4DY6A

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
258
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inorganic polyphosphate/ATP-NAD kinase 1
publication title NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 67
structure length 258
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 4dy6A02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 4dy6A01
1U0RA 2JGRA 2P1RA 1Z0UA 1YT5A 1Z0SA 3V80A 3PFNA 3VZCA 5EJHA 5DHUA 4V24A 1SUWA 2I29A 2I2BA 3V8RA 3S40A 3VZBA 2I2DA 3V8NA 2BONA 3V8PA 1U0TA 2I1WA 4L02A 2QV7A 1Z0ZA 5DHQA 3V7UA 1Y3IA 2Q5FA 4DY6A 4WERA 5DHPA 3V7YA 4WRRA 5EJIA 1Y3HA 3V8QA 5DHRA 5EJGA 4HAOA 2I2FA 5DHSA 5EJFA 3V8MA 2I2CA 2I2AA 5DHTA 2QVLA 3VZDA 3AFOA 3T5PA 2AN1A 3V7WA
chains in the Genus database with same CATH superfamily
2ZJAA 1Q3TA 3KT3A 4QWMA 1XN1A 1F8UA 4QOFA 4XYMA 4BDTA 1YJXA 3IIKA 3DLIA 3SEZA 2OD9A 1H1LB 2GF9A 1PFYA 1SPXA 2GZRA 1T2UA 3OPMA 3CVJA 1U7PA 1NM5A 1Z4PX 3EZFA 1N1EA 1RRFA 1C81A 3CISA 1ETUA 2X8JA 2XUOA 4F96A 4AULA 3PDIA 1JKIA 3I2JA 2ZI4A 1L1RA 1YA4A 5F33A 3DWEX 5EQJB 1GAQA 3FVVA 4NMHA 4PRZA 10MHA 2Q1XA 2WP0A 3O82A 4YJKA 3G5TA 4LYJA 1EI9A 1QE0A 3ADKA 3ET5A 4HFNA 3ZVNA 1DINA 1EGQA 2UYCA 3IEKA 3HJFA 1OX5A 1C4WA 3KCNA 1LTKA 5C5IA 4IF4A 3RRNA 4PXSA 2PZEA 1XTPA 2Q4BA 4MR7B 4C2UA 1O3YA 3BKWA 2FP3A 1LSOA 1KI6A 4RNCA 4BNDB 1J6UA 3DTVB 5EJMA 5IEBA 3GAFA 3CRNA 4TM7A 1KR5A 1MQAA 1Q0ZA 1X77A 1K5GA 2Y6UA 4E4TA 5IWCA 1B8UA 4ZVKA 3SVZA 1RKVA 1L8XA 1NN5A 1GQOA 2Q4EA 3D1VA 1P5RA 2M98A 3BAFA 5IRCD 1AZTA 1ZUIA 3REQA 3U3RA 3WG9A 4DILA 5C5EA 3KOYA 1DCKA 2R6HA 3FMVA 5IPFA 3CSUA 3H2BA 4YAWA 3QU9A 5LZ8A 4G4SP 4GBJA 2GN4A 2XSZD 2EFCB 4Q4LA 2Z1DA 4F6RB 3FJ1A 5TARA 2WA1A 5H1YA 4W8OA 5G40A 3BL5A 3BXXA 4ZRMA 2OBYA 3UUEA 5A4AA 1PRYA 3HA2A 1WKVA 3FCUB 1UOQA 1LI5A 2J6BA 5LNK1 2BM0A 4CM8B 1MAVA 4U3JB 2Q1UA 4N65A 4OLAA 1EHIA 3W2EA 1E96A 1VG9B 1Y63A 2P79A 4I8XA 3RIHA 3L4EA 5KYYB 2ZANA 3ZHQA 4AJOA 4TTTS 2LIVA 3C15C 1T5BA 2ILVA 3CINA 4IFEA 2JLSA 2CF5A 4O2BA 2GYUA 4MAFA 4ZO9A 1J25A 2ZSFA 4Q66C 2RKOA 2P9QA 1PJQA 5GJCA 3NCHA 3DXZA 1L3IA 2DE0X 3C3XA 2JIMA 4QUEA 3UQYS 1YS6A 4E4RA 5BYKA 2ONJA 1Z8HA 2NU7A 2QN3A 2ZCUA 3M3DA 1ZK1A 2XLCA 3LWDA 1B8PA 1EVEA 3COJA 4H9GA 3UOAB 5ALUA 2FWNA 1D2RA 2ZS8A 4AY3A 1WUKS 1P7PA 1R4NB 2VWQA 5EE5B 5B3JA 1HNWB 3AEXA 4RELA 5GINE 2FEOA 2VDMB 4Y2YA 1U63A 3MTDA 3KZXA 4LYEA 1H0SA 2EF0A 4QULA 2JCSA 4RK1A 2AOVA 1X14A 3CEAA 2BF7A 5IAKA 3H2JA 4RNDB 3OEHA 2YVKA 2QXUA 4W7HA 1EFCA 3E70C 4JJ7A 1GITA 2DYKA 4EZIA 5KYUA 7MDHA 3OPVA 3ROGA 1U0JA 1U4NA 2A9OA 2ZITA 1ZMTA 3L8HA 3UK2A 1SXJC 2OWDA 3A2NA 3OCCA 4GMFA 1IJBA 3D5EA 3OSZA 4YAGA 3MJRA 4TMZA 4DBLE 1PJ2A 3RS5A 2EKBA 4FMCB 5AJVB 3N7TA 4BNVA 1IB0A 4QC2A 4KJZA 3K16A 2BKAA 2X1MA 1PR9A 4CM7A 3RIGA 2PUCA 3EDYA 2GMWA 3AUKA 3DAPA 1ONBA 4FFNA 4KVZA 5KYKA 4CG3A 1JG3A 2ID4A 3MLAA 3ZXIA 1TTHA 4FOSA 3T1NA 1XG5A 2QW8A 1Z7BA 1HUQA 4L1KA 4LVUA 1E2DA 3RAGA 4DDVA 1XWWA 2VJMB 4LY9A 4MUXA 3W5UA 5C5DA 1Q12A 2QXYA 4ZU6X 2VO1A 4IR7A 4WXRA 4MPRA 1V3QE 4MJ7A 2EJCA 2P3SA 4ZTBA 3DL0A 5IVIA 2UZ3A 4I6JA 4C3VA 3JWGA 3GFQA 1FUIA 4DMFA 1XC7A 3WLAA 3ZHXA 5FLXA 2JFWA 4KN9S 2AG1A 3GZTB 3AJDA 3BZWA 1PV2A 1RWNA 2XMSA 4HB0A 2BTQA 5B36A 4H77A 3FTCA 4LHXA 5DBFA 1KZYC 1H2WA 2VNJA 5THKA 3QMVA 4LGCA 3JZDA 1H3FA 2GYWA 3K31A 4KQ6A 1Y4UA 2O2SA 4RHYA 5LZ7A 1ELOA 2HUNA 1I1OA 2R4TA 2RI0A 4GMXA 4JBHA 3W8FA 1EP1B 5GY7A 3W8DA 2W7TA 1G59A 2QB5A 3QIAA 2ZSUA 3NW9A 4JB8A 3B6JA 4EB0A 1UP6A 4DM7A 1QF7A 5IT5A 2ZQYA 3EYWA 1Q91A 3HY4A 4I1UA 1Q7CA 4NS1A 4JC5A 2O8DA 4JYBA 5FA5A 4PBSA 4B43A 3LQKA 1Z22A 4QM6A 1E4YA 4YAOA 4BO6A 1RXCA 4DY4A 2VDUE 4PTLA 1VLHA 1KYZA 4BKOA 5BWMA 3L6BA 4Z0TA 1T6BY 1FFSA 4XFKA 2ZFUA 1O9GA 4R2HA 5HGXA 3GELA 2B1RA 5BN4B 3K15A 3LCJA 3BHMA 1Q5PA 2XGOA 3JQFC 3N8IA 4PG5A 2B7BA 3EUAA 2Z2KA 2PZ8A 3K5PA 4Q3NA 1FFAA 3RVKA 5HDQA 3V7NA 3KZKA 2JGNA 3ZWVA 4LY6A 4CU2A 4UM9B 4YUWA 2ZRFA 4LV6A 2PCLA 2M1ZA 1AIPA 3H75A 4GOOD 1MJGM 4Q19A 3PQ4A 1Y7IA 3BJEA 4Z1MA 1U1IA 3JQQA 2DR3A 2OZLA 3OT4A 2VJYA 1SCAA 3UJ3X 5T3UA 3JVVA 3O4FA 3N2EA 3OF5A 4BO3A 4G89A 1AGPA 2HBYA 3ZJ4A 1EFRA 1MIOA 4L57A 1K7SN 2FPIB 2JD1A 2R86A 5BQ3A 1G9XA 2AEJA 2BDTA 3DWGA 4RLQA 3CZCA 4PSDA 2O0HA 2OBXA 4G97A 5BYJA 1LQ2A 1SBIA 4XLLA 4BQNA 2DETA 1EM6A 2W2NA 3PWZA 4JXZA 1T1RA 4UDXX 2JS7A 4BU1A 3CEPB 3TQQA 3FCEA 3SXJA 1MK2A 4QVKA 1A9SA 2J3MA 3DLCA 4X90A 2GPSA 1YB5A 4LZPA 3M7IA 3Q1KA 4QFDA 3DHEA 4AU1A 2IF0A 2WI8A 4A6PA 1ADFA 1V6AA 4WZBE 1DC3A 2XCIA 3R3WA 4JLOA 2NUPA 4IDFA 