMCA 4AU1A 1RC0A 1JAIA 4EKYA 1T1RA 3VTFA 3V1LA 2QZSA 1DEOA 5HGJA 3CZQA 2CNKA 2LCIA 2OP1A 1IY1A 1KKUA 3HS3A 3ZHQA 4HLUC 1EVKA 5DT9A 2PJDA 3LRPA 3K70B 5JFGA 1KSHA 1U6IA 3AKDA 1Q7RA 2AMFA 5A6SA 2FR1A 3LGXA 1Z0ZA 2E4YA 1QWTA 3RU3A 2XZOA 3BPSA 4RK1A 4X6LA 4MVYA 1CS0A 4RPLA 2TMKA 3GJ7A 3A9SA 2F8SA 3L7BA 3ORSA 2DMRA 4CFSA 3M8KA 4AG5A 4JLMA 4WBNF 4YH1A 4D25A 1RXSA 3EQ6A 3ILXA 1DCTA 1PEAA 2HSJA 3OC6A 1H4QA 1ODIA 4GNRA 5AD1A 4KC0A 1C8VB 1NJ2A 3G68A 4B6EA 4CM3A 1XAJA 3PVSA 4JSRA 4TVOA 1KO5A 5FTLA 2CDBA 4RLHA 3F97A 1QF7A 5IBPA 4LHSA 3WMFA 1ECJA 1J25A 1EEHA 1I4EB 3F3MA 4U2GA 4LECA 4PNPA 5CT4A 4R2JA 1AO0A 1L5YA 2XODA 1D2CA 1JR6A 2CYCA 2FF5A 3HVJA 3O74A 4HH3C 3FUWA 3V33A 4CKZA 4BTVA 1TVKB 1Q11A 3JVEA 3S2ZA 5C53B 1QP0A 1OH7A 2V1UA 5DASA 2I2CA 1RP7A 3SFZA 1HTBA 4PRLA 2WQZA 1KI7A 4A0EA 3EYAA 2OL4A 3TR0A 4F2WA 3B6JA 1AX9A 3WVNA 5DKFA 5EKTA 3I6ZA 4RTLA 4HUQB 1QYIA 2D0IA 2KQUA 2I1WA 1AXRA 5KIAA 5JJ5A 4U7DA 4O0MA 4WXMA 1D4OA 1K1EA 1L3IA 3KJZA 1DT3A 2PYIA 1JILA 3F5SA 3MUEA 4FKBA 5KDDA 3K1YA 5ITVA 1G5FA 2N47A 4FW9A 4LZJA 5EA2A 2P5TB 5BO5A 5TMEA 2WM2A 3CJTA 4D4JA 1LZKA 3PDUA 4FFPA 4N4AA 3DMDA 5KKAA 1E2EA 1GADO 2FHPA 3V97A 3WAKA 2ZR8A 4C4OA 4CBVA 1KKLA 4UBOA 4Y9TA 3QFCA 1KAMA 4P5DA 1G6OA 4OQDA 5CIYA 4KDRA 3FSGD 3STYA 4CM1A 1K3UB 1RHUA 5JXGA 4BDTA 3KT0A 1NOKA 3UJ8A 3DTVD 4CQMB 4EJSC 2E4UA 4C89A 3Q3VA 2UZ1A 4LOJA 3UQYS 1FP1D 1VYHA 1ZD4A 2VQ6A 2XTJA 5CW1A 3KOYA 3TGWA 4F9FA 4I55F 3R5HA 4S24A 4AJPA 4F56A 1VJDA 1W1WA 1KHUA 8ADHA 3E81A 2Z2JA 3H2GA 3UJHA 2O8CB 3RU7A 1B0AA 1CEQA 3WXBA 5AIAA 2NO4A 1E2KA 4DW8A 4LFCB 4BX0A 4ZK2A 2P9HA 2EKQA 1VKJA 4NDAA 3KVVA 2DPGA 1PDOA 1KFBB 4NFHA 3BA6A 5AOAA 2HIGA 1XKXA 2UXDB 1F4LA 2O06A 5DI3A 4UCXA 4F60A 3T94A 5JE8A 3GK3A 3RUFA 3MG9A 5F98A 4WW0A 4K6MA 1JHAA 5CT9A 1EJ6A 2ZB8A 4MICA 5TGTA 3VGJA 1RM4A 2Q9CA 1POXA 2V54A 2C7VA 1LDBA 1CQIB 2C4HA 2VHUA 4GLBA 4R41A 5DM4A 2QN2A 3C3KA 1R4MB 2YWCA 4YWHA 3ZV4A 4DF3A 1UMCB 4QDTA 2N1BA 1MC8A 5AHOA 1OCEA 1HDYA 4CGZA 1XUOA 3HM2A 4I7EA 3WGLA 4ZGBA 2ZJ7A 1WD5A 1XL0A 2ZRKA 4LDNA 1UJXA 2WAYA 2WF9A 5I4IA 2G7MC 1N2JA 1ZOPA 4WPGA 1PGOA 3AV0B 3SCZA 1TLFA 4NVRA 5HXAA 1C1YA 2ZRAA 3KQTA 4FMCF 5F4BA 3EWSA 5GVRA 5JNTA 421PA 2PFSA 4O02B 4PPNA 2VHQA 2YJGA 4JLPA 1Y3AA 3LUHA 1UMDB 1H94A 1TK9A 1GRCA 3AU9A 4PVCA 4RHUA 2JKDA 5TQ0A 3ZWVA 4B2LA 4JT2A 4KWTA 1K8ZB 3A6KA 1J9GA 4ENUA 5FUYA 3NHMA 3OZIA 1XCGB 3URKA 3WLPA 2GFQA 3ZEAA 4ZCTA 2GRJA 3Q6NA 2AXEA 1TTQB 4NFLA 1TF2A 4B45A 4CMEA 2II6A 2XUDA 5JC8A 2I71A 2M1ZA 1G66A 1V47A 4W99A 3KSAC 1GRNA 4RIGA 4OLBA 5EEHA 4HWSA 2OQ2A 4PLZA 2JLWA 3I6BA 5IDVA 4DUZB 1PD0A 1C81A 5LB4A 4AJJA 2XHEA 3IP6A 4BQPA 5JAIA 5JSQA 3VHRA 4Y1RB 1Y8AA 3M82A 1GZ3A 3C7CB 1EJ0A 1KQOA 4RY2A 1TZ2A 1Y89A 2HNAA 1ENZA 4DJDC 1STOA 4AROA 4Z0PA 2FZWA 4N3CA 3IYLW 4G23A 2VP4A 3PFGA 3T95A 2XMZA 3ICEA 1ZOSA 3QHPA 2R4QA 4OHFA 2XVMA 3R9KA 3C5CA 1UPFA 4KO2S 1XWIA 2PGDA 3OF5A 5F2EA 5HQ3B 2D1FA 5LJLA 1XLVA 4YP1A 4ZVNA 4MULA 1SUWA 1MRSA 4KW7A 2WD7A 2WV9A 4W8OA 3OQIB 4LQLA 4GX2A 2B8WA 1KEKA 3HEBA 4E21A 5EZSA 4KWHA 4CEIA 1MA3A 3MK31 3WWCA 1TQDA 5FPQA 5DBIA 5U4QA 3KAKA 5KYVA 3GWZA 3RFFA 4ZYXA 1VE7A 4BCDA 3K2BA 1D2NA 3EPHA 4TUYF 2E4ZA 1C30A 5GIPE 2YHAA 3FCOA 4XDHA 4EK9A 1TVCA 1WUKS 1OWNA 4TV8B 1GPWB 4NRDA 1H8HD 5IJWA 3I4CA 4GS5A 2BKAA 1L8OA 2GASA 3ON5A 2ZRIA 3HJFA 2HJVA 1MPTA 5E0OA 4HSGA 2H7YA 3IURA 2W93A 3AFHA 3QPDA 1B8VA 1PR4A 1FZTA 1TX4B 4ZT7A 4XVCA 4KNWA 2IHKA 4MRSA 1NLFA 2WE7A 3G0BA 5EJ6A 2V3CC 3DLCA 4EAQA 4YR7A 1Q1EA 3QX3A 1NXPA 2FVXA 5AI0A 5BSUA 1LF5A 2D0DA 1ZUHA 1G3UA 1NFFA 3IP3A 4BLWA 4Z1MD 4UUBA 1XU9A 4KDFA 2CXPA 5CXQA 2QXTA 1Y3FE 3CRRA 2HPZA 1DHRA 3TOCA 2Y2UA 3VPBA 1P2BA 5M3BA 2IU4A 3DBVO 4UPEA 3IHKA 1LA2A 3EY4A 2XB2A 5FWDA 4CMEC 3HXMA 1WPGA 2G8LA 3CVJA 3IMCA 4PYRA 4RIHA 3FPJA 1NN1A 2PD6A 1NW6A 1O3YA 1USUA 3QMPA 2I4RA 4JEIA 2AWOA 2B5WA 3JARB 1Y4ZA 3RD5A 4ASUA 4FFLA 3F73A 1A2OA 2C2YA 1D9ZA 3BHJA 1UL1X 2EX4A 2OXCA 4CKBA 5DVZA 4IJQA 1FYVA 4M87A 3VR3A 2C1EA 5IT4A 4NNOA 4NTZA 1M2FA 4RXMA 2B8EA 2Y0DA 5EQTA 5NULA 4CT4B 2K6GA 3F8SA 4TMTA 2GZDA 2QVBA 4Q4JB 1QXSA 2WFAA 4FX2A 2QRUA 4F3RA 3SDBA 4GR9A 1SZPA 1NRJB 3E84A 2J7PD 3KUKA 5C5CA 3AI7A 3BM5A 4GSKA 1VJ0A 2C2GA 5AXCA 3IPCA 3K9BA 1IWBB 2IDJA 3H75A 3TB4A 2RH9B 5KHLB 3Q8KA 1WQ3A 4R9UC 1FBNA 4BUJA 3M3PA 