4MYTA 2ZSIA 2C4WA 2IHKA 2DPMA 1IZ9A 2ZWMA 4C43A 4MVJI 2LC1A 3UCFA 2GPYA 2IS1A 2BHNA 2Z8ZA 1C7QA 3H9EO 3S1SA 4IX9A 3UTDA 2PGOA 3QPWA 3AM3A 4J16A 1L5RA 1T24A 2X5OA 4LHYA 4S1WA 2IT1A 4C4PA 4QVGA 4UM8B 4MO2A 3N2IA 4CCSA 1DAEA 4IILA 3SHTA 3N8KA 4KN5A 4URYR 2A0FA 1QC5B 1W4ZA 1P75A 5D8DA 5HP4A 3BE8A 2A5YB 2C4TA 2ZJ5A 4BJ3A 1RWMA 4BP1A 4CLRB 3ZX4A 1LVGA 1QMPA 1GZ5A 1QX3A 2XHZA 3SHOA 5JFOA 3KJNA 6ABPA 1QF6A 2G6TA 3AUJB 3OUTA 1FFYA 2C83A 4PSCA 3EBPA 2VEDA 4L3WA 2VYVA 1A71A 2RHWA 3QVMA 5LKRA 3OFNA 4S24A 2X2EA 5A8IA 3CWZA 3CZRA 1L6RA 3ACDA 2O06A 3EXHA 3PRHA 4PGGA 3NALA 3VNSA 1N57A 1W581 1YJ5C 3B1XA 3CR7A 2ENUA 1K3QA 5J40A 4DCJA 3ZDAA 3SQXA 4JBNA 4PICA 3K0AB 4IUDS 1RWXA 5B4UA 3U17A 1JZTA 3EIFA 3HO8A 4P34A 4L8YA 2NUBA 4BUCA 1SIOA 1YVPA 1P9RA 2CK3A 2CXQA 2PBFA 3OP4A 3IJEB 1TEVA 2P1ZA 4RK7A 3VNQA 4KFCA 3SI7A 1F14A 4WLOA 4XXHA 5FULA 2OGWA 1NQOA 4RIHA 2UVDA 3SC2B 3X3HA 1OIWA 1VBFA 3F5FA 3ORYA 2J9ZB 3OD5A 5F1OA 2Q4DA 2PT5A 5FFFA 1YZYA 1J0AA 1PT7A 2IQ5A 5IBRA 4RPKA 1PR5A 1E2IA 2J3LA 3GFTA 1GA1A 2PWBA 2WJZB 4EUNA 1FEZA 4MMZB 3T7RA 1MBZA 2IYSA 4F11A 4KR3A 1N5DA 1NNUA 2OXRA 3O4GA 3U1VA 1T6ZA 4BFLA 4YN3A 5C46F 1EUQA 2UZAA 2G70A 5FUBA 2ZIXA 2WMNB 4WACA 3F4BA 4G37A 2F9FA 3L5OA 5G53C 2Z2ZA 3WGVA 1GXCA 4YJFB 3RTBA 3EPJA 3WIBA 3D4BA 4DV2B 4ZGBA 1YBFA 4BRZA 4CMEA 1KQOA 2HNBA 1RJDA 2QX9A 2B7CA 3H9BA 4YJ2B 2C0CA 3K8ZA 2R6CA 5KQGA 3SZRA 3TTSA 1B41A 1I2CA 1X6VA 3QHPA 1CR0A 2WRZA 3IQFA 2QZSA 3HRKA 1YBMA 5CM8B 1T2CA 3FGNA 4OHCA 4INAA 4XSGA 1V3UA 2EJWA 3ANSA 2Q62A 2BGKA 4ML3A 4TSKA 3FHCB 5T3YA 4EEKA 2PX3A 3DBIA 2ZPAA 2ZR9A 2DHQA 2WD9A 4Q9IA 3N7AA 2EWVA 1W47A 5JLJA 4Q6BA 1NT2A 1UPTA 4OKIA 3UPUA 3O8OB 4I55F 3NEYA 3BPSA 1OIXA 4U6QA 4L5IA 4K9QA 3HRHA 2O8EB 3ZWQA 2G8LA 4HATA 4K9NA 4KI0A 2IEZA 1XALA 1XV5A 1JA9A 2RMKA 1QIKA 3ORQA 4LOHA 2O8NA 2DY0A 4IOJA 4Z3DA 4DREA 2ZJFA 2AH5A 3DEFA 5K4AA 5EUCA 3KJQA 2H48A 3D3EA 4O1HA 1RM4A 2NLOA 3IDAA 4V0KA 4DEYA 4GPEA 4ZCPA 3B3JA 5SZKB 3U2QA 5BSWA 2C3YA 2B1GA 5CJPA 2B2NA 5ESXA 4EJQA 1HLDA 1RVDA 3G6KA 4BKQA 4IP0A 5A9SB 2PZFA 3EULA 2FPKA 2ZBEA 3M6XA 1ADCA 4BV3A 2HMAA 4F7DA 2QD3A 4N48A 4U0KA 2WAAA 1C1DA 4R71A 3CRW1 2UZ1A 1PUJA 2QVLA 1OU4A 4HNQA 4Y0NA 4DWVA 1NVUQ 3I52A 1TJNA 1NXVA 2XT9B 1HEUA 2P9JA 3FSJX 3IR5A 4WKBA 3VZCA 2H4JA 2HU5A 1XO1A 5CW1A 5IU6A 3DG9A 2HO4A 3KYDA 3VJRA 3FHOA 5L8VA 4P4UA 5IYZF 3QK7A 1UKBA 4B2YA 2R7LA 1W1IA 4PFSA 3MBKA 2C0QA 1XEWX 2HDWA 3MWDA 3OY7A 1WCXA 2OP0A 3R6DA 1NN1A 4F4JA 1XZQA 1ZD9A 1JEJA 4HLNA 5PNTA 1OXSC 4DLLA 2BUAA 4LF8B 1D6NA 3DZJA 1OH7A 2H1HA 4LCBA 1MV5A 1K5HA 4LE1A 4KACA 1Y8RB 4O4JA 2ZRIA 3WIUA 3HXLA 2DZDA 4MAAA 2YZ7A 4D46A 5JC1A 3OUZA 4U02A 1ORTA 1V26A 2R6ZA 2QJWA 3OI7A 1H0KA 3ZE2B 3QYJA 4YJ3F 3D9QX 2R65A 1MZKA 5DGHA 3FPHA 1XZCA 3RYHB 3RAFC 4N3NA 1ZD3A 2C20A 3D1LA 2AOWA 5CCDA 4YT5A 4V0OA 2P4UA 3N2LA 1MHTA 1NX9A 5KQPA 5IVHA 2NZUG 5G0TA 1IBSA 1R9JA 3ZBPA 1TVKB 4LJKA 1QFMA 4XEUA 4IVPA 4MWBA 2GHQA 2O7SA 1EGMB 4XQ9A 2XQFA 2IKSA 2R6JA 1P6UA 3R3JA 2DPLA 1NR5A 4JBLA 4K9PA 1AMUA 1OMOA 2AF4C 2XW6A 3FJYA 3FNFA 4A2WA 2EJVA 1L8QA 1VJDA 4BN5A 3HWSA 2ECPA 2G1JA 2OC4A 1NW4A 4L78A 5I5EA 2I2FA 2I4MA 5TEVA 1MJSA 2HRBA 2CLHB 5H3HA 2EX4A 4FHCA 3L0ZA 4LYAA 4OIMA 1Z4IA 4RKRA 2J3QA 1RQNA 3WYEA 2ZR7A 1QMGA 4F1JA 1CF9A 1DAHA 3KXLA 4KSCA 2W2PA 3BD7A 1NU6A 2YIMA 3I1FA 4FDTA 5A0TA 4PLWA 2C03A 4V2IA 1BCRB 2IF2A 4P32A 4QU0A 2OHJA 1D6MA 3QTLA 1RBMA 2WTBA 2B6HA 2YWJA 3FYUC 2CGEA 3LDHA 4FOPA 2VR1A 2WHQA 3LD9A 1V3VA 4A4DA 5FNVF 4F4UA 4M0EA 1A9TA 6NULA 2BJVA 2R1TA 1E1QD 5HF9A 4ZFNA 4Y9DA 3VUEA 1SG0A 4UE3S 4YDHB 5DBEX 2MDTA 3UMGA 1AV6A 4WY8A 3VO1A 1L7QA 4U1RA 3RADC 4II3A 1CBUA 1UBGA 3ZE9A 1V35A 2WYVA 2I8AA 3HN7A 4Q3LA 3ZU5A 4QWWA 2BI7A 1F6WA 2PX0A 5CEEA 2OO7A 3OQIB 1E62A 3O94A 4EHKA 2OK8A 1YJQA 4I1OA 1IONA 1PW7A 1ZN8A 4XOIA 3UGKA 1KGSA 3Q12A 1FC0A 1JGTA 2AZDA 2VZLA 2FPXA 4ND5A 3RD5A 4J76A 4WFKA 4OQNA 4INPA 2HBQA 2AWOA 5CW2A 1D0SA 1G55A 2RAFA 4MW5A 3C7TA 3TEFA 5DGIA 3WA6A 4MRPA 2ONZA 4K87A 3URKA 4N39A 4OL9A 4HNTA 1A5SB 2AN1A 1J23A 3FDIA 2GJ8A 2PZJA 2H2AA 3E8SA 3N53A 1ZY2A 3LIPA 3EBOA 3R5FA 4XGQA 2HB6A 5FJIA 4LV8B 4YJHA 3T3PB 1BHSA 1TJPB 2DLNA 2BKUA 1G3QA 1M0TA 2BTOA 3D8HA 5DWQA 4V1CI 4MV7A 3CWCA 2A9KA 3L8ZA 4DPKA 3TGLA 4MPDA 4TT8A 4GI1A 3RKUA 1BDMA 4BU0A 5HHTA 4GECA 1BXRB 4RKQA 2WKSA 3H1PA 4EY7A 3WB0A 4A0HA 2WHPA 2VPIA 4G1UC 3UEOA 4K9DA 2EFDB 5LR6A 1VBMA 4D8WA 3JWJA 3O7WA 3RJ5A 2VPWA 1XDBA 1DEXA 2IYUA 1M76A 3PD7A 4HNVA 5EFZA 3NQ41 1LLCA 3WTBA 5MFZA 1SCIA 