4MVJA 1JDTA 1EZ1A 3GGGA 4MDYA 3W5SA 5HM8A 1E7WA 5IKXA 3P9IA 1CJKC 5D5QA 4HQLA 1EDDA 3NXSA 1QK3A 4BGEA 4ZYUA 3N2KB 2W6JD 3RSHA 1SXHA 3PSAA 3B1ZA 1PJLA 4HEA6 2Q6VA 4PZDA 5M2QA 1K7FB 1VSTA 5BSRA 1EX6A 4Q3OA 4L28A 3JAWA 3HVHA 4XFKA 2WB4A 4YAIA 5CD1A 5DBEX 2KWIA 2PX0A 5EYPA 3PU6A 2M98A 5IRCD 1P4SA 3H04A 5KHAA 4WY5A 2XF2A 1VXRA 2HYIC 3L93A 1OKKD 1J24A 4EQZA 4G6ZA 4N39A 1B73A 2ZT5A 4Z3OA 1NKSA 5MFPA 4FKMA 4D9NA 1J5PA 5REQA 3GY0A 2PH1A 5K05A 3LDFA 1QLHA 2IX9A 1UKVY 4UZSA 1D4AA 4M7PA 1LPSA 3DEYX 1GL7A 2R44A 4ANFA 1E3MA 1ULTA 5DE3A 3WOHA 3ZBPA 4QXOA 5BYKA 5IEBA 4WKNA 1VP9A 3PQ2A 1ULHA 3RTAA 5I9IA 3CUKA 1ZUNA 3PUJA 4S0ZA 1SC4A 1ETUA 3QYFA 1AHNA 3QPVA 1K8XB 1W19A 1WLYA 1M10A 2VPZA 4YLGA 1D6JA 4CMAA 3FCUB 3WYBA 2P0AA 3LS2A 5IUKC 5J4LA 1LX7A 1LB1B 2C99A 2ZBEA 4YASA 1AKEA 3ZHSA 1MVOA 4OHVA 3VHXA 3B2EA 4WFIA 3IQZA 1ZR2A 4MB6A 1K92A 4LNAA 1I3KA 2NQ2C 2H48A 2HO5A 3DKVA 3H7AA 3NEAA 3OM9A 1NHWA 3OUUA 4HNAB 3HO6A 5B3AA 3S2SA 4HNVA 2YCBA 3JYHA 3UIEA 1N6OA 4AN1A 2GCOA 3BRQA 2WINI 5AKGA 5FL7A 3HDGA 4QXPA 3RRFA 3VMFA 4IKPA 3QLVC 2XCRB 3PF8A 1WXIA 1ZOIA 3LC7O 2ISSD 3Q2OA 3VAZA 3Q8LA 1A4IA 2QSUA 3DZKA 4GZMA 4WBSA 1G5RA 3GFTA 1N92A 2D5IA 1DOZA 1JSZA 3U39A 3F5DA 4AZ3B 4E6PA 2C95A 4ZI7F 3CNEA 2XCUA 1T4BA 4QRIA 4D8TA 2RKOA 1OE0A 5AQEA 1WF6A 1IVNA 2YWDA 1KI2A 3D8NA 1Z37A 4J3NA 1WD7A 5E6SB 2UYQA 4LRTB 4TXNA 1QM5A 1IHPA 2ATVA 3DPSA 1L4LA 2FETA 2BFDB 2HA7A 3SLGA 3QU2A 1LRKA 3EG5A 4BYGA 3QSYA 3BD9A 3ETCA 1OXVA 1QGUB 1OWLA 4TKVB 1RHKA 4BX8A 3FVRA 1M2GA 1FQJA 2B6HA 2JIOA 4KGDA 3U7QB 4L3OA 2R8PA 2MU1A 1VFPA 4NBVA 5FUVA 5IT5A 2YZ7A 1PUXA 3OTQA 5KX5B 1UDBA 5FLYA 2QL7A 2OGZA 5BXYA 4F2DA 3UXHA 1IHXA 3OEEA 4GKJB 4BUCA 1RWPA 4O6VA 3H1EA 4GICA 1JEQB 1RFLA 2SCUA 1BFUA 1OC4A 4JUCA 1FYXA 1GA1A 3BFVA 4QPZA 2UYOA 1Q0SA 3VO9A 4MI1A 1JEAA 2BR4A 2GILA 5LQDA 2OT3B 3SX0A 1YZYA 4HZUA 5H1YA 2ZWPA 4Y6QA 4CR8A 3WK8A 3V8NA 4BN4A 3DSHA 2EQBA 3HEAA 3NM5A 1AKWA 1K8QA 1QAMA 3WMGA 5KYYB 1H3EA 5BV2P 3BDAA 4G67A 3P2EA 1KMIY 4DRXB 5K6RA 4ILKA 2HU2A 4O4HF 2HWKA 2PRSA 4HAOA 4BQSA 3R1IA 1D7AA 5AVSA 5IEJA 3SVTA 3JRNA 1JDZA 1P0CA 1VBNA 1DKPA 3PHGA 4YCAA 3R5XA 5F9FA 2Y1KA 1V3UA 1CR0A 2QPOA 1BWRA 3BX1A 4PRZA 2FN3A 5CDFA 1ORVA 1XALA 2ZBRA 3DEIA 2V3VA 4DSUA 4XGRA 4W9RA 1NMZA 1P2VA 1BE0A 3BD6A 4MWTA 4NH0A 3VR2A 4AY4A 2H0AA 3GJSA 2ZQYA 5ALUA 5K3CA 3OZSA 1WW8A 2I33A 5KQPA 3KLBA 1GDTA 1SXJA 4NBSA 1Z6TA 5JH7A 4PR0A 3KKEA 1TU3A 1GUDA 4RF3A 1P6QA 2GYVA 3DP9A 5CYOA 3AC0A 2NN3C 3FUCA 3HJNA 3QLVA 2YXPX 1NVUQ 1TU4A 1Z39A 2OZPA 3PX2A 1SA0B 3ZZTA 3AB8A 5DSXA 5A71A 2OO5A 2YYYA 3F47A 3MRSA 2O6LA 2DFVA 1P5JA 5CRIA 5E8RA 4QOIA 4I50F 3ZCRA 1RJWA 2YMQA 3I64A 4C21A 2JHGA 3JZAA 2QRPA 1Y3DE 2QV0A 5A1TA 4N0EA 2C5AA 3RYIB 3VBCA 5CB8A 1I1NA 4MI3A 3E7WA 1NVBA 1OBHA 3ZVMA 2G06A 1G2OA 3A2MA 3GN2A 4PLFA 1JIIA 4OQPA 5H80A 3VYWA 1G4AE 5B3JC 5CA1F 4OX9B 2B1QA 5FFFA 2RK6A 5AVJA 3M4XA 1SXGA 3NHZA 2Z8ZA 4KU4A 1WQ4A 4ZCMA 3E27A 5H3HA 2FX3A 5IDXA 4PHHA 1Z12A 4M1YA 2WSSD 4BWFB 2XXSA 3A6EA 3WYFA 2UUPA 3OT4A 4XUEA 5L95A 3GFSA 4ZREA 4G5SA 5FTWA 3T61A 1EXVA 1QRUA 1RQGA 3BAFA 4G5FA 5I4BA 3X2EA 3L8CA 2KX7A 2QUIA 1GSAA 5ILOA 1HTTA 2EFCB 2XTNA 2HHCA 3ONEA 4FGUA 2NXEA 3PKZA 5EJ7A 4MRVA 3RCBA 3F6PA 4INPA 1VL2A 2QX4A 4AJEA 3GDOA 5LL6P 4YYEA 4RU1A 3ZXUB 1E1RA 4CQNA 2HN9A 1YBMA 1YBVA 3KAQA 4NCKA 3S99A 1MKYA 4DA4A 3K53A 1I7NA 3KKKA 2XEXA 4HFNA 2R7MA 3D7RA 4J0DA 2NVOA 4A2WA 4C22A 4MVJH 2CBZA 1WMDA 1Y6QA 5JYBA 4JI5B 3FTEA 1Z15A 3OQMA 3GGPA 4YJGA 1Q74A 3CCCA 3O8DA 4Q7LA 3I1JA 2G6BA 1U0OC 3NMUF 5AUQA 1UK6A 3RVJA 1EM8A 2I2WA 3CKYA 1MB9A 1QH8A 3D4BA 4NECA 4FZ5A 2JVKA 3U4HA 3F7OA 4CI9A 1RYBA 5CX1A 5EUQB 3PGXA 1A71A 4ZQGA 1CRQA 5DIZA 4EG4A 2VJLA 2VDOB 4J16C 3MJFA 1GDHA 1J8MF 1NMQA 2I6GA 4PZAA 1T1GA 3ZQJA 3WRXC 3DBOB 3ESXA 3GFGA 4LZOA 4EJ0A 2VZLA 4E03A 4DDVA 3IP7A 3K1AA 3Q8WA 4YT4A 3B9QA 5GV7A 4YUXA 5G3YA 3FTCA 5BNWA 2B4AA 1XPOA 4NPCA 2FSHA 4LYDA 1Y5MA 3OLYA 4KPFC 2V6IA 3WIDA 2OG1A 2E89A 2OO5C 4N9WA 4C4YA 1JDNA 4RQUA 4WN9B 4E33A 3B51X 3IPLA 4UAUA 1ZI8A 2GCNA 3NC1C 3N2LA 3EW9A 2BCEA 2GCEA 3K0AA 4J9VA 3KJXA 4TLDA 4AZ0A 4GDMA 3JWEA 2GX6A 4I4TF 1PJSA 5JEDA 5KOJA 2YNMD 3MIZA 4QOGA 3BL8A 1M6VB 1MAUA 3QVUA 4BOYA 1YB1A 2P0EA 4L5BA 4XYEA 1BDIA 4DR4B 3O3OB 2KFUA 4QPPA 5JG7A 1ZH8A 3ZCQA 3BGVA 5JSZB 3KJEA 1SG6A 2C1ZA 2YRWA 1LSSA 3CO0S 5FWNA 4BIMA 2BWJA 2YW2A 2Z9DA 3GLTA 3OESA 3BH0A 4JJZA 4E7OA 3GNSA 5SZHB 3ESBA 2O3RA 2V7TA 1H0RA 2CFIA 3LZCA 4LWPA 4ZI5A 3UA3A 2GUGA 3EFOA 3JYOA 3MBOA 5BVHA 2VQEB 5E1BA 1MDBA 2QMEA 4ZJZA 4OH7A 2F90A 4B79A 3CTMA 2C4VA 2XGMA 4DQUA 5L9AA 5FJJA 4LHYA 3KBBA 4O2BA 2HQOA 1T8RA 4YMUA 1V2GA 4OXIA 3OM8A 4ABYA 1KO7A 2BKLA 3IUBA 2UYYA 4HTAA 4JLVA 4U2FA 4JI4B 4OLAA 2WIKA 3AINA 5GM2A 2XNJA 4KVAA 2BRUA 3AK4A 2R66A 3EJWA 3I8SA 3W79A 3WYAA 1P17A 1QE0A 4C0SA 4BE7B 4DUGA 3TKYA 1E6WA 1HK7A 3ITNA 1QPGA 4LYJA 1FDOA 2FMFA 4PEVA 1FYWA 3DZCA 3JZDA 1AUXA 3RS4A 4KAFA 3IAHA 3Q7SA 3RAJA 5E6RA 3NZEA 2O8NA 3UWDA 3EUEA 4D8WA 4UUNA 4Q1EA 1FPQA 1J7KA 1H2XA 4HC4A 2GVZC 2JB9A 4X1OA 1BDBA 1L4HA 2Z4SA 1GPNA 5DLEA 1SBHA 2ZS8A 3BAZA 3K72B 2LRHA 2D5CA 1YDMA 5A0TA 1ZZEA 3DHVA 3NM6B 4GPZA 3SHQA 5LN1A 3JQ7A 1A0OA 1RLOA 1Q7CA 3M33A 4GOKA 4IMJB 4RA6A 4CFZA 5JY6A 1KAGA 2QL6A 2W22A 2WWHA 3DYVA 1XZBA 1E7SA 1ADCA 1VHQA 5EWMB 1XKTA 4KP7A 1ZLXA 4F8EA 2PRKA 5J2TF 3THWB 3EHEA 1C7JA 5BWBA 3RADC 2WEKA 3WYCA 4E5YA 4X97A 5FOWA 1YZ3A 1WA5A 2Q5QA 4M0UA 4RCZA 1SQSA 1RC8A 2L82A 4IRUB 1HZZC 4RZSA 4DREA 3SC2B 1JDJA 2PL5A 2Y3IA 5LM3A 5LXTF 4OMFG 3I8OA 2W71A 3IT3A 1DG3A 3OA2A 1DEVA 3ETDA 1H6AA 1K4MA 2Q07A 3CO5A 3HHPA 3LBAA 1VJ1A 3OM0A 3LYLA 3SOZA 3VNQA 4X00A 1NP7A 2ZRDA 1KTIA 1EFPB 1VKZA 3AF3A 3H0CA 3SZRA 3TIGA 3PDHA 2XITA 1IY9A 1DQNA 3QKTA 5GZ3A 4RHCA 1XN1A 2PZBA 3OBBA 3IMEA 4AMGA 2O5CA 2CNWA 4H7EA 3R7LA 2FZCA 3TEFA 3VXKA 5KU7A 1DRVA 4Y0NA 1QTQA 5LDHA 1JHUA 4Q37A 4AUNA 3QW2A 2C4UA 2QVZX 3CVWA 3VKGA 3GMJA 3RE1A 3L7KA 3IOBA 2H1IA 4M4SA 3ISJA 1PK8A 2MSDB 3UEOA 3ESZA 2QTTA 1N5OX 3TSYA 2BDUA 2RGRA 1Y3CE 4P38A 4EW2A 1MC1A 3D4OA 3N0WA 1XAGA 5A3VA 2IELA 5JS7A 3GJ5A 3KXIA 2P3SA 3O4HA 4HNAA 2DB3A 3A2KA 2C7QA 3UK2A 1BO6A 3CG4A 4OTZA 2DJ5A 1JMYA 1V2HE 3INTA 1H66A 5IZCA 3PWZA 2IRWA 1MEJA 4BMXA 4DMLA 5BN5B 4MVJD 4CCYB 1KERA 3HUTA 1FOEB 1V8BA 3CWZA 1RSZA 3H83A 3OPXA 3ONFA 4NZMA 3ZJ4A 5K45A 1W1IA 1Z06A 3JQ6A 5F2NA 2ZSEA 1P4JA 3G89A 3HLYA 4V0NA 1QORA 1NPTO 3EC1A 3I9LA 3MOIA 2P9YA 2ZREA 2PX4A 5JD4A 2GEJA 1VHJA 3E82A 1OFGA 1MJGA 2PLNA 3C8UA 5AKEA 1K0FA 4X1IB 4DXDA 1YB5A 3DEAA 3UHJA 3HGQA 5E9QA 3ZGXA 3UCEA 2ROQA 4KSCA 2F1KA 4TSFA 1L1EA 4KU0D 2D1RA 2JGLA 1R5JA 2REOA 3IDZA 3IQIX 4EFDA 3VR3D 3WKDA 5K0FA 2NO9A 2I1VB 1OLSB 3W8FA 5A6VA 4PFSA 3OKCA 1TECE 4P8RA 4G1FA 3CE6A 2AI1A 1FP4B 2IODA 1PG5A 4GZLA 4LVCA 5E7JA 4B3BA 2XRYA 2HHHB 2PJRA 3A6PC 3SMVA 2BM9A 4CN8A 4QFDA 5BURA 2VUSA 1YCFA 2HZ7A 4J2HA 4RTSA 4B7XA 2C2WA 3FPEA 3OE7A 4G0YA 1KAQA 2A1TR 2GBLA 2H63A 1KIAA 1MO5A 2ZS9A 3D6JA 3DMYA 1PWZA 3FXAA 1VCMA 3DZGA 3N8KA 2CB0A 2P62A 3QKWA 1SR8A 4N3AA 4EPXA 1LWOA 2QRKA 3L06A 4PE5B 3S2UA 4F21A 1N5LA 2C5HA 3DT8A 2ZTUA 1KE1A 3P9YA 1OX6A 4JD5A 3A9TA 3MYRA 3RYFB 3H18A 4MQEA 2HR1A 3RASA 1FVFA 4XJVA 4X94A 1MABA 3DV0A 3KU4A 3RPEA 4G1CA 4FQ8A 1P7CA 1ULSA 1K89A 1ZXBA 4D41A 3P27A 2YWJA 1EFUA 1QE5A 3HWRA 3O4FA 4OREX 5FNVB 3KEMA 3TLKA 1L4EA 4BV8A 2J0SA 3WTBA 3I61A 5F3DA 1KGSA 1UANA 3J80A 1JPJA 2CMGA 1K7CA 1MVNA 2O0LA 2WJVA 4BJ5A 1PR9A 4NEGA 2BEVA 3SQXA 3E8XA 3IE1A 1HE4A 3RIYA 2X0RA 3LSTA 2L42A 1DC7A 5A4DA 1F51E 9MHTA 1T1IA 1ULAA 2P9TA 4R3NA 5H81A 3WLNA 4BQQA 4YRSA 5C7YA 1CUFA 3AEZA 3T8YA 5MDHA 1FTYA 2FGKA 3DPUA 4NHOA 3N7TA 4CL8A 2HGZA 4FINA 3UATA 5JYEA 4DKJA 4NAVA 4LAFA 5B53A 2C5BA 5B5SA 4BO6A 1U1EA 3I62A 4IINA 1U7XA 4FX5A 1P74A 1IBRA 2HJRA 2FB9A 1DHTA 1P2UA 1W5BA 4BBAA 5AM4A 3WDMA 4DLAA 1XMQB 2JQJA 1I2DA 3OAAA 3CJRA 1HO3A 5L8VA 4LXIA 3C3AA 4EHHA 2Q0HA 3QVJA 3EVCA 1ZJYA 2IZ1A 3GDFA 3HDJA 4FGZA 3KPJA 3N2EA 2B9EA 5JWRA 4MR7A 4XXHA 1UPUA 1RIFA 3VDQA 1AF7A 3FPAA 3AFIA 3NWOA 1O8CA 2OD7A 3F3SA 3TIIA 1PSDA 4EI2A 2VBGA 3AR9A 3FCSB 4IFIA 1JGTA 4I1RA 1C0IA 4AJ1A 3VPFA 3SSMA 2J0QA 2AN4A 4JLAA 1ABBA 3O8NA 3F7TA 1FNBA 2DH6A 3G13A 1E5DA 2HJSA 3UJCA 4EGQA 5JNRA 1T3GA 4U02A 4FCWA 4WCVA 3WLIA 1OR8A 1KTVA 3QVLA 3D4NA 3HTXA 1BGXT 3LCCA 4D56A 4CL3A 1UMKA 4WUTA 3M4NA 3WY9A 5TQ2B 2B4YA 3F9RA 2ZWVA 3WLFA 1QRTA 1WXXA 2GEUA 2O8BA 1IWOA 2ZVQX 3DR5A 1R74A 3X1MA 5CDGA 4CF4A 2YHIB 2B2XA 2MYUA 5ARCA 4F2PA 3DO5A 4O4JB 4ETMA 1TMGE 3JWHA 1CEYA 4Q4AA 1GL6A 4GOLD 4DWVA 3TLAA 4RLQA 5JBIA 5KINB 2F8MA 4Q3NA 3B6IA 5H02A 3S5JA 3GG9A 1H22A 3HJGA 1GU7A 2R1TA 2ZJ2A 1KFCB 