4UBJA 1BX3A 4ESHA 2VSYA 4Q34A 3G9TA 1UMDA 4ETIA 2G88A 1Y1SA 3G17A 5IBCA 3VA1A 4ZIRB 3VRHA 1N6NA 1NBMD 1I4WA 2FMFA 1N3YA 1W0KA 4A92A 1R6UA 1XTBA 4WK0B 1G6KA 3SEFA 3ESDA 1E3TA 1R3UA 1Y7PA 2JFUA 4IIUA 3N75A 4DC0A 2BGUA 5BYAA 3MWEB 3O1HB 1INLA 1PEKE 1W85A 3X2EA 1KFEB 3TAHA 3WRYA 4GFDA 4R2WA 3X1XA 3BWVA 1V96A 2PR7A 1Q22A 2RHGB 1DAIA 4GM0A 5ALJA 3KPYA 2V03A 5HMMA 3G0CA 2DSTA 1XEWY 2QD2A 5T4HA 2XEDA 4I1SA 3NIFB 3K9WA 4CPDA 3ADOA 2ZI5A 4PV7A 1BD3A 1C4XA 3GZ4A 3OOYA 3JD2A 1EVLA 1GTL1 3HSSA 2R1ZA 4AN4A 3PTAA 1GSHA 1MEEA 2JZCA 4IVNA 3W9UA 5CLFA 1SXQA 1WB4A 4YC7A 4MYSA 1Z07A 2IELA 1J70A 4PNZA 4XQGA 7ABPA 3HXQA 3QX3A 1V1RA 4NZOA 4B34A 1YQGA 1ZOQA 1P6XA 4JNCA 3CO0S 5ES4B 4BNGA 2VZ9A 4ZEWA 4MCHA 1G19A 3KOMA 4RF5A 1EHYA 3IUJA 2BMVA 3GA5A 3FR8A 2DTDA 2NTVA 5ECDA 1ADJA 1T34A 2O8VA 4GBMA 4KXVA 3ZCVA 3IOYA 3K35A 2EGUA 4Z9FA 4DKJA 1DKPA 1R8YA 3GY0A 1SGWA 1T3LA 2HLNA 3GI1A 4G5OA 4W9NC 5AI5A 5IMSA 3NDBB 1GWNA 5BSEA 2GTIA 4KQEA 3G8YA 4MQFB 2SCUA 3NLLA 4ME6A 3T35A 2YJNA 2QDXA 3OA0A 5AFSA 1WF6A 3PUHA 4CIBA 4JU8A 2VK2A 2WD7B 4OVKA 4EGCB 2QRLA 3GGSA 4N8SA 3AHEA 3NC4A 3TPCA 3HTXA 3TQCA 3INTA 3CF6R 3H1GA 5HMLA 4D4IA 1NY6A 3R5XA 1US8A 3ND8A 2YWCA 5FV7A 3BL8A 3WMGA 4M22A 1RYMA 2MR6A 3CRQA 1OFUA 4L4SA 1A3CA 1VE3A 4HL6A 2V7WA 1U7VB 3ZNQA 5FA6A 1IXYA 3BA6A 3UJBA 2E4VA 1G9SA 4M55A 2GLUA 2DY1A 3D8TA 2O48X 5FEUA 3EZ6A 1BMQA 2X1LA 5EKXA 4IH9A 5D3ZA 3OFKA 4BX2A 1YJMA 3R0VA 3LUAA 2CE7A 3KFLA 3JYLA 5IABA 4LNUB 3TE6A 4AS2A 5JMTA 4ETNA 4QBTA 4H0CA 1TL7C 4TKVA 4EHDA 3EIXA 1VA5A 1WCV1 2B92A 2BLNA 1HDGO 4HBGA 2H8KA 3VR5D 4OGFA 1Q92A 2YWRA 3SX2A 3WO0A 3QVUA 2AKYA 2PMCA 5HX7A 2C00A 5L3ZA 5DEOA 2ZYHA 5I9SA 4WNCA 1D1SA 3VZRA 2BV3A 2A7QA 1GPWB 4IHQA 3VR5A 2B2XA 4ZO6A 4FBGA 2YXBA 5EA2A 3PKJA 2AVDA 4CQJA 4TRMA 3A1NA 5JFTA 4IJUA 2R66A 1TM2A 3DFKA 4KIGA 4QRDA 3DS8A 4RQAA 3U13A 5F7JA 5LMNB 2GBPA 2VRCD 3GA7A 4IL5A 1MABB 4YLEA 1EFLA 4MXDA 5HM6A 2R7MA 3C3WA 3FY4A 5E6RA 3T4EA 1TF2A 1X8LA 1YS1X 1M1XB 2ILTA 2QG9A 3QTTA 2OGZA 4MLDA 3M6FA 4GLJA 3VO8A 4X3PA 3WHPA 3C97A 1U1CA 4RKFA 1SBTA 2AC7A 2NU8A 1IY8A 4DT1B 1RTKA 1ZH8A 4G24A 1W8IA 2BI4A 2ISCA 3A1TA 5ABPA 5KC8A 2HMSA 4CODB 2GOYA 2P9BA 5EHGA 2AFHA 1YQDA 1VIYA 2VDWA 4OXIA 2HOQA 1RWQA 1YL7A 2PVSA 4W1PA 3RVBA 2JVIA 3C85A 2Q6IA 3V2UA 4AO8A 2NU9A 4Y6RA 4LJAA 1EFPA 3TLCA 1AUOA 2GSDA 2O3TA 1ZKDA 3H86A 3LT2A 2VUTA 4XRRA 5DTJA 1J42A 1RWVA 2P4EA 3AVPA 4UJ5A 3OSUA 2H9YA 4RXTA 4EGAA 4GRAA 4CKCB 3I8SA 4L5BA 1PEAA 4TZTA 4EUSA 3Q0TA 4ZOLA 4FFBB 1HT1E 2JJ1D 3WV5A 1MQ9A 3CUWA 4BLPA 4LWPA 3AESB 4MVJP 2HV8A 3U0BA 3D8NA 5LLSA 4JL6A 4E1AA 2O7NA 1T9BA 5IFLA 4HWKA 1BX1A 2JJ1A 4V0SA 2W37A 3LS2A 3HX1A 3AB8A 4JLBA 2UXBB 4HEJA 3GNLA 1P9OA 4KQKA 5KVVA 3LC0A 2JAQA 4MWEA 4WH0A 1TEZA 3ZWWA 3ZY3A 1JT2A 2YFQA 3IC5A 4X7MA 5AKXA 5FTJA 1TMKA 4NU5A 4MWCA 2IZZA 1QP8A 2M9MA 4RZ2A 4EP1A 1MTOA 4YRFA 4DLWA 1IOLA 5K0LA 3ZWCA 1NX6A 1UXKA 3TF5A 3L41A 1QHHA 4CI0B 1XLTA 5BWCA 4NNPA 4U39A 4Y6PA 4EPRA 1JJIA 3GL9A 5JZBA 5KTOA 2ZZMA 4D4GA 5K6AC 1XQXA 2AB0A 5AW9A 5L45A 1QU5A 3UMCA 1NJ1A 1Q6ZA 2W6NA 3OFSA 3KTOA 5LOVA 4NYIR 1L5FA 3BOSA 4C01A 4DXHA 4ONEA 2CVFA 2QBYA 1DVRA 1JFRA 4GI5A 4GXQA 3VTKA 2IPLA 3VH2A 4DLBA 1OC4A 2G77B 1MO3A 4MA0A 4CFZA 1DAOA 1ND6A 1TJYA 1XMJA 5C1IA 2E5LB 5IZCA 4YAEA 4PYKA 3WMRA 1X9HA 2XNDD 1P1CA 1FW8A 5CNIA 3ORFA 9LDBA 5KUTA 1Z8FA 3G23A 3HPRA 4F9EA 3AEKB 2IDJA 4XZ3A 4V0RA 2NYVA 1GM5A 2FLVA 1JPNA 4RK4A 4MCIA 2EG9A 4I8IA 3R3ZA 2KMLA 4LZAA 4BNHA 4D0RA 3DDOA 1W2GA 3MUFA 2KB0A 4A0EA 3GGDA 1UZUA 4E5KA 4F5EA 5JH7F 2D5AA 1SKBA 3ZW7A 4CGYA 4R31A 2EZ9A 4M49A 4DMCA 2YJGA 3I76A 2IITA 5HPYB 1RW4A 1WIWA 3FHLA 3GUUA 4HJRA 5IXYA 4IRXA 1KO8A 1DKLA 1UQRA 3NCTA 3RLIA 4W1SA 4GPZA 3ZLBA 3W8RA 4AO7A 1Z0ZA 3GZNB 1W2WB 4IYRA 3ZE0B 4OJKA 3PITA 3C6KA 1ZK3A 2C2HA 4IBOA 4JT8A 2Y68A 4OM8A 1FVOA 5A62A 3FCAA 4URXR 521PA 4ZZ3A 4FILA 3GRCA 4DMLA 2RB4A 5HKKD 4AN1A 1RWBA 1ZRNA 3KKPA 3N07A 5TF0A 2C1ZA 3VNRA 5C2JB 3PJRA 5K9ZA 2CNNA 3U3XA 1WSDA 2PWYA 4ILKA 2UVQA 1ZMRA 2JAUA 1NC1A 1R88A 1FDIA 1OV6A 4C9BA 1JXOA 3RSOA 1XJ0A 1RAAA 2WHEA 3CA8A 1NF3A 3JAKB 3DE3X 3K96A 3LLVA 4NCNA 3VPSA 1NP7A 1TT5A 1UBOS 2VBFA 3G79A 3KUUA 4UCFA 5E9WA 4PSAA 4UNPA 4U7TB 2R5FA 5SY6A 3ZHZA 3Q8LA 1XZFA 2PUEA 1JNYA 2IE0A 3OC0A 2OCAA 1GUFA 4MVJD 1E0KA 1T6XA 3O73A 5GGYA 3PLNA 4HRVA 3M4JA 5F5XA 3WWEA 5A2QA 2WUEA 5A5EA 4DWOA 1XJWA 3CZ5A 4RLHA 1N5LA 1YHNA 1Z5OA 5EKUA 5A9RA 1IUKA 1PEYA 3HE3A 2D0PB 3JX9A 2GHIA 3QTBA 1QH1B 3T0IA 1II0A 2R0QC 3MC1A 3LHIA 3ETLA 