3MWJA 1JFVA 3KJFA 3RYCA 1SHUX 4IV5A 2O5EA 3U3RA 3VH2A 1O6GA 2XKKA 2H06A 3O90A 3PUVA 4LDZA 1LSUA 5CJJA 4BNIA 4FYHA 4CM8B 2XOKA 3GFVA 2C97A 1BGWA 3CVOA 1D2MA 3I0ZA 5FDFA 4NMWA 1Q0UA 1QAQA 2YC4C 1V0JA 3FCCA 3I30X 2YHIA 2WC1A 3BTVA 3U3OA 1VOTA 2GRUA 3TZKA 3AVUA 1E3TA 3C6KA 3ZBQA 2CXTA 3RV3A 1UJMA 2CJWB 3I2GA 3VR6D 4D45A 3FY4A 3QVTA 1M6EX 3R0VA 4EA9A 4FN4A 4CDRA 4HDCA 1SXQA 3NASA 2LGJA 3C3BA 4XPZA 2H2DA 5EQDA 4ROTA 1F2VA 4D81A 1ONNA 4CCYA 1A5ZA 3UO8B 2JNWA 2HDNB 2P79A 4D3DA 3MB5A 4IZHA 1LDGA 2HJWA 4DIBA 1UK7A 3GFPA 4UTZA 1XTUA 4LJ6A 3VTKA 4E88A 2FW6A 4JL6A 4YMLA 2FKNA 1GZSA 1T0UA 1X8JA 4AMBA 2EJVA 1DAHA 2HQ1A 3O1HB 4MIKA 4MVCA 1EGVB 5CUQA 3TW8A 1YF3A 3CS3A 2UUBB 1C14A 1WWKA 3A4VA 3M4ZA 3OCVA 3WLRA 3PNBA 1D1QA 4V2IA 1XLUA 4YVFA 4YN3A 3WI7A 2DQKA 4U2CA 3G5AA 4D0GA 4LOIA 1RDFA 1T43A 1UOEA 4TYWA 2ETXA 2ZRLA 3KKPA 3PT9A 1EXDA 2X2OA 2I67A 4BTLA 4BVKA 1MW8X 4H0FA 3IAFA 1PQWA 2NUPA 1K08A 4OFBA 2FPKA 4YRCA 1QYWA 3GVXA 5D84A 5JDCA 1G9TA 4RJTA 4FYXA 2WJGA 1LPMA 2R7KA 3I2FA 1Z4NA 2FPGA 3FX2A 2FX5A 4LZWA 4P86A 1NVVQ 5UKDA 3TRDA 5MGBA 1CJUC 3LXXA 3GAZA 5E3HA 4NH4A 2HUNA 1UK9A 3N2GA 1P9NA 4MQ4A 1VI2A 3CR8A 2AGVA 5JASA 4MUBA 3J81k 1QRSA 1T0JB 3BMOB 3HKBA 4ZCPA 4X45A 1PGPA 5D3MB 2JCGA 1NLUA 4TLBA 1C7QA 3EQ7A 4AXBA 4DAOA 1A2QA 5ICEA 2IDZA 4TSRA 2B1GA 3EIEA 4PZPA 3L4JA 1TQ2A 3FGNA 3RNLA 3QLJA 2I29A 3Q3CA 3BZUA 3DM9B 1ST3A 4B4WA 1TIPA 1KZGB 3UTDA 2Q1YA 1NF9A 3R41A 5ALHA 1T36A 1OAOA 5ERXA 1T2CA 2JAHA 5BQOA 2AJBA 3PUXA 1SVKA 2CMFA 5C8YB 4YPFA 1JR3A 1FC0A 1YCHA 3OJCA 3GN1A 4EJSA 3MAAC 2M9MA 1O1YA 5BNZA 5A6SB 3WYEA 1DOHA 1BJTA 1KYZA 1VB3A 2HRRA 5FLKA 2X9LA 1GQYA 4KACA 4E6EA 1QCCA 4II2A 4BV3A 2YOGA 1VHLA 1Q77A 2QTFA 4P08A 4PAOA 4CHGA 1YR9A 4LRUA 2P2NA 3NYRA 4XB1A 4H60A 5B7GA 3LI2A 4MQUA 4JY7A 1XVVA 2IY8A 3PEUA 4U6QA 1N5MA 1DWQA 3TL2A 2SKEA 4TUYA 3IUPA 4F11A 1XNJA 5KZMB 1RZVA 2JI6A 3DZ8A 2G1KA 1CJBA 1AQUA 4FHFA 1SQ6A 2Q5OA 1JHXA 1MR3F 2Z8YM 2QPTA 4YMIA 3LD9A 3ZIUA 1XG5A 5CT8A 4B3MB 4ARBA 3GRCA 2PK3A 5CM2Z 3NDRA 2FUKA 1UKYA 3QGMA 3A1DA 2R8YA 4Z2YA 1H5NA 4X93A 3DULA 1C9DB 3E35A 4QTUB 3E0XA 2HK8A 2QP9X 4RDHA 4ZTBA 3ICCA 1CLEA 1D1PA 2YWRA 5TGZA 4ZVQA 4ABTA 1RPAA 4RH1A 3TZBA 4CM5A 4TS3A 4FJ2A 2JRLA 3OCYA 4XPIA 2BFBB 6ABPA 1QHFA 1RKUA 4N8DA 3CEHA 4MUEA 4PO8A 4ZI2A 1T15A 2I4MA 3FNHA 2HO4A 2RGBA 2GNPA 2FDCA 4L27A 2GXAA 1BWQA 2FDRA 4BV2A 2CZCA 2P2LA 4OQNA 2W6CX 4Q00A 2VDVE 4RIEA 3L4SO 1GLNA 1LQ2A 4PX3A 5DT2A 2UZAA 4JC0A 4ZT5A 2RC5A 2ZTSA 3QE0A 3ZK8A 3RTCA 3FDFA 2DXIA 1KYYA 2XPCA 2B92A 4G9GA 2VVTA 3H5IA 1UBUS 4HY3A 1SVUA 3T54A 1II8B 1E1RD 5ITWA 1NQVA 4M49A 5AXDA 1HMYA 1IE3A 4JVMA 3A7EA 5LA6A 2PSSA 5HHTA 4UXJA 1DSSG 3HB5X 3TLGA 3WBKA 2ZJ0A 1JW9B 4KV7A 4C87A 4ZYTA 1KK0A 1NMYA 4E5UA 4L8VA 4F5DA 5K0JA 2VRCA 4LI3X 3V5NA 2XD9A 2ZSBA 4N40A 1DXOA 2VHVA 4BJ6A 3M3HA 3T99A 4IJWA 4DMGA 4JVLA 4GYWA 1QRAA 3RUHA 3PGJA 3A70A 3GLFA 1MJSA 4RE5A 1N7HA 4TTAA 3EA0A 3W05A 4TWIA 4D99A 4AKIA 3BXFA 2JARA 4RK7A 1JDVA 4JB0A 2YMPA 1V4BA 1IMJA 3KT3A 4NOKA 2Q2OA 1G8FA 1GNTA 1OXMA 3A31A 5AMXA 5FPHA 3ZQ4A 4FWTA 1CEEA 3DEJA 4DCJA 1QVZA 4J7UA 2VP2A 3L9WA 1VL1A 5KUTA 2P67A 1Q7GA 1WZEA 1JNYA 1T5IA 2X1LA 1N5KA 1T1JA 1VGRA 2X9QA 4TKMA 2YYAA 3Q2KA 3B36A 4YO8A 1AS0A 1UBNA 1IXRC 2CZQA 3EPKA 5DI9A 1VJRA 4Q9IA 1NF3A 2WKPA 1Y1KE 1JAHA 1ZNWA 3H6HA 4OI2A 1CY4A 5ICFA 3OJOA 1KP2A 2GO7A 1D03A 2VN8A 3RSCA 2W3OA 4DWWA 4YRGA 5CFOA 5K20A 4JIWD 3I6YA 4FEGA 4ZVTA 1NXTA 1TU0A 2ZJAA 2I22A 1PT8A 4D02A 2XZTA 5A4JA 1YR3A 2W2KA 3MFQA 3TZCA 2QTGA 1XHLA 5IABA 4IHJF 1ODCA 4JQYA 1I4TD 4U8HA 1TJ5A 4XJXA 1XOIA 4U0KA 4K0RA 3NUQA 4GKVA 5GONB 2ONCA 1PV1A 4XDYA 3ESRA 1NBOA 3HA7A 2AZMA 3C3EA 4DJJA 3RHSA 3KJHA 2Z6VA 3QQ5A 1Q0ZA 3LIPA 1EVJA 5B30A 3LQFA 1RYZA 2RJOA 4YV7A 1BN6A 3KSZO 3I9MA 4URWR 3HZHA 1Z5WA 3HN7A 2F8LA 2FAXA 5IAEA 2BELA 3TRKA 4KNYA 4FKZA 4J07A 1DUVG 1VLMA 3ICQB 4BP1A 4CKYA 3FDJA 3K0CC 1Y5NA 3AJ8A 4ARSA 4ESHA 1USKA 4CN9A 3PKIA 4E70A 1ORWA 1L5SA 2NWQA 3T5PA 4LTNA 5AKKA 2GJ8A 4J29A 1H6BA 1DMSA 5D6NA 2OM2A 3OO1A 3VR5A 1IK4A 4NZNA 4BLUA 3RRZA 3PITA 4GMDA 5TDHA 2VPQA 2WU3A 1W9MA 3JVUA 3PC6A 2PVPA 3PGVA 4M9QA 4GMFA 1N2EA 5FBWB 4XB6B 3JD3A 5IF9A 1QHNA 1HEUA 2PY6A 3KE8A 3PLNA 4YRDA 4KXUA 4EHKA 4J0IA 1OFUX 5EWLA 3TK1A 3RYHB 2ZZNA 5ULLA 3TVTA 3G9UA 4NQRA 1NUUA 1N5RA 