5DK6A 1GUZA 5BSTA 2G9ZA 1IE3A 4Z8YA 2C88A 2Q6LA 4IXTA 4EYOA 4YRBA 1Z5NA 2JH9A 3A31A 3MIZA 3VI4B 4C78A 1FZQA 3OIYA 4S1NA 1IWOA 1M34E 1WM1A 4M2LA 3LRTA 2FZVA 2O2XA 2O9JA 1E1MA 2XTNA 1UR5A 2RHTA 2MWMA 4FDVA 2CBGA 3WNQA 5HUJA 3F71A 4I66A 1ENYA 1GV0A 2J08A 2VF8A 4QO8A 3V34A 2IW3A 1R50A 1X80A 4CV0A 2BZSA 4CLHA 5MGNA 2PBLA 3KEGA 3P97A 4G0VA 3R3UA 3IP5A 4OMUA 4ZVSA 3IDOA 3IE2A 3ML1A 1FDSA 1B7GO 2OFOA 1WW2A 4WHMA 4CR7A 1N4AA 3U7GA 1Z39A 1DS6A 2H2GA 1ZJWA 5AJXA 1YB7A 1HETA 4NIMA 1TCBA 2QN7A 3LWZA 8ADHA 1JB1A 4KV7A 1WZCA 4XX1A 3UMSA 4LE2A 4R2LA 1UDRA 3DZKA 4HS4A 2HSEA 1QTNA 1LNQA 2FPGA 3MB8A 4GIBA 4Y2GA 1BXZA 1U3DA 1PQYA 3PT5A 4M86A 1TI7A 3CNEA 3EXAA 1GLVA 4BIMA 2O1XA 4IIJA 5EHZA 3C6XA 4LTMA 4V38A 2VCYA 3BWYA 1CIPA 2RONA 4ZCIA 1U3CA 2OILA 3DLBA 1JR6A 1IEXA 4FGJA 2WTUA 1E3WA 1NF2A 1U0NA 3D6TB 2HQ1A 4JOCA 4U8HA 4COOA 2AG5A 1BGWA 1HNXB 4BAGA 3Q9UA 3TVDA 3SZLA 4OATA 3EGOA 3E82A 2WWFA 3BICA 4U9UA 5KVAA 4WBNB 3MS2A 1CV2A 3BMQA 4X8LA 3CSSA 5K0SA 2ETXA 1GUBA 3D5QA 3G2HA 1YCDA 4YQFA 2QTTA 3T4PA 2PTGA 1YHYA 3ZQ6A 3RAEC 1KAGA 2O5EA 2XDYA 3KD2A 4XCXA 2WLTA 5JFGA 2YOGA 1BHQ1 1E2QA 1CRLA 4YYZA 1C29B 4MQ4A 2I34A 1XKTA 2QE7A 3QXGA 3TW0A 3V1MA 4OA5A 3ROEA 4ALNA 2IXEA 3MDBA 2E21A 3DAYA 2PKXA 3IIIA 2X5XA 1EFVB 2XUHA 1JNXX 2E6UX 3HO1A 1BDHA 1PUXA 2DWPA 4A8JC 1NMYA 4HTAA 4C2BA 2ZAYA 1NSYA 4AZ0A 4NZMA 2AOXA 2GF0A 3NTUA 4X1OA 1PJ3A 2UUPA 3G2JA 1PBNA 4I50B 4NBUA 3VR4A 4AMYA 2FEXA 1UBLS 1HSOA 1V11A 5IJXA 4FXOA 4TUYA 3H5VA 5E3JA 4ZEOA 4LRXA 3DOHA 4XGRA 2HA0A 2PVPA 4CVNA 5IG2A 3PKIA 5CDSA 4M36A 2VYND 4DS3A 1OQAA 1GA6A 1QONA 2QTBA 1D9ZA 1Y9EA 1OVGA 4P3OA 5TMPA 3QE3A 3A4LA 4GMDA 4DDUA 1TAUA 1P2BA 4HADA 4Y6LA 4DA8A 1F06A 5LYJF 4KW7A 3W90A 5CD1A 3JQ9C 1QBGA 1K0FA 2RGXA 2ECFA 1J07A 2VYNA 1RDFA 2OG2A 3FFTA 4O59O 1A4RA 1D2MA 2AR7A 2VDKB 3K4HA 1LQUA 4HDRA 4BRSA 3PHGA 1F7VA 3M4NA 1RJFA 2BCEA 4BLTA 3DVSX 4QARA 2JKYA 2OHIA 1MX5A 2WTEA 4WLNA 2UVPA 3EW9A 3OZRA 4FHEA 5DNUA 4DCGA 4QKQA 4DJDC 3AERB 1I7SB 1I2AA 3LTNC 3K05A 3UYLA 5CVJA 4XTRA 2NG1A 1D8TA 4IFTA 4MHOA 4IDDA 2XB8A 4TLAA 2PGXA 3ZDZB 1V1JA 1O97C 1B8NA 3M83A 4NY1A 1RPJA 4OSEA 2HJWA 4OOFA 1PJ8A 3EMBA 3JPYA 3O93A 2FUCA 4AW9A 4BKUA 4HLCA 1WMAA 1XEFA 2ZUVA 3NTXA 1QGUB 4UJ3A 1Q6YA 2RH4A 4MR8A 2JCXA 3JQBC 3R5SA 1EVQA 2QP3A 2BDEA 1LU9A 1BE6A 1WB6A 2HGSA 5CX1B 4EVSA 4Z7OB 2TSYB 3I9KA 4NATA 1YUBA 4HD8A 4GOND 3IVMA 2WZDA 2WW8A 4QOGA 3W5IA 5FBWB 1JQJC 5E6UB 3X0DA 1LTQA 1QHEA 5BW4A 4I0WB 3AVXA 5CP8A 4F7WA 1PS8A 3GCWA 5FWYB 4YGYA 1I8TA 4NE9A 1GRVA 2CLFB 2XMRA 3A6GA 5AUQA 3ET4A 4PANA 1M1NA 2DWQA 3M5CA 2DFKB 1DC8A 5HIMA 4JJIA 3RWBA 4BX3A 4PZZA 4ZVTA 2VTBB 4BOYA 5TPWB 1VC2A 5FHQA 1NMSA 3DSHA 1WF3A 5MGBA 4KFSA 3EGXB 1CY0A 1KYWA 3IJ5A 1HE5A 3TL2A 4FEAA 1NZDA 1THGA 3BWMA 1RWPA 3EA4A 1RVV1 1VMKA 3W5VA 1U0FA 4GXTA 2IBTA 1J4KA 3S1AB 3I04M 1YTLA 5LU9A 4GGOA 3WB9A 4HGYA 1VXOA 3DMYA 1PTJA 3HCAA 3D0KA 4MUKA 3TRFA 2JPEA 2C57A 3ZNPA 2ODTX 2EH0A 2VP0A 1B3RA 5ECWA 2JBWA 2EFYA 4YH1A 2OAEA 2RGNA 2JKDA 2E49A 1G8PA 2G1KA 3BN3A 3IT3A 4HK4A 5LKAA 5J23A 3GLGE 2G1LA 2DBQA 2A35A 1H9CA 1QV7A 4WKNA 1UWKA 1CJBA 2FSPA 1F5SA 1XCBA 2QVBA 2O7QA 2GUGA 3D6UA 2PV0A 2PRZA 2WB2A 2JIRA 2UYQA 4GQIA 1ZXBA 2WJIA 4H1VA 3GRPA 4MUEA 5F64A 3MAGA 3L43A 3P9QA 3CZ4A 3H6GA 3OJEA 3RC1A 1Z62A 2C7OA 1NNEA 1PN3A 4YGXB 2Z9DA 3SD7A 1ESNA 2W6IA 3AC0A 2NV6A 1F2TB 3RYIB 4CT4B 3ABIA 2EOAA 2HNAA 1F9AA 4JOSA 3THWA 4Y2PA 3T3EA 3JAWB 4I6GA 1KC3A 1OYVA 1FUYB 1SBZA 3F97A 4BMPB 4BVAA 3E84A 4B35A 2VUIB 3FSRA 3MUNA 3RYCA 2WSIA 3IP6A 4WESA 5JTTA 5HCNA 4G3XA 1FS4A 1HY3A 3UJHA 2NZYA 1D8AA 1PQWA 3VXKA 3WGGA 2K7FA 3I8OA 3TOZA 4H18A 4RVDA 4JI2B 1ZIOA 1OKKD 2HQBA 1Z5WA 1ZG3A 2PUHA 4O4LB 4X84A 1BA2A 3FMFA 3MBIA 3D7LA 1M5TA 5JEDA 2PZMA 3OOEA 3VR3A 1X7WB 1X9GA 4ASUD 4N7JA 1LSUA 3KTAB 1ZVKA 2F3SA 1U8YA 3IP8A 3VGJA 2D3WA 2FWPA 1P3JA 5DMHA 1T5TA 2D1YA 3RUIA 1MPTA 3THRA 3S81A 1X74A 1F4VA 1VBKA 4EG7A 3ZLVA 1T1JA 4LNAA 4BLWA 2N42A 3GJZA 3RNLA 3L5KA 3DD1A 4ACAA 2ZTMA 2WJ6A 2VF4X 3UNXA 4KLNA 3FYHA 4LJ4A 1OLUA 4KR0A 4V1CA 1DXQA 5JTUA 2VUSA 3S99A 4QTYA 1SBYA 3NBKA 4OXYA 4KNYA 2GRAA 3FSGD 3A9UA 2XVAA 6REQB 1VKHA 1KDOA 4X1IB 5JXHA 2YVUA 2CXRA 3RS7A 5T6BA 4C76A 1N33B 4WNYA 1NUAA 3EFOB 3SXUB 3DMTA 4KO8A 3R6GA 1USKA 2PRSA 2VUHB 2FPPB 2PL5A 3JYNA 3Q9LA 2PZKA 3FSGA 3FYTA 2QPTA 1JQBA 3H5RA 1EDZA 4UVEA 1DQNA 2BFAA 1Q57A 2VSNA 4YPOA 3RARA 5CITA 2JLXA 1UXOA 4WEOA 4U8GA 1W1UA 1NF9A 3TKYA 2CKDA 2BEKA 2FA9A 1LLQA 3HCWA 1BGVA 2AL7A 4JONA 2VPXA 3DNMA 