3ZDXB 3BH7A 4M2LA 1LPAB 3NHUA 2B34A 4EGJA 4F4HA 2DBQA 2QN7A 1VZ3A 1TAHA 2Y4NA 2IDMA 1GOTA 1L7QA 1QTNA 2PX8A 2KBEA 1U3DA 2PLWA 2FW0A 5CGZA 5IVHA 3R0ZA 3PHHA 1EHYA 2R6R1 5TR9A 3TO5A 3AQIA 4FCCA 5JYDA 4NXMB 3F98A 3ZDRA 2PCLA 3W3AA 4TRMA 1QCYA 2HBYA 1HNXB 1K97A 1Z6YA 5FFMA 3OHSX 5JZMA 5FYDA 3TQCA 4LA4A 4CKEB 2HXGA 3QIVA 2J3JA 3WL7A 4LC1A 2OV6A 4YJGB 4P2BA 4TRRA 1UC8A 4A23A 3M1LA 3U7QA 2R6JA 4OXXA 1KHXA 1OHHD 1XROA 3O7MA 1L9XA 4F84A 1MB0A 1OUMA 1VQ1A 3NC0C 3NYWA 3VSCA 2BM1A 1HL7A 1AIPA 3EH2A 5CLFA 3ZIAA 1R10A 2Y92A 5TT1A 2PUGA 2GH1A 4XUGB 3SK0A 1WY7A 1Z2OX 2CJPA 4HTFA 1GUYA 4S3MA 4WFJA 1J2UA 2ZFUA 4I1SA 1EWVA 1YE5A 5HJ5A 2QZZA 2QXUA 1XEXA 1KDPA 1TD9A 1WW3A 2Q1TA 3AR5A 2G88A 4NMMA 3D2LA 3DH0A 3HDHA 2NADA 3P5SA 3KTAB 4DNOA 3FKQA 5KNCA 4NEHB 1H23A 4OX9Y 4YRKA 3E5MA 1FP6A 4WK6A 3GQBA 5CLLA 4M8KA 4X5OA 1HWYA 2H7VA 4LCJA 2CDCA 3NDJA 5CHYA 4CLEA 2PRZA 4TMWA 1VG9B 3ILSA 1YR7A 5JIBA 3GFRA 3MTAA 3UOTA 4ZWNA 3EWIA 3ES9A 3IOYA 4QU8A 1PJRA 1R0LA 1Q0QA 5H3LA 4X7BA 3WRXA 4XWWA 1ONSA 4GUDA 3UXMA 3SIWA 4BV9A 1B41A 5SY4A 1I51A 2HYDA 3IKJA 4K2HA 4Z9BA 5AI5A 1BHSA 4FFDA 3LHSA 1ZNZA 4URZR 5B55A 3W2FA 5THKA 4KBFA 4A7PA 1W34A 4XLZA 2MYTA 3TOSA 1I1HA 5JXIA 2DCMA 2BFDA 4NX2A 4GZ6A 1UBTS 1O08A 4KAAA 4QARA 4BFTA 1SQ5A 5CT5A 4C30A 5IUNC 1JG4A 5FOSA 4BJ3A 1JEYA 4WOBA 4RJKA 2DUUA 3DDZX 2GSDA 3ZHVA 4C0AC 1XO1A 3CCBA 1ORTA 3H4MA 1SK8A 2QNRA 2BH9A 4HB3A 4HAXA 5KX5A 3G0DA 1DIHA 721PA 4GW3A 4BVBA 2FUCA 3MUNA 1BMFD 3D4PA 1XYVA 3QH4A 4UOEA 1V1MA 3D8BA 1MP0A 2SHKA 3ROTA 1AO3A 2HIMA 2IYAA 4D3FA 2HPVA 2QBYA 5EYPB 4PAWA 3RVDA 5LQCA 4XH9B 2C4KA 2GPBA 4N3GA 3DITA 3I5YA 1KORA 3LK7A 2GPNA 3EVAA 3E22A 4AECA 2ZJZA 2NU7B 2H1HA 4MGZR 5AW4A 3NIDB 3VHXB 5KMGA 2AVNA 3IP1A 1UBEA 1Y5RA 2ZE8A 5CX1B 2MWMA 4OHYA 5CA1B 3GUYA 1R9JA 3K4HA 4C78A 5CEFA 1RYFA 3IRUA 4KK3A 1E32A 1YONA 2RJ3A 2BM8A 2ZJ4A 5KSYA 5JERA 2I4NA 1QP7A 1NR5A 4F4IA 5BORA 1USVA 3AIMA 1Y1LA 4A2CA 4F85A 4CEHB 2CHUA 3MMNA 3IESA 4DMHA 5EJMA 1VHDA 3IVMA 3M1AA 3SZ3A 1NVFA 4MV5A 3DNMA 3AWIA 4D4GA 4PV7A 4US0R 5KOHA 1WJGA 2I34A 4QJ4A 1KI4A 4BO9A 4LJ5A 2VHTA 4ECEA 4O0LA 3WIUA 1GARA 1YTLA 2OV2A 2REBA 3Q0EA 4IUBS 4MQ6A 5JR3A 2I6FA 2VSQA 2J07A 1A7AA 5BN4A 4BNLA 5FPSA 4HDAA 1NG1A 5EGSA 4LK3A 2QNIA 2E49A 4BU0A 4DM3A 3KHTA 1U2DA 1KEWA 2BEUA 5FLEX 2GNAA 3T7EA 3TQQA 2Y0CA 3KALA 4EA6A 3SHWA 5LZ9A 1QWOA 3FSEA 2RGXA 1KDTA 2Y99A 4E07A 5IAGA 4OHRA 5JLJA 4U39A 1SHJA 4LN1A 2X3UA 2PU5A 3GLVA 2H9YA 4ZMRA 2ZJ5A 4PYNA 4EJ2A 4JFRA 4JI1B 3BXZA 5ALPA 3BFXA 4TV9F 2XY4A 4EJMA 3U4MA 1ZNQO 4DY6A 4H1HA 5LLDA 1MENA 1NY6A 5MFZA 7MHTA 1JTEA 2QAJA 3G1UA 3TB6A 3L79A 1OIWA 1DAIA 1U5BB 1LK5A 2GLTA 2VJKA 3NOQA 3OE4A 3PCXA 3IVCA 1Z5ZA 5DHQA 4QFCA 2FRXA 3TSCA 3A4YA 1NX9A 1VYVA 3U4AA 1R8YA 3C3WA 4NY1A 5EP4A 3RJMA 4CIXA 4II3A 2RI6A 3BBLA 2IVZA 3OPNA 3TM4A 3VI4B 1BVUA 1YOVA 5EINA 4H17A 4CIVA 1HKHA 2XUQA 3ICOA 3V6LA 1SA0A 4ZAYA 2EIXA 4BMYA 4I9FA 5FBKA 4YGXB 4Q0MA 3SG0A 3ETLA 2HLHA 4KJXA 4PF1A 1N2BA 5I3CA 2Y71A 4YBRA 4JIVD 1DEXA 5L3QB 3UYLA 4J0KA 4ZOBA 1AQIA 2VNAA 1DS6A 4JEMA 1HX7A 4ZKEA 2VF8A 4AW9A 3HMQA 3IO3A 4ZT2A 3TF5A 1ODTC 1UPTA 1VRVA 1GQSA 5FWAA 1B15A 2ZDHA 4HNQA 1ONOA 5CXXA 1N33B 1YHNA 4RPGA 3BHIA 3R7FA 3U44B 4OHOA 3JR3A 1YRAA 1XRNA 3ZDBA 5ESDA 1JLSA 1FRZA 2ZUFA 5EIBC 3ZNOA 3ICWA 4CF6A 1ZYUA 1RP1A 3CW9A 3FW1A 1X8XA 4AS1A 5T3UA 3OZUA 1OX4B 5E50A 3ASZA 4L9AA 4YV2A 2VJQA 1MAWA 4KAJA 2XQKA 3QVMA 5ERGB 1OLUB 2X0DA 2G77B 3DAOA 2WDPA 1OVMA 2J6HA 4HPWA 4WV3A 5K51A 3CLVA 3RM3A 2RSLA 2N75A 5LJIA 4UE6A 1BG6A 1PJTA 4ZQEA 5FFNA 4D98A 1ZY2A 1L4KA 2BJWA 3C3MA 4LNUB 2PRIA 3LPLA 2UYHA 2O2JA 2OCIA 2FMUA 1AK1A 1B2RA 4RV4A 3MQ2A 1GR1A 4MUAA 1ZD9A 2W2KB 5AVZA 1H2EA 4V0KA 3GP5A 1I4WA 1RBMA 5GJWC 3W4IA 1O5OA 1VLHA 3HLTA 4CXMA 3HYNA 4M8SA 4NBKA 5BXQC 2QQFA 4GYKA 2CVQA 4LDAA 3GD7A 3V1UA 2GVDC 2JFBA 2ZBUA 3GRZA 4YA6A 2Z3ZA 3OI7A 2ZK7A 2IWRA 2WF6A 1K2MA 3KVNA 4OU4A 5LQMA 1UDRA 2Q4DA 1YCGA 4XX1A 4IG4A 2JVJA 2QJFA 4R1UA 3WRWA 5ADWA 1DRWA 4IXDA 3U7JA 1PFYA 1XD8A 4MR7B 4IDOA 2GEVA 3NYIA 1KJYA 4D8VA 2EBWA 4JU9A 4HB0A 2BDTA 3KX2A 3P4XA 4NENA 1YUMA 4ML3A 4Z9FA 2C84A 1R88A 4NP6A 4J2OA 4PX5A 5JD5A 1IJEA 1F0PA 3R6LA 3RO7A 2JBAB 4NE2A 3UKJA 1NI4B 4XDGA 4B31A 3B3GA 3GJ3A 3THSA 1ISFA 1UBSB 2ONJA 3JXEA 4M1KA 3W5VA 1G55A 4J9UE 3WGYA 