1P5ZB 1SCUA 2YBEA 4OXKA 3K9FC 4ZT5A 4O1MA 4ZOQI 1MA0A 5ENDA 3KSUA 1J7KA 3MSCA 2NXCA 3OTHA 4FUQA 4XM0A 4EQZA 1L5HB 1WWKA 1IRXA 4M1SA 5DSZA 4BBZA 4K28A 2H9IA 5AKIA 2GXQA 4U7WA 2CMDA 2CYAA 5ITSA 1NQWA 4TX1A 3PNVA 2G36A 2Q9BA 3PNYA 1YZLA 2L69A 3VDRA 2PS1A 1QYXA 1V6CA 2FK8A 3FOWA 3QJGA 4NBRA 2H5LA 2PL9A 2QMYA 3BRWD 1C7IA 3CTPA 1YE8A 2AD5A 3P2EA 4GX2A 4IVQA 1ZLYA 4X44A 3UWDA 3RU7A 4AG3A 4HLQB 3CLUD 3IELA 4HI0E 4IO0A 1OXTA 3ND6A 1CY1A 1IATA 1RM5A 5CNKA 2CD7A 3UMBA 2ZZNA 3DV9A 2ZVQX 1ZGGA 4LBYA 3W6UA 1DIAA 1NKSA 3FSEA 5CDUA 2XRZA 1FUEA 3GC6A 1AN9A 2B82A 2X8JB 3O7MA 2ZJ3A 5DCUA 4BQFA 5KU1A 1ZEMA 1E5XA 1OFIA 1BS2A 3QI7A 2E3JA 5KDOA 4FN4A 2F64A 4IS2A 3OOWA 2V7VA 3T7KA 1F2DA 2BE9A 1FK8A 4FNOA 5AHXA 4N18A 4K8RB 4AIIA 1OH5A 4PQRA 3T9AA 4B6FA 5A5DA 1LZKA 2VTDA 2WQ6A 2JIZA 4PHFA 5DNDA 4R0VA 3Q8XB 4GVPA 5FPQA 2FF7A 1HBJA 3HZOA 1YQQA 5AJTA 1Q15A 1LKZA 2JLAA 1W4RA 3W6OA 1XNRB 2RH8A 2VH2A 4D9HA 2H7YA 4MKRA 5M34A 4KQJA 1R0LA 3VU9A 1LSSA 1YBAA 2W2QA 5AJWA 2RBEA 4JLWA 1U81A 1ILEA 1ZR4A 1Z4KA 2X0IA 1ESDA 1E2EA 2YYZA 2YY6A 2HHLA 3CONA 3P9NA 3RAJA 3RTEA 4CZ2A 2RG7A 1CB7A 2C78A 4UHJA 1TXGA 2GM5A 2FXIA 2V0GA 1DRWA 1YRWA 2VNAA 4MGEA 4ZVVA 1RAFA 3O1JC 3GMIA 4YHHB 1U6JA 5EJ7A 1YRAA 4CEIB 1V1MA 3E5NA 2MSWA 4BQQA 4D3SA 1HRKA 1WDMA 2ZEJA 2CVHA 3HXTA 4F8JA 4J1TC 2VOEA 2ZB2A 4YLGA 5CAEB 3ZZTA 4B4VA 2JJMA 1K88A 2R4UA 3BHIA 2HCJB 2RK6A 3ORSA 4JA2A 4NBVA 1NDHA 4D57A 2WIFA 4Z4IA 4BNJA 2RH9B 1CQIB 2OCXA 3HCBA 3ENQA 2PCJA 1JKFA 1L4LA 1WULS 1AKRA 3AK4A 2ZSAA 3LC2O 3P9YA 3PFIA 3ONWA 1V9LA 4M0KA 2HYIC 3F5MA 3BSWA 3DZFA 1LJUA 3I9V6 4HZUB 4BB6A 2VIIA 3TW4A 5JW6A 3EIOA 5EPOA 2BT4A 4FYXA 1QO7A 1F48A 3IA2A 1XCJA 3Q6MA 4Z4GA 3DHNA 2Z4RA 4FFSA 2NUTA 4NZNA 3BEOA 4O2BB 3VPCA 1T0JB 5LQJA 1J2JA 2H5JA 5L3SA 1TZBA 3GVIA 3A6KA 4B4UA 2XMPA 4EFNA 4ZYXA 3PPVA 5TEWA 1UKAA 1JF8A 1C7EA 2NU7B 3IUEA 4ZI2A 1QHNA 2XX3A 4NJMA 3DQZA 1EK0A 2QUAA 1L5SA 4YQZA 2G9NA 1LF5A 4LY3A 2PBZA 5HK8A 4NYIQ 1KE1A 1D5CA 4G8CA 5JAMA 2AZXA 4ZD6A 3ICEA 4OYYA 4PG6A 1DIGA 2B37A 1Z2DA 1YKGA 3BXHA 5BORA 4BLSA 4KXNA 1KQFA 2C5GA 3E22A 1LPMA 3VU1A 1AS3A 5K0EA 3HWWA 4X1YA 4CU5A 2VJAA 1A8PA 1J1UA 1CX9B 1UJBA 3ITNA 1U2EA 1VECA 4BNTA 3M3PA 4TZ6A 3ZHCA 4RVOA 3HJCA 1L7EA 4M0MA 1RRMA 5KNCH 1BIFA 3L7CA 5EMJA 2CDAA 3C5HA 3I0MA 4LDZA 4BXOB 2WFLA 4KOEC 3LPLA 3KSMA 4FGWA 1ONNA 2B98A 3KXKA 3PXDA 4MB6A 4YROA 5TF4A 1TF7A 2VXOA 3OLZA 1AQLA 1YAJA 2I3DA 3ZXUB 4X66B 2TS1A 4F3TA 4Y1RA 4ZWNA 1NPDA 4M89A 4D99A 3GJTA 4H0FA 3DFZA 1X7ZB 3ZD9A 4LFAB 1KJJA 3OJOA 4A15A 4V0MA 1CDEA 4XUDA 1VRCA 2PGAA 4MI6A 4B73A 1ARZA 3QYFA 4Y2JA 5BOSA 3ZE1B 1DFIA 2B9VA 4G85A 2ODAA 5KYXB 5FWAA 1I5EA 2W83A 2GCOB 3HLTA 3AF2A 3NHSA 1W4CA 4QTXA 1AM4D 5KYWA 4S05A 4CTJA 3L2OB 1NI4A 2OEPA 4PWZA 4TQUS 1LRJA 4ND8B 4Q4HA 4B3IA 1DWOA 2JH8A 3AHHA 4JI3B 4WL0A 4B3FX 5JDIC 3VR2A 3AJEA 3O3NB 2ZIFA 1G5TA 2BEUB 5AICA 4QXRA 1P45A 3DO8A 1KJYA 3L6EA 2O8DB 3BHNA 2HIMA 5BSUA 2AA3A 2XMQA 1G6OA 2C2GA 2ZGVA 4POOA 9ABPA 3IHTA 4O4HB 4DZRA 1VHDA 4XDHA 1OTYA 2GYYA 3TGPA 1JPJA 4DMHA 3LTEA 5L7WA 2D6FA 1KKMA 1XXHE 4IS3A 3TJMA 2HLDD 2KLBA 5KJEA 3HRIA 4GSYA 4CM4B 1JS1X 4J07A 3V1LA 1K66A 3ZDQA 5E9AA 1PL8A 2IHUA 2JI6A 3KWFA 1IDN1 1NA5A 3FTPA 5AKYA 4EGQA 5AW4A 4K46A 1LA2A 2ZS7A 5TPZD 4L16A 4W82A 2RHRA 3LXUX 5I7SA 1POWA 3I2IA 2AYZA 4EKIA 4AKIA 3LAWA 2OZLB 1ZX1A 3UT5A 3NUZA 4Q21A 5A06A 1I9GA 5BXQC 3UPTA 2ZJ6A 5TPZA 5CM9C 1MIOB 3U9TA 4CR8A 4Z99A 2RC6A 1V3TA 5BW8A 1N6HA 1Y6FA 1JHRA 4OK5A 3CNNA 1YOBA 2DXIA 1UFQA 5G0SA 1XDDA 5T8KC 3C5VA 2ZI6A 3ABZA 4QQ8A 1NMXA 3SGLA 1ZDMA 3D31A 1WETA 5JJBA 1MB9A 3MTEA 1E98A 1SC4A 2QVXX 4B85A 2Q21A 3CEHA 2Q6OA 4MI1A 1EDBA 3FPBA 2FOXA 4HAVA 2XJ4A 4OH7A 3KQPA 4WCDA 1YIAA 4WUTA 3VDNB 2YJ4A 3ZWBA 5C8XA 1K1EA 2XWQA 3DCIA 1JW9B 2O07A 1R5BA 1MJ5A 3GO4A 4IH1A 5A7HA 3QA9A 2GX6A 3A9CA 3EG9A 4C7BA 1ATIA 2WU8A 3M9XA 4M1OA 4BTVA 5I51A 2DP4E 3KJIA 2HT1A 4WN9B 3WMXA 2O14A 3VV3A 5IJ9A 5ECGC 2V8BA 1SUPA 1F8YA 4XB2A 5CR9A 2QNRA 5IMBA 4EI8A 2FWMX 3IUMA 3ELUA 3WBFA 4BRUA 4PZEA 3ZHOA 1PTKA 1Q17A 1QRRA 4FR2A 3SBEA 3WGNA 2Q45A 3ORHA 1UWVA 4MJLA 1G0NA 5HIIA 3I45A 1SCKA 4CFSA 2M6LA 1AHNA 4K6GA 4JP3A 4ON9A 5FOUA 5LB4A 4JDPA 1TUEA 1Z5ZA 1R4AA 4EJSA 5FUQA 3SJ7A 4TT3A 2CSXA 3OU7A 1P81A 2PX8A 3HVKA 3L0SA 1FDTA 1F3LA 2XUZA 3O8BA 3T0GA 2ZT6A 1KYTA 4BZWA 3T3OA 1AS2A 3U3OA 3QX9A 2FX2A 3HDHA 4JUIA 1H1DA 2F8LA 3F6SA 3LKBA 2VHVA 4BAUA 3HP4A 1KAEA 3SQMA 1G21B 2JIOA 3O92A 1R0SA 2OV2A 2A0XA 3L1UA 3UHAA 2ZJOA 3HYLA 5DOZA 1T35A 5EZYA 4DR7B 1UL1X 2SKCA 1LX7A 3PRJA 4RSRA 4RFSB 3IB3A 1P0MA 3CPEA 4R40A 3IMFA 3AEUA 1JVSA 1TZMA 3KB2A 4WY2A 2YUIA 3SLGA 3UENA 5C8DA 3D6AA 3G2KA 3S44A 3CUSA 3IMGA 2VPPA 3ZQUA 4HH4A 5HE9A 5IC5A 3QPCA 4TZ0A 4OQQA 2FGJA 3MINA 3PT9A 2G5GX 2YVQA 2QV7A 1UBUS 1WAMA 3ETCA 1KZHA 2KS6A 4BECA 2GBCA 3HKBB 2Z9BA 4D0LB 4JJAA 3GVCA 1D7AA 3C98A 3FTNA 2WABA 3PUKA 1KO1A 3A6FA 1VSVA 4LZOA 3ZWAA 5GIOE 1T1SA 1X15A 4WI1A 5GJBA 3WJ2A 2WMYA 3U81A 2CMGA 2JK0A 3BMCB 1G8GA 1X42A 2M6SA 4HMOA 5TQ2A 3R7NA 4F6CA 3UK1A 1AZLA 1C0LA 3OECA 3A4VA 2QDKA 3LWBA 4HDNA 3OQMA 3GAMA 4MKGA 1YCGA 2Z98A 1LZLA 4HGNA 1NI3A 1O6FA 3SZ3A 1MZPA 2BHTA 4KH1A 4NK5A 3TLYA 5JUWA 3OFVA 1Y98A 1Z0FA 3CKLA 2NQ2C 2UKDA 4LAFA 5AKEA 5CCBA 1CLEA 3LT5A 1Q84A 3NO4A 4GBED 4LQCA 1ZJ6A 4UEQA 3PNPA 4GXNA 1QIFA 3PPXA 3W79A 4CQMD 5B12A 3NIWA 2BH9A 2PD3A 4DARA 2A4MA 3BE6A 1RXSA 5BR1A 3WK5A 1WL8A 1HZJA 2YQ4A 4PGHA 2VAXA 4MITA 3PGA1 2PBRA 1MLDA 4TMYA 1IMOA 5E0KB 3OO1A 4DBZA 2H3EA 5HCIA 1U6KA 2CFRA 3N28A 4AIRA 3O6VA 1JG4A 4K1XA 4Q5IA 1RHUA 5DLQC 2FPRA 5F35A 4EA9A 2R2GA 2ADOA 1W6UA 2VN8A 1ZRHA 4D4LA 1YJBA 5SY9A 4PLZA 5BT8A 3OQVA 2CNBA 3MAJA 4DNPA 1KEEA 1LS6A 2HN9A 2XDWA 4HP8A 5CNJA 4EBFA 4EMBA 5CMLA 1T8YA 3UNMA 3ICWA 3O4HA 3FMGA 4PC1A 4W5RA 2VA9A 3H7AA 3E9ZA 4OP2A 1UKYA 3OZBA 1WXFA 2I7VA 4OLFA 1MJGA 4UUPA 3CO5A 2G7ZA 3NKLA 1GPUA 2H2DA 1CUIA 2P7HA 4IHAA 4GVLA 2UZ1B 1S4MA 1R1DA 4PQGA 5GM2A 2A7XA 4OCZA 3RS0A 1NJSA 4YCCA 4PCUA 4XWAA 1ODCA 1C4KA 1I01A 2AVNA 1PG5A 1X3LA 3OX4A 1NBOA 3PJDA 2GK4A 1U1FA 4RETA 1SB8A 2G9RA 3T7JA 1YC2A 3PX2A 3B7WA 4KQ2A 4OJQA 4YO7A 3W0LB 3ODGA 4A0QA 1PJRA 5KNLA 4DJFC 3RSQA 4NG5A 2JGKA 1BE0A 3U9LA 3EGDB 2DPHA 3H11B 3MWDB 1SC3A 2CSWA 1FJHA 2IYXA 2NU6A 3BE4A 4JBXA 4V0NA 1K75A 2C9BA 4GQBA 4E2FA 4Q0MA 3F1LA 2OXEA 4RA9A 1ZICA 3HKCA 2CNLA 1K4KA 1XT6A 2FSVA 4O4JB 3SMQA 4EI7A 3EVEA 1GVHA 3RB8A 3GK3A 2AK3A 4M9XA 2QZ4A 3QJ5A 2GUWA 2X9LA 3R44A 4CHTA 5C7IO 3I6MA 3MAAC 3S7TA 1XTRA 4PNPA 3OT5A 1TO6A 4RE6A 1K3TA 2B7LA 5TS2A 3ZE8A 5A03A 4IOLA 4TTIA 4ZV9A 4BLVA 1T2DA 4MOWA 4N40A 5C8YA 1G8YA 3BWCA 3DKVA 3E8XA 1GTRA 2F8TA 3MRVA 2O6HA 3ISVA 1E59A 3OE7D 3WKAA 2R97A 3AMVA 4TMKA 4R9VA 5CT4A 1HOXA 1BFKA 3HUDA 1M2FA 3FJOA 1YJAA 3AIMA 3OJ0A 3PCTA 4KX3A 5DCYA 4D56A 3GQBA 1LV7A 1Z47A 1J2RA 2PIDA 2ZTUA 1PD0A 4PC6A 4Z7JA 3OTWA 3REFA 3HHPA 1O8CA 2OCLA 1JRLA 1OBVA 5EHXA 2NW6A 2ZAIA 4EF6A 3KOZA 1MG5A 2M6KA 4YB8A 4B3DA 3KM0A 1RC8A 4PO8A 4ZREA 4TXJA 1X2EA 5I3ZA 1SU4A 2OP1A 5DMXA 4OGLA 2OK7A 4DL9A 5CT5A 5L3RA 4F1KA 3NDRA 3FTEA 1UZAA 2V54A 4JNKA 1XD2B 4NFYA 2DRIA 4GL4A 1U3TA 4JEMA 5L7YA 4EEXA 3NHAA 4M9SA 4S04A 1Y6QA 4Y2XA 5E7QA 5JCOC 1N3LA 2KQUA 5DSXA 3UY4A 1KFCB 2GBLA 4L8VA 4EARA 2F8SA 5JDCC 4B40A 1L4BA 2IOHA 2RHBA 2FKAA 2XV1A 4JJ6A 2NPFA 4DADA 5C1OA 3X1JA 1PWYE 3HVJA 1KFJB 2MOKA 3MJHA 2AKEA 1IHYA 3LCRA 4PLFA 3DULA 3MNFA 1QG4A 4UEKA 3W4JA 3CUYA 5LPNA 3EBLA 3IMKA 4O5AA 5IHXA 1ZVVA 4LMAA 4E5YA 1V5FA 2LP4Y 1WR8A 5AW5A 1MO5A 2W6CX 5JADA 3TB6A 3TX6A 2K6GA 2JAXA 4WWHA 1H2YA 1EFTA 2QX8A 3A4MA 4FZRA 1K4MA 2C31A 1P7CA 1DJPA 2I2WA 3HXKA 1QK4A 2YHUA 4PZUA 5B30A 1PJCA 1O1YA 4WZBA 3WB1A 1DNPA 2G71A 2IZ0A 4HAZA 4ZAVA 5LA6B 1AB5A 1FL9A 2F48A 2XD9A 4G56A 4NV0A 3TLKA 4BL5A 4BMDA 1J2EA 5K8CA 3EVTA 3IPLA 1SQ6A 1LDNA 2I87A 3K09C 3PB3A 4I2NA 4TZKA 3HCPA 3GQVA 4PHHA 4RY2A 4I4TF 4OAOA 1DBSA 1SM4A 4IRUB 1IBCA 4NKRA 5ALKA 4C3UA 2CLLB 1SC6A 1J8DA 1ZSYA 4ZC1A 5H0IA 3G9XA 1W34A 4UPEA 5HFAA 5J2TF 2P6NA 1YRYE 3DONA 4QPCA 3HGTA 4F5YA 2QD5A 5IT4A 3V3KA 4BS9A 2JGIA 2R11A 2VTVA 1MQSA 3FWYA 4IJWA 4NAHA 5EPUA 3HBMA 4JLKA 1BN7A 3BD6A 4NV1A 3ZW8A 2ZM6B 4PBTA 1P1IA 5LM3A 4B7CA 2ZB3A 4C6RA 1I4EB 2PKEA 1MC5A 4FZVA 3S7ZA 2FV8A 4DUGD 3HFRA 4B6GA 5KREA 4JQCA 3K1AA 4FD2A 1PNRA 3CLRD 1NBAA 2WHPB 3H18A 4K9KA 2XMGA 1FMJA 2PH5A 1KPHA 5DBOA 3VI3B 1YK0A 3NM6B 3GN1A 2IU0A 3VKVA 3AI2A 1WHTA 2TYSB 4NU8X 4C4AA 3DJYA 1DMRA 4Q4JA 3WWPA 4PR3A 2Z6AA 2YYSA 4FDUA 3N70A 1N5RA 2H2WA 2JK1A 3GLUA 3L79A 3STVA 1P74A 1QYCA 3ROQA 4AJ1A 2V6JA 1ZMOA 4INZA 1VFNA 3BMOA 1Z26A 1VMIA 1TAHA 1H0RA 2IDZA 3BWXA 4UU1A 4Y6QA 5GIPE 5TY0A 3E53A 4EMSA 3GXBA 3AW8A 1TCUA 3GJ5A 1I5RA 4FZ3A 2Q5OA 5KNDH 5G0WA 2VJDA 2XA9A 4MA5A 2Q7DA 4HX2A 4MB0A 1ZAKA 4EO9A 5FLKA 3OE5A 4IO1A 2ODWA 4MPPA 1WXGA 5F9MA 5IN4A 3LX8A 5KSOA 2YXNA 4RA6A 5MN6A 4KVAA 5K1ZA 1W85B 4GP9A 3V6MA 2QL5A 5T64A 1IUOA 3I6IA 3HVRA 1Y5LA 1Z6AA 1Z0JA 2EX0A 3BWBA 3Q2OA 1MO6A 2CNKA 3K0BA 5TVKA 2JA1A 5KX5F 4F4DA 4J7CA 4LFBB 1Y6ZA 4M7WA 3L1VA 5KTNA 1RI4A 2W4MA 2GFQA 4GI2A 4YMGA 1SXHA 4ZYYA 2YZMA 3JD4A 3ECSA 4B6QA 4OLHA 1O96A 2J5RA 1CUJA 1TJ5A 1XDZA 4FOTA 4HGRA 3ADBA 3CLVA 4A2CA 2PH1A 4BVFA 4PINA 3IEXA 4MUNA 4DG8A 3GD7A 3ZJ5A 4NFLA 1Y9ZA 2P4SA 3ZOKA 2B61A 4NK4A 2KI5A 2KX7A 2QROA 4RWZA 5FUXA 1D1QA 4AZ3B 5JS6A 4FFLA 1V1RB 1YS2X 4KG7A 1ISHA 1MORA 1NT4A 2OUIA 4L72A 2BKVA 1X86B 4PYQA 2ID8A 1UT8A 4I5DA 2NTYC 2HTFA 1DV1A 3RVRA 4DANA 4O4IF 2PGJA 2A94A 4KNWA 3ZPXA 1RQGA 3W78A 1VYVA 1I0LA 2FSSA 3VHXA 3F7NA 5LBTA 3WL5A 4HNAA 1XF9A 5H81A 1MW9X 2OV1A 2EDCA 1FA9A 1L7PA 2R8PA 3RFCA 3ZK8A 4FYWA 1NBHA 2J5KA 1Q83A 3EG5A 1R6BX 4JQSA 1KOGA 1GLGA 2B0JA 3HH8A 3BDAA 2E1PA 1V25A 4URWR 4C0XA 3DMGA 1IG0A 4EAAA 3QY9A 4P6VF 1D1TA 2OV4A 1OFUX 3MGBA 4QTTB 4BMCA 1LC3A 3C1UA 4W6QA 4R51A 3L0DA 1XTZA 1GPKA 2OOSA 4TKMA 3KUDA 4AQ7A 2CLSA 3ZCTA 3WIOA 3NIDB 1SKQA 1AGYA 1OH6A 2XB2A 1EIZA 1SKUA 2H07A 1A2BA 4UCQA 4YRMA 4QA9A 4OTZA 4EQ6A 1C8BA 3SZOA 3TRKA 3ASVA 4EA8A 2A58A 3G7SA 4HV4A 1RRGA 1T1GA 4EEZA 2HR1A 2Q5CA 3KK0A 1UEXC 2XF2A 2NSJA 2IXAA 1FVFA 3GYGA 4GO1A 4MW4A 4Q1EA 3OQOA 1YDMA 2Z8YM 3TPFA 2CB9A 3CKKA 4FFRA 5DX1A 3ZHYA 3QLJA 3CX8A 5IBQA 3UWOA 3TCXB 4DIDA 2VYFA 5C3MA 3ESYA 1KJ9A 4I46A 3B82A 1BEUB 3PUWA 3D8BA 4ITVA 5EC8A 2OORC 3HJGA 3LW8A 2I6XA 1P0IA 5ALNA 3SEQA 3W7BA 1YDGA 3QU4A 2HREA 4NONA 4CETA 1O95C 1RLMA 2J3JA 4XR9A 4IRMA 4UATA 3WKEA 2VHWA 2A6PA 3CVUA 1CY7A 1IUNA 3D7RA 4X20B 4MICA 3L6UA 2H54A 3WTCA 1MFZA 1QFXA 1TMYA 1ZK2A 1CE8A 2AHOA 5LLDA 2M1XA 2VP5A 1BWRA 3MERA 1GZ3A 1F6DA 1FP7A 2PJZA 1A9XA 2UZ4A 4EITA 3LQYA 4AG5A 2PRKA 1CQPA 3CNQS 4KE9A 3JR7A 2KKLA 1QK3A 3E9NA 4ZHQA 1RXVA 3LU1A 2HW8A 5ELLA 1R15A 2NU8B 4RHXA 2JD0A 5KQLA 1NNSA 3L05A 4CT0A 1OX6A 4Y0AA 3UGTA 4LCEA 5B64A 2QU7A 4LKRA 2ZRAA 1DX6A 2WNHA 3QEAZ 3TQOA 1NVTA 4NDAA 2AFHB 1E60A 1E6KA 1XEXA 4I3GA 4QLAA 1U0LA 4AKSA 5EIFA 1AKTA 2QIPA 4LE0A 4TKZA 1K6EA 1ZU5A 2EAUA 1ZK0A 5EIOA 3HEAA 3ZR4B 5HWSA 2RHCA 4RFLA 4ZVUA 1EK1A 3VAZA 5JVDA 2VP9A 2COEA 1KJQA 4EY8A 3QWFA 1EFPB 1IY9A 1KXZA 1M66A 2HMYB 2P5SA 3R23A 3QQPA 1QRSA 2XCUA 2RGGA 1GARA 4ZC8A 5B7NA 2ZUTA 1RXWA 4RULA 1U8TA 2PLWA 4PQFA 4ZOLB 2YMMA 1TIKA 4MV3A 4H1WA 3BGSA 4U00A 1S2MA 1Q19A 1T4BA 2AI3A 5LJIA 4XUCA 2CFCA 2RCYA 1IEQA 4G5HA 4RGBA 3VH1A 3WYDA 5B2EA 1HTBA 3HU5A 2I62A 3HCRA 3MWKA 1DQPA 1F2UB 4XA8A 4JKOA 4F5ZA 5J63A 3O75A 4U5XA 4D96A 3IIEA 2G0NA 3M6UA 5JRJA 5AVXA 5IKOA 1R0WA 3DOOA 4I5EA 4ANFA 2WPDD 3DT6A 3K6JA 3TSZA 1PDWA 3ETGA 1R4MA 1BNCA 4B44A 3C6ZA 1R6DA 2A5LA 4BATA 2C59A 3K0EA 1VL2A 2WPDA 4IJ5A 4R2XA 4M1ZA 4XD7D 5BQPA 4MPJA 3ANMA 1NW9B 4B2LA 3PD0A 5TIIA 1KK1A 4DUYB 2F43A 1NUTA 5CA0B 1E7RA 1RC1A 3EISA 3DV0A 2FW6A 2ZPUA 3N74A 3GLFB 2A84A 1XZEA 4IXDA 2I54A 3FM9A 1ZHOA 2CD9A 4RJTA 3JRNA 5HRAA 1L5VA 4JLNA 3WGHA 5LOVB 1YRLA 3LK7A 1TFRA 2OT3B 2XUDA 3LT4A 4MVJG 3W7AA 4B4DA 1X7XA 2HJRA 2QRNA 4UNIA 1Z6ZA 1E1DA 3BILA 1NW7A 3JQAA 1O57A 1OW3B 4I36A 3UCXA 2AFIB 3TIGA 5DASA 3RV4A 4OFZA 5BW5A 1G3IA 3UAYA 4UULA 1ZLXA 4DNXA 2IU3A 3JAMA 4DZTA 1VIDA 4NH0A 4DQDA 1Y5RA 2DULA 2KB4A 1Z4QA 3VOSA 4BNKA 2CBXA 3FNHA 1UXHA 1RLTA 1I2MA 2IXFA 4LPKA 5EWMB 3WXMA 4AJJA 2W98A 4IIHA 2EKDA 1N8KA 3F67A 4XDZA 2OZVA 4CG0A 1QU2A 2DQZA 3MMNA 1U2GC 4L51A 4BE7B 4EW2A 2CDBA 5JRDS 1T4CB 3WIDA 1X2BA 4Y2QA 3D6MA 3PNSA 1X7HA 2BP7A 3IESA 5EWJA 1G18A 1C1XB 3ME5A 5KKCA 3HI4A 3BJIC 3I01M 1K3NA 2OYCA 1OWMA 1XHFA 4QDTA 1B74A 4B3CA 2JRLA 3I32A 4C89A 1C3OB 1NVEA 3EVBA 1UEIA 2FWJA 1HL3A 5DT2A 3NFYA 2X0FA 3PUJA 3K0FB 4Y7CA 3B13B 1KI8A 4QEKA 1E79D 4BBJA 4PSVA 3NNSA 3DUFB 2R00C 3HV2A 3U49A 4JFAA 4UBLA 3OO0A 1DEHA 1HE8B 4QNMA 4ZDJA 2XCSB 1JTFA 1XRLA 4X6YA 1J5PA 5CDGA 2W8BA 1JJAA 2XR1A 4MX8A 3G3EA 3CF4G 3R7LA 5E6SB 1BHO1 5ELMA 3WZ2A 2C98A 3ER8A 3CGWA 3B20A 4ZCLA 1OT3A 3DAOA 4AO6A 1MV8A 2IVFA 3A3PA 4KIUA 5K45A 3C7CB 1T3TA 5C34B 2Y92A 3X44A 2BGTA 3GLTA 3IAUA 3AFGA 1Z45A 2FAXA 2ZWPA 4CYMA 3AB3A 1YIOA 3T06B 3C48A 4BO2A 1NW8A 1JSZA 2O19A 1EAMA 2Z57A 2WJ4A 4IV5A 2YMLA 1Z08A 4FX2A 4Q1VA 2HADA 4P1ZA 3WRXA 3ZKWB 4ETMA 2IX9A 3E3AA 3OCYA 4IQ8A 3VBCA 4C04A 5BWBA 1YASA 3VPXA 3KYJB 1C3LA 1KH1A 4ERXA 2JQJA 4FGZA 2OBBA 2VHJA 3WDLA 1X80B 5FF9A 2BEWA 4UHEA 3FDFA 4HH0A 4Q7EA 2X7HA 4UVGA 4D8VA 4F8YA 1U7TA 1RWOA 3IAHA 4Y2RA 3P94A 1KZ4A 4LNHA 1BX0A 1GTZA 2PMWB 4U0JA 1DFHA 3ZYCA 4D79A 1G6Q1 4I55A 4F85A 4EDFA 2PYDA 1FXWF 1PYGA 3ZDCA 1T4GA 2ROQA 2O4CA 3NANA 2ZRMA 4LJ6A 5L4LA 1Y5IA 3X1KA 3INRA 4AJIA 4ZTUB 3Q8MA 2GPNA 1LGQA 1P4SA 1GUAA 1ZIDA 3I64A 3E3MA 4BLUA 5I9IA 4KAXA 4N12A 5ALSA 5KOYA 4WFQA 4NECA 3PDCA 4QU5A 2MYUA 5LIRA 