4OQFA 5ADVA 3TW0A 3DONA 3LDUA 1FDVA 2OWEA 3AUSA 2H07A 2QRNA 3O26A 3QE2A 1PR3A 5D00A 1Y1PA 4P32A 1OD6A 2MINB 3C1AA 4UTNA 1NI4A 1U2SA 1T9KA 2NSDA 5BOSB 3ZDCA 4KLRA 3V4SA 4NV0A 3HACA 4MWZA 4Q4AB 3IAM1 5AKZA 4K6KA 3C24A 3GBPA 4OQMA 3F5FA 3EVFA 4MTLA 1QP4A 3C4QA 1ADBA 2OB1A 1XTZA 4MLCA 2DE0X 1CULC 2FEOA 2PT6A 1LDNA 1ZICA 1OVGA 3LX6A 4C9BA 2PUFA 2DYKA 3MJRA 1BXRB 1RLJA 3MINA 4Q82A 5T4HA 4D6XA 1BKYA 4ZOQI 1HTWA 2JH8A 1U7VB 4AYXA 3A25A 2QDXA 4ARCA 1J49A 1L4MA 1WP4A 3F2VA 3DOCA 3I1YA 2VDPB 1DADA 3EMBA 3KJIA 2ZU0C 4TT8A 1Y1TA 3R7BA 4UW9A 5FOUA 3G2OA 3K0KA 4MYRA 3SEFA 2FX2A 3TTXA 1R1DA 5KU1A 4XCQA 4IZIA 5E2IA 1QO7A 4R6XA 4M54A 2GTPA 1MZPA 1A8SA 2GCOB 1E5XA 4BWYA 1KHTA 1RCUA 1C7RA 2ODBA 2IXDA 1C0EA 2BFFB 3PGA1 1JECA 4Q02A 4Q66C 4YAOA 1BS2A 4E13A 4E46A 3LH5A 1WXEA 1NM5C 4KIFA 4KITB 4QM7A 2A4KA 3CNQS 1GL9B 3GARA 4BVLA 4AZVA 2PQ6A 5K8CA 3IH5A 4PBSA 3DB2A 2XUAA 1AG9A 1WXGA 1XZIA 3PWTA 3HO1A 1I5RA 2PTHA 1ZK1A 5FX2A 3W6OA 1TA4A 1BHQ1 3G2QA 2O5VA 4RESA 5THQA 4BE9A 5I9NA 4L8WB 5FBVB 4NPHA 4GQAA 1OZHA 2GJ9A 3CC8A 2C96A 3CW8X 3MJHA 2QIPA 3BMCA 1W96A 1VTKA 2JI8A 4I3GA 4YC7A 2BGRA 1QFSA 2PWPA 2ZI9A 4F8YA 5ILGA 1YZUA 4R8SA 5KYKA 5CURA 1UJBA 3BWMA 1IOLA 3WKCA 2G0TA 3U13A 2Z3VA 5IK2A 3RSFA 3ZD9A 4CLHA 4M98A 3TTYA 1IN4A 1MQ8B 4S1TA 5DM2A 3UG7A 3N58A 3TRFA 4XW2A 4I4TA 1Z16A 1NJ1A 2VHCA 3KLOA 5CG1A 1O94D 3RAEC 2PGIA 1KU6A 1H0HA 3BCHA 5B7QA 2ZETA 2ZXFA 3KOMA 3OD1A 5AOCA 2GBGA 1WKCA 2PMFA 2FSIA 1KY5A 4EJFA 2CXNA 1JKFA 4ND1A 3RVMA 1WE2A 3ROEA 1N0WA 1P73A 2BDEA 1GCIA 3M1YA 1KJIA 1T9ZA 4Q7MB 4XWGA 2NUTA 2HPAA 2ATCA 2VG8A 2HY7A 1WDTA 3NRJA 4OK3A 1Y98A 4RXTA 5HF6A 4MP3A 4NXNB 1L6RA 1SUBA 2I8AA 2MYNA 3DCNA 3MJSA 2JZCA 5AHRA 4UVDA 4JGGA 5LQJA 2QSZA 2MMGA 3AILA 3L18A 3V1TC 4ZAZA 2G8NA 1U98A 1HDXA 3AT1A 5C35A 2RHMA 2WYHA 1XTRA 1V5EA 2GEBA 1XC7A 2IEGA 4HF7A 4R68A 1RHQA 2K7ZA 2EJWA 2E7ZA 3FRIA 2OD9A 3R3WA 3W6ZA 4BFVA 3D02A 1OY1A 1V3VA 2H5LA 2ZIXA 1IJBA 3MDBA 2GEKA 1KR2A 4XVHA 1RC1A 1HLFA 5DGXA 4RS4A 3ZYCA 2O8FB 3GLQA 3TOXA 3IBFA 3NBXX 4JOSA 1QQ6A 2OHIA 3TQOA 1Z18A 1ATIA 3I1IA 4PAQA 1UT8A 2AMLA 2VK8A 3EIUA 3DMTC 4XGNA 2OQVA 1YZNA 3TRIA 3V32A 1ZK2A 4YQEA 3UKOA 4Z7OB 5F7OA 3EAFA 4Y6LA 2ZR9A 4ZOAA 4CM7A 3THOA 4Q6BA 5C4MA 1JG2A 2RGAA 1QBKC 1XZMA 3C74A 4R9NA 4CDGA 1OLXA 3WLAA 4EVIA 5LB2A 3VSEA 3DLBA 5ALZA 2FUNB 2VJYA 1U1DA 2HLPA 1Y8RB 3IA2A 3WYNA 4B7UA 4C76A 5JDCC 3I6MA 3MWDA 4JLKA 1G6KA 3BMQB 5HZMA 4GZ3A 4QYXA 5TPWA 4JLNA 1EE2A 4KMMA 3STWA 3LAWA 2FOXA 2H1VA 3U3ZA 1KH2A 2QVXX 4JBYA 5D7NA 1W36C 2FF7A 3KPVA 4FOLA 3NIWA 2VP6A 1SQGA 3N8IA 2HCRA 2QD5A 3LT2A 1GUZA 3NBAA 3QF7A 3GUCA 4QUHA 2J3KA 2GBIA 3U80A 3OFND 1PKEA 4IYRA 2YJTD 4HXGA 1LPOA 3HU1A 3GUZA 3W06A 2YXDA 4TROA 4EKNB 4NJOA 3BGOS 2BGNA 2HRZA 4JK3A 4FJ0A 1LPPA 4JBLA 4N18A 4O25A 3EH1A 3TRHA 1TOAA 1IBSA 1DLJA 4KZPA 5DWVA 2CYAA 1B3RA 4TWRA 2I3BA 3NB0A 1SBQA 1E64A 1ISHA 2D74A 5CVDA 5CB0A 3C1UA 3BFPA 1BCSA 1QONA 2QRGA 1U4OA 3NWPA 4HN4B 2FW7A 3E9YA 3H2JA 3GU3A 4TTSA 2EYQA 4K1LA 4RL6A 1FFXB 1HFJA 3KJGA 4UFPA 2ZJYA 4UFNA 4XA8A 5JH7F 4E3ZA 2FEAA 4MMXB 1KVUA 1TVKA 4W8HA 3HJAA 3E7PA 3SSNA 1COZA 2J46A 1CZRA 1O95C 2A0TA 2H51A 2BKVA 2JJQA 4OHPA 2V7EA 1FK8A 3PXAA 4K87A 3BGWA 1Z75A 3GD5A 1U2TA 4YLEA 3C7TA 3HBLA 4A4DA 3OEHA 3PHIA 4OJMX 3QM1A 2L2QA 1YB6A 1M34B 1G8YA 2PEYA 1S3IA 1N0IA 4G9EA 5DYGA 3TW4A 3ZIAD 3QX7A 1HUQA 3N1UA 3E9QA 2CFTA 2JIMA 1L1RA 1WQ1R 3AI3A 3G23A 4FDVA 3G8DA 3UJ3X 2EHJA 5LLTA 3IUNA 2JFHA 4KQIA 4AF6A 2JGDA 5TX7A 2QUJA 4J0GA 3SXUB 5ALJA 2R6HA 3WIBA 4J4HA 1II9A 5HE8A 2ZVJA 2HMYB 3QWBA 3PT5A 5JI3E 1XJQA 3FJOA 1N1GA 5EKXA 3BHMA 1TF5A 1VPVA 5KWIA 2BEVB 2ZDGA 1MAVA 1DV2A 4C1BA 1NVWQ 1ZH6A 5TJHA 3EFEA 1JHMA 2PLAA 1YU9A 2CJYA 1ETHA 4MUGA 4NENB 1Q21A 2GJKA 5E6RB 3RQIA 4BMNA 1GGJA 1KEPA 1ZMBA 2YICA 3OZTA 4CCWA 4RSHA 2C8JA 2HA0A 5JMTA 3ZD7A 4FC7A 3DLPX 2ZOSA 4J3JA 4O4HB 1W0KD 5FYQA 1EX9A 3TOVA 1L5FA 4L4UA 5C5EA 3ZOKA 2P9BA 3BB4A 1V25A 2GXSA 3HMKA 2F1RA 4I1OA 5IPFA 4OYYA 4ESOA 4FP9A 3NBFA 3FYUC 3OJLA 5H59A 2VRCD 7REQB 1LJUA 2O3TA 1L5ZA 2OBMA 5H82A 3AKCA 3H2BA 4IWNA 1RD4A 4DG8A 4WIAA 3M6WA 3HFRA 2OPHA 4C03A 1RXVA 2QYSA 4CG0A 4N7BA 1L5NA 1POWA 5AJYA 1OA0A 1Z7EA 1IIBA 5EE5B 5ENVA 3IPYA 2PUJA 2R48A 3O94A 1E0JA 4CDMA 5L7WA 4KTTE 2P75A 2QWXA 4PQFA 3SYNA 4MUMA 2IH4A 3O95A 2P9GA 2WUDA 3ZYZA 2UZ4A 4I81A 3W4KA 3DLAA 1SZDA 2HMTA 2I1QA 4UEQA 3KZMA 3EIOA 4I5EA 4UULA 3AHHA 5LBTA 2PUVA 2X7XA 5TARA 1ZD3A 5TS2A 3W7BA 2W8ZA 4GPEA 1O95A 4BCBA 1DD1A 3W2IA 4LGYA 2PLRA 4M7WA 1WPXA 1W4BA 1KMCA 3O7WA 2J87A 4L7VA 4BLRA 1ADJA 2NO5A 2IS1A 4QQNA 1PEKE 3GLGE 1R0KA 2IUTA 1NMXA 5JDIC 3R5SA 3ZVLA 1RJ9B 2Q3JA 3KJNA 4TS1A 4V0SA 5AM2A 4WNIA 3EC2A 1U0NA 2Z04A 4RKQA 3DE0X 4J2TA 1NN0A 3TX2A 2YRFA 1PNQA 3K9GA 3QBDA 3S8MA 4BFZA 3OF3A 4MOWA 1YI1A 5KVAA 2PJUA 4JWTA 4MIEA 1KSFX 4H7PA 4NJMB 4TTQA 4Z9YA 2R1UA 1GT6A 4KX5A 2XKJE 4DLBA 1QIJA 3GMDA 3K0BA 1W581 2JD0A 4NJMA 3ORQA 4D97A 8GPBA 1FNNA 2OOKA 1T8YA 2O07A 2VIIA 3QHQA 4HAIA 2G9QA 2WJ4A 2A94A 1AKNA 1JJAA 2P0YA 2XVAA 1E59A 2FF4A 1FW8A 3L0ZA 4DYHA 1E0DA 2NXJA 4B9AA 1TA9A 3M2PA 4ZHQB 1TUBA 3KPYA 2X4DA 4X7PA 4K6HA 3VPSA 2VKTA 1NU8A 1PKXA 1YE8A 3OZGA 5C7LO 3HZOA 1CC1S 1EMDA 2AQIA 3OZBA 4QULA 2B35A 3KYBA 2O8EB 2Z83A 2NVUA 5FOXA 1ITZA 3FSRA 4WZAB 1U80A 3FMFA 3HCNA 1PEYA 2DPXA 4X1IA 1MOZA 3TTVA 4CIWA 4OSPA 1Z5GA 1UBCA 2A9KA 2JFYA 1ONPA 2YINC 3KKNA 4G4JA 4IDPA 3IIEA 2IEBA 4EHFA 1LW7A 3DMFA 3CPHA 3ELVA 3VAAA 3LPAA 3A1UA 3M6XA 1RMYA 3WWDA 5F2OA 4L4SA 5LUAA 1JSXA 2GT1A 4D74A 4DXHA 1ZLYA 1Z25A 1VYUA 3GCXA 1XKQA 4G5OA 5TPZA 1JDPA 3GGCA 1O0SA 1UWCA 2JIRA 1P3DA 2FQXA 1AUVA 1NYLA 3CZ5A 4LOHA 2FH5B 1H4SA 3CZMA 2HEIA 4BVHA 3GLIA 4UBJA 4LRWA 4KFCA 1TQ4A 1OAOC 4YLYA 4AP6A 2HCTA 4QYSA 2J59A 3C15C 3M9XA 2PXXA 3VYTB 1KGDA 4ER5A 3RFXA 2UUAB 1G3QA 2B0CA 3AFNA 5F76A 2P78A 3GVIA 1B0UA 4KR0A 2O20A 3G9XA 4RJIA 4YMSA 3G1TA 3V4RA 5EIXA 1E61A 3HB0A 4D9HA 1PD1A 1J8VA 5B64A 2EDCA 1COWD 1KETA 1BCRA 2AOVA 1LSOA 5J5AA 3KPWA 3NUZA 2UYCA 4LGVA 4A10A 3KLNA 3CBQA 4MEJA 4P0TA 4QIHA 2W37A 4Y1EA 4Y3UA 2R6FA 1TE2A 1NDHA 2G25A 3O03A 3ZCPA 4MPTA 1P2DA 5EUMA 5THXA 2O05A 3M89A 4JLJA 2YDXA 1JBQA 3ZDQA 1HFEL 4D9FA 3V2GA 2AFHB 1P0PA 4PU0A 1H65A 3HXPA 5ADHA 3H3JA 3PS9A 1EM6A 1X7YB 3SSOA 4KXYA 2GN1A 2PQ2A 4BBJA 3CT4A 4D4IA 4EDHA 1X7YA 1EAYA 1XU4A 1JSCA 1KYWA 1XTJA 1M2HA 1XRPA 1X38A 3GW8A 4IBOA 3PC2A 4DGSA 3AUJB 5IFKA 2XDWA 1KVQA 2C5FA 4IXTA 3PJEA 4C4PA 3JZFA 3T0IA 1G38A 3F6SA 2J3HA 1SUEA 1M2WA 4JI3B 1YVEI 2JD2A 1U2GA 4N0QA 3CUWA 2QK4A 3V1KA 4KJZA 3Q98A 5AHKA 1ISJA 1IOVA 1SWVA 2TSYB 2XNSA 1YS6A 3HA3A 4K9LA 4Y6SA 1BCRB 1J39A 2BSQA 3QEJA 1EIZA 1F14A 3H5AA 4ER7A 1XBTA 1HT1E 3JQRA 4OA5A 5JNSA 1RI3A 2JZOA 3RC9A 1HYHA 3B9PA 3O5AA 4JEHA 1DDOA 1FJHA 3DOUA 4BE4A 4QBTA 4WLVA 1UAAA 4D5GA 1G5QA 1WIWA 3Q3HA 3CXRA 5REQB 4C4SA 1MN6A 2AMJA 4RYDA 1KIFA 3DDHA 4C0HA 5KYNA 3HP1A 5HX7A 3U3XA 1F4PA 3B5JA 1O0CA 3PXBA 1FB5A 2ZSUA 3D43A 4KQGA 2XAUA 1P4GA 2ODTX 3RT9A 3VI3B 4PSCA 4EO4A 2XUHA 4OXRA 3T38A 4QGHA 1ES9A 4NCAA 3L7CA 1BYUA 1LRLA 2LC1A 1SXJC 3OUNA 2WU4A 3GZNB 4MKZA 2AHOA 3KOXA 1SG0A 2P8SA 2O2SA 1Z28A 3EPRA 3HJRA 2G1JA 1JJFA 2UV8A 4KWIA 4M1EA 3VKVA 2WAXA 2BSAA 3EE6A 3AESB 1YRQA 2NVBA 2XGSA 1D0SA 3QXJA 5JALA 1A1VA 3IHLA 3TMAA 3NGLA 5BW6B 4EY8A 2D6FA 1IBKB 1V9SA 4OOFA 1M73E 3VX4A 1UBGA 2X1HA 3LWZA 2YHSA 1ESMA 4C1NA 2DFTA 1P61B 3JQPA 3F7MA 4LHXA 3VH3A 4AVYA 1Y6GA 2VWHA 4JR2A 4WEOA 4MW7A 3VR1A 1J33A 3PEYA 2XJ4A 2QX7A 3DQPA 3VC1A 3WB1A 1UODA 1NW8A 3WJ7A 1Y81A 2QLTA 2H1FA 1XT6A 1OIXA 4C0LA 2J6IA 4C4TA 4ETIA 2HJGA 4ZVOA 4CMIB 3MGGA 1YT5A 5KAMA 5MN5A 1YZVA 4C4XA 2CNDA 2V4MA 2WUVA 3WNCA 3MUFA 3COSA 5DHFA 4DLNA 5BW5A 3G0HA 2CXOA 2P2GA 8AT1A 5ES4B 2ES4A 2K5UA 2IYRA 2OG2A 3EIXA 1A3CA 1AS2A 4Q48A 3SR3A 3EAQA 4RPIA 2XQFA 5ELXA 3UT5B 1FSPA 3A04A 1KDRA 4W5TA 5FBZA 4PIPA 1IHYA 2G83A 3EXIB 5JAZA 3GYGA 4LRXA 2BIFA 3NIGB 3JCZA 4NMHA 1ABEA 4E1BA 1S2IA 3EGIA 1RXEA 2Q1UA 3RIHA 3NTRA 5L7YA 1EM8B 1HLDA 2FTKE 3BWEA 4M0PA 4QWMA 3WKBA 4AICA 3UAGA 1LK0A 4N3BA 4IDQA 4J4TA 2RHWA 3RARA 2X5KO 4RY9A 3L6DA 2HI0A 1LF0A 5T6BA 3OX1A 1NVAA 4CDNA 1FUIA 1KMHA 3EZGA 1KEUA 3LLVA 4MNTA 5EWJA 4WJLA 3H86A 3NOOA 5AIBA 4UCWA 1P8AA 4GBGA 3EDYA 1KFKB 2IYYA 3LBHA 1M33A 2VTVA 4PHFA 3R7NA 1O0BA 1WTCA 1MJ5A 1W44A 2XXJA 1K75A 1FNMA 2IYUA 2J5QA 3D3JA 2VT7A 3L8EA 4KRXA 3CUTA 3DQQA 4N54A 3ZWDA 4DQLA 1EZZA 4WN3A 2WJAA 3ILYA 3BE8A 1NI3A 2BBOA 5A9TA 4EENA 4F4DA 2IIPA 3GZTB 3NTVA 4B85A 1WY5A 3QE3A 1TIKA 4TZ0A 2ASVA 1Z26A 3RVNA 1YMQA 2VQ3A 4DWJA 1F38A 1NWHA 2D4HA 3PO8A 2HV8A 3T0GA 4ERNA 1IPHA 2ILTA 1X1TA 1GILA 1G59A 4OEHA 2JLCA 4MVWA 2H65A 