2EZUA 3K72B 1Y6RA 5JNTA 1YCHA 1NQTA 1PX2A 4LQDA 1ULTA 1SC1A 2VQ6A 1T9CA 2FPGB 2IFTA 3VZBA 3EDRA 2H1CA 3QKTA 4N4AA 3RRYA 3BGDA 5IBPA 4OLBA 4Q9NA 4D8XA 1W0JA 2P2YA 2BUBA 2RKBA 1K3FA 2F1HA 4LFCB 4CDNA 4DAEA 3EXEA 4OSPA 3MHTA 4AMVA 5C4VA 4Z9BA 2JEYA 1RQ2A 1E20A 3NYIA 3K2QA 5CFPA 4QUIA 3KSAC 5DWVA 1Y82A 2WMDA 3QJYA 3EC7A 4ZK6A 1A0OA 2Q0HA 4NBSA 2OO5C 4CR6A 2G5PA 3EVFA 1AD2A 1J1ZA 2C2ZA 4X9XA 1SCDA 5AKJA 1G2OA 1ZD1A 1S01A 5FOWA 3UFXB 3JVIA 4WKPA 4B33A 2WBLC 2BH2A 1E3DA 3M9LA 4MGKR 5LYYA 2VQ3A 1DLIA 1ST2A 3GG2A 1ZP6A 5IYZA 3T12A 3OIFA 5BUSA 2N9UA 4RH1A 1OI7A 4WCFB 1JFFB 4K2HA 1BKYA 2C3PA 3WI7A 4GG1A 3HYCA 3TSCA 3DWIA 2G4CA 4E5SA 1B73A 1K8ZB 2IIBA 3CZPA 1C8LA 2VNIA 1PJZA 1T5OA 1ZCAA 2C2KA 4HLUA 4QSMA 4MW0A 4FINA 4FMCF 3CY6A 1ENOA 2AE1A 1A5ZA 2O2HA 3TXXA 1ZQ1A 3CEMA 4J0CA 3HU2A 4LPSA 1A69A 2QUBA 4YJ3A 3CN7A 1T91A 2CLIB 1IHPA 4RIEA 4ZOAA 5ALRA 5F3DA 1TU0A 1NV9A 1L5LA 1SOWA 2IU4A 1JDUA 2Q9AA 2Z43A 3MXTA 4OPMA 1OILA 3T61A 4RPIA 3UJDA 3ZV3A 1LLFA 1R8JA 2QY9A 3NT5A 3T52A 5K3EA 2XUAA 1CDOA 2GA8A 3TLJA 3ETEA 3AVOA 4ZDKA 1EGVB 1U4OA 1T0HB 2V6MA 2Q8PA 3H65A 4KH0A 1C8KA 2IPMA 3RT9A 2QOEA 3TDKA 2GI4A 4JUCA 4OKSA 4RTKA 4OQ4A 2PH3A 1SH7A 1GN9A 3NMUF 1H3NA 1PR6A 1B76A 5ED0A 2HA5A 4YAKA 1UAGA 2ATVA 2PUWA 4BWYA 1EA7A 1JDBB 3E15A 3MTBA 3F6BX 5HRCA 3IOCA 2ZXFA 2IU6A 2UVPB 3QUTA 1PGQA 1SURA 3H13A 1Y5NA 3KKEA 4U2FA 4Y98A 3T9FA 2WF9A 1FRFS 4PRKA 4AKHA 1UBHS 1A9QA 5K3SA 2PLRA 3MHPA 4OAQA 4URHA 1TK3A 2C7GA 3INNA 3OQJA 2AN3A 3M6IA 1USVA 2WA2A 4BX8A 1CTQA 1U8EA 4MHTA 1D9XA 3FRIA 4PAMA 4RF4A 2DERA 3EQ8A 1V5GA 1MVNA 3HXOA 2HO5A 3LL7A 3LO5A 4MR8B 5JO0A 1J8VA 5IVDA 4URZR 1T5LA 3A1WA 3MD9A 4F38A 5FNVA 3R20A 2CV2A 2WHXA 2GEKA 5CT8A 2CKMA 2GN2A 3QPUA 3PQ2A 2W0SA 1E4EA 5F7ZA 5AVWA 4J0EA 1TK9A 4OYRA 3EGWA 4JT2A 2BFBA 4D9BA 1G8MA 4L9SA 4MQUA 5KCMA 4EHNA 1VSUA 1U3WA 1G88A 2ZSJA 1H2XA 4CHGA 3K9HA 3L4KA 3OCZA 1TQ2A 4QQFA 1PT5A 3D59A 5EMKA 3AT1A 3EAGA 3JWEA 4C88A 2PUGA 4KGDA 4A0FA 1M1NB 3AXSA 3DDCA 3HKDA 4NC9A 4PW0A 4XWWA 1XDWA 2C07A 2NNLD 1CUDA 1WZEA 4JYMA 5IT9A 3SJAA 2APJA 3L07A 4J1NA 1DG1G 5IARA 4JU9A 1H2RS 4RIGA 2ZUFA 3CLTD 1C3JA 3RASA 4QLBA 1UDBA 1F1JA 1G16A 2J32A 1N9GB 1I30A 3B70A 2OECA 3KOWA 3PVZA 4JBWA 1C0PA 3KYIB 2IYAA 1HDZA 1SUWA 3CLSD 4E3ZA 3F49S 2XKAA 2EWMA 2AZMA 3UJ7A 4HQOA 5ILOA 2ZRCA 3KBOA 3A10A 1T2AA 4FSXA 4DMMA 3M1YA 2NSYA 1H9AA 1D2AA 4OFXA 5IM4F 1T0PA 1Y9AA 4P5PA 3EIWA 4N6NA 4G4JA 5K8UA 5BR4A 3U80A 3DBVO 3C5WP 2X40A 2XYPA 4YP6A 2GM9A 2E5FA 2OZPA 2Y1GA 1SUSA 3KOOA 2NVUB 2OC9A 1SXPA 1L5NA 3DP7A 2R1UA 4MQ5A 4LX0A 1KVRA 3LUGA 4WK2B 3LUBA 3JQ7B 5FL7A 4DIEA 3MD0A 3K1JA 3TUIC 1GU7A 4N41A 4BCBA 4E15A 1W35A 5EWLA 1G7RA 1J2YA 1H23A 1QWOA 1UIRA 2GN1A 3OLWA 3MWJA 4D8YA 1EGHA 4D81A 4Q12A 1NQVA 2EJBA 3E23A 1D0IA 1DD1A 2A5DA 2XNCA 3UWMA 5K8JB 2O8BA 2VXYA 1ADYA 1M2KA 3V00A 3DEYX 3KKOA 2YOHA 3QKSA 3A2KA 2VL7A 2QTCA 1DRUA 4GM1A 4D9EA 3Q9SA 4DC1A 4IKEA 4RQBA 2QY6A 4E33A 1NHGA 3O8QB 4ZV4A 1T9GS 2D5CA 1VSQA 1HT0A 2C5FA 1CRPA 3L8CA 1DUVG 2GB4A 3DHWC 4XFJA 5GOTA 4GPAA 4RVNA 1EJ6A 1NMQA 3DVRX 3OCXA 4QBKA 3ZCSA 1WV3A 4C4SA 1GKLA 2LBPA 1J5EB 5D00A 1IN5A 1QE5A 3M5PA 3Q2KA 3OM0A 3ZV7A 2SKEA 3PFCA 5HJ7A 3FKSA 3IPCA 3C3MA 3UAWA 3ZD8A 5DJ5A 1XCMA 3BB1A 3AUTA 4R9SA 1OLUB 4V1CB 1EDEA 4ZYTA 2Q3BA 4FCWA 4X7RA 3VBEA 1TZCA 2WFMA 1YKSA 3V2GA 1IZ8A 1HV8A 1VZ3A 2CYCA 1E5TA 1Z16A 4E5UA 2QSZA 1QAQA 1MC8A 4YJ2F 4BPRA 1T9ZA 4UHBA 3TSAA 2FCAA 3BD9A 3G1WA 4KO2S 3EH1A 3M3HA 1DT3A 4JROA 4HB3A 5HZMA 3JVUA 5EXSA 3T3DA 4D41A 2KHZA 1L5KA 3AO0B 1MB2A 3MS7A 1AKEA 1IXSB 1FQJA 3FKQA 4YA6A 1NJ8A 3RE1A 4IHJB 1BXKA 1P29A 2GHRA 5EIBC 3AHIA 1G8FA 2SECE 4IQ4A 3WLQA 2QN6A 2AMVA 3GAZA 1SCUB 3C8DA 4N7MA 3ZHRA 3ERCA 1H42A 3M6AA 3MT8A 4R5HA 3VDXA 1QK5A 2B25A 1NDUA 5B1SA 3UV3A 4DCCA 5HG0A 3SSMA 1R9MA 2IOFA 3PDWA 1RAIA 2RARA 1G20B 4GX5A 2ZBVA 1HLGA 1BKSB 4J0DA 4RPCA 5EKTA 5CB6A 2QTZA 4PX5A 1E1CA 4YRPA 4Q48A 4MGIR 5K2OA 4I9NA 4XUGB 3KEQA 2GPJA 5DFAA 3RRZA 4L75A 3EEFA 5ESDA 4YRNA 1FYEA 2P4HX 5EQFA 2RJOA 3AUAA 4ERNA 6AT1A 3K70C 2ECKA 2OYSA 2QX6A 4J43A 1Y1PA 2JNWA 4Y9TA 2PE5A 1X0XA 1QE3A 2O6LA 3AKYA 5IKPA 2Q3MA 1E1NA 1CVIA 2EP7A 2MSEB 2B4YA 3DXYA 3RTGA 4UBIA 4EW3A 4F3RA 1DZIA 1KMCA 4GP7A 1JQAA 1PF7E 4MV6A 5KKNB 2VKTA 4RENA 4DV3B 3CBQA 2DFLA 4KXXA 5AQ1A 3O74A 5KBYA 2HDNB 4QREA 2BFDA 2F3QA 4CQLA 1SFRA 4CM9D 1M2GA 2FW8A 3B9QA 2MSDB 4MVXA 4YBZA 3CPSA 4EMUA 5IEJA 5G1NA 4UUMA 3RR2A 3K9GA 1PG2A 5U4QA 2HHAA 1DRKA 1TJ4A 4NV3A 4YTEA 2A0YA 4ZT3A 3G02A