3JQ9A 1GPH1 3GEHA 1QGYA 4MMZB 1H05A 1NI5A 1T5SA 5ALXA 3PQCA 4F4FA 4HWKA 3HFGA 1DMRA 3IEIA 1PLLA 3AVOA 4R0NA 1DAOA 4ARIA 4XWYA 2VLBA 4G25A 2BONA 1K3QA 1ZIXA 5EFOA 3FZQA 4CKBB 2J85A 1CJMA 1ZISA 1T8PA 2JAQA 2BHRA 2ID8A 1K3JA 3CF2A 4CKWA 1ORRA 3TI7A 1N0UA 5BSEA 1KIMA 1FYFA 1M2JA 4TWAA 4Q7KA 1K6JA 1PW5A 3RT7A 4GSLA 2ATEA 5EI5A 3RRYA 3SAJA 3ZCSA 2RKWA 3H8JA 4L8LA 1FNSA 4RIFA 3ULKA 3UUGA 4HUJA 2AZDA 1K6IA 5HZHA 3EIFA 3B3QA 1GAWA 3FNBA 5HIIA 3SYLA 4A6DA 1G5IA 4RS3A 1L7BA 5F35A 3VH1A 1F8UA 4X6UA 1X7DA 3ADDA 2LCFA 5HM6A 2J0UA 2CXXA 3GA5A 3L6CA 4MW2A 4RA9B 1CR2A 1SXJB 1VIAA 3EXAA 3KFVA 5FIUA 2UZ0A 3ONNA 4PG7A 3SBEA 3OZ7A 3ZLBA 3FI9A 3ZU3A 4BO4A 1PFUA 1H2FA 2A86A 4Y2VA 1EK6A 2DSNA 3N2ZB 3ANYB 3L3BA 3SOPA 4DT1A 2V9CA 1YR6A 4UBNA 2JKVA 3FDIA 3M9WA 2GHRA 4R1OA 2QTCA 2PL9A 3NM4A 5JLAA 2R47A 4PLCA 2GHIA 1FRQA 3EUWA 4GE3A 5KPJA 1E94E 2JATA 4B17A 3A4IA 3DLHA 1E1DA 1IQ0A 4LJ9A 2X76A 3H13A 3BSWA 3HY4A 3IUQA 5KNBA 1QIMA 4JT4A 1EFCA 1KQPA 2ZSKA 3R3HA 1FTWA 5ALFA 5EE0A 2NU8A 5K6AC 1YDGA 2C42A 2ZRPA 3F8WA 4M1ZA 3WE7A 3I0NA 4PYKA 4NV3A 3TAUA 5LQKA 2HMAA 3WDKA 2FJ0A 2HU8A 4RXUA 5SZJA 1JHQA 4BRWA 3IQEA 4ZQBA 2AJCA 4LE1A 4EHNA 3IAXA 1EX7A 2R8XA 1IOZA 4YRBA 4DQ0A 1PQPA 1A8IA 3V4ZA 3ZZMA 3T4UA 4HGRA 2P5UA 2OAQ1 4IXMA 5DXJA 3VZCA 2XUOA 2JG3A 3WL5A 1PHRA 2DHRA 4B8WA 3MLBA 5JFOA 5AM5A 3PXDA 3IKTA 1ACLA 3SGLA 2WFZA 1RIIA 2GN2A 4QASA 4TOIA 1H0SA 1Z34A 3NORA 3AVTA 5TEVA 2SNIE 2AXPA 1H4VB 4CUJA 4CLXA 3K94A 3NWEA 3TTSA 1YR2A 1FX0B 2BE7A 2ERYA 4H0CA 2BGTA 3H9BA 3RAFC 2AI3A 4RVUA 4G0VA 1J2EA 1MBZA 4FFNA 5JPCA 5HJEA 1D6MA 4UREA 4GGOA 1TFRA 3K20A 1U11A 3CVYA 1UXHA 2IU6A 4DDUA 1N2ZA 4D4MA 3KSMA 2QRMA 3A3NA 5JT1A 1WHTB 2FZKA 2OSVA 2X13A 3GJXC 3KZCA 3N6VA 4QX6A 3RJTA 4IS2A 3GRPA 3GBVA 2AEMA 3KU1A 2ISCA 2LW7A 2P4QA 1YJ5C 1Z6XA 1DCMA 2HRCA 5L3QA 1DQSA 2P2ZA 2QAIA 3HSSA 4GWGA 3GWGA 5DNDA 4ZZ0A 1ZRSA 4US1R 4IP0A 4FFBB 2MR5A 3H17A 4UMFA 2UXBB 2ZAIA 2I2FA 4L76A 4PPFA 4I9UA 5DO9A 4KGZA 3IBGA 1EWTA 5FBRB 2WWIA 2Z2XA 1EXNA 2CK3A 3IUJA 3ROZA 4C3UA 1THMA 2J4FA 3ELUA 3EGDA 2Q4EA 1KVRA 5AICA 2DF8A 1TDJA 3OP4A 3QU9A 1JQAA 1FS4A 3G2LA 4GR5A 3MMPA 4GEKA 1DXYA 2PT5A 2QTHA 3IQDB 4TQUS 2BGGA 2BH2A 4IO0A 1Z7WA 5JHHB 3OFKA 1N5JA 4DPMA 2W2NA 4JI6B 3SN6A 4CGYA 1CJSA 5HRAA 3AW9A 5KNLA 3T5AA 3GO4A 2QY9A 5JOQA 1CUJA 1TNDA 4IDBA 5C1IA 2IBMA 4WINA 3UTCA 4D9MA 3SQMA 3TLMA 3L7IA 5D3QA 2OYRA 2X0FA 4EH1A 1CRLA 2RGCA 4K9DA 4DYVA 5I7VA 2AC4A 2QTBA 1U28A 3OTIA 1DBIA 4JVOA 3HKEA 3RKRA 1KFJB 4E1VA 3PGMA 1RYEA 3QLEA 5DYIA 4RGYA 4HYQA 4BLPA 3VHLB 2GM4A 3SC6A 3IX7A 4JSYA 4Q3AA 1DG1G 1X7XB 5FADA 3U3MA 3RABA 1KP3A 2BGMA 2CDAA 4GD3Q 4LISA 3RYTC 5JEMA 1P1BA 1VGVA 1L5MA 2DBZA 3C1OA 3LT5A 2VYVA 3QVXA 5CH8A 2DEUA 4UQPA 1Z8NA 4BN0A 3LDHA 4DB4A 4EOGA 2J4CA 5KVVA 2IXFA 1T4GA 1E2DA 1FJGB 2IBTA 5IKEA 4TQGA 2DULA 3CNLA 5JQGA 1W48A 4AS3A 5JAHA 1TYBE 1YDHA 3QNMA 3MHTA 3A1NA 2JLQA 1LW6E 3LW8A 5IVPA 1PFVA 4N3NA 4QQ8A 1K6EA 2FCRA 2VHXA 5L3ZA 2XNDD 3C6ZA 5HKKD 1DIBA 2P5YA 5H16A 3LG2A 3WMWA 3IA7A 4E5SA 1L7NA 5CA1A 5HZGA 3TNDA 5J23A 5CU7A 1G2PA 4HBGA 3PC4A 4YFVA 5KMGB 2HU5A 4ZU6X 4R5HA 1Z22A 1K27A 2C2BA 2QTVB 2WIFA 2PQMA 3PP8A 2VJDA 2YZNA 4BGVA 1FVOA 1EUDB 1Q0RA 2Z5GA 2Q0XA 3BICA 4IH1A 3KDAA 2D59A 2D7JA 3ANLA 1TYAE 2C29D 3H65A 2LKCA 3RC1A 3FYUB 1AH2A 4HVTA 1WZ2A 2LWIA 1N6PA 3LOUA 4J7AA 4DDKA 3NDPA 5MHTA 1Y4SA 2C9CA 2IK8A 3DBHB 3IDAA 4EHAA 3DJFA 3DMNA 2FV8A 2VUIB 2AB0A 5CR9A 3C8DA 3GT7A 3VV3A 1PBNA 2I6QA 1XZ8A 2FMXA 4FIZA 3E18A 2VWGA 1LGYA 1GYRA 5CCBA 3GVCA 4LX0A 4E4RA 4JXZA 2HQBA 1QVAA 4B6QA 1IN6A 1ZAKA 2MIIA 1F1JA 2J9XB 2R84A 2Y93A 3ONDA 5HIMA 2IGBA 4Z4FA 3D5TA 5AP9A 1AKRA 2A6PA 4ARZA 1AGYA 3F71A 4YS6A 4DLYA 1JHYA 4FGWA 1LTHR 2E5WA 3F49S 5FNVF 2H2FA 1X1DA 4EHDA 3UMGA 1ODSA 3IMKA 3WP1B 3EA5A 3GLRA 4EY7A 5BOSA 2Q2WA 2V7VA 3NNNA 3TKAA 1ZM7A 4DCGA 2YVKA 3D64A 2GYWA 3OOHA 3AERB 4WBXC 3SYMA 3OPYI 2DTDA 1S89A 2JGRA 2UYGA 4D44A 1OPRA 1WV0A 1ZL2A 5TPZD 2ACWA 3LP8A 4KXWA 2JA1A 1M6VA 5K8IA 4MS1B 2AEJA 2R6CA 3IOEA 4TMFA 1YASA 3HCEA 3FJ1A 4OQQA 4UNNA 4BLSA 1PUIA 4L4ZA 3ASVA 4ND3A 4CKXA 4I9NA 3THXA 3THXB 3H2HA 1SKYB 2JDID 1C8BA 5KWSA 3DDWA 4LNUA 2A5DA 4CUKA 1KZ4A 1PQUA 1WBJB 2YNMA 2A5YB 4O4IB 4PPYA 2BYTA 3LFUA 2J7PA 3GLHB 3MILA 3MJTA 5ALEA 1B6SA 1ISPA 2A7QA 3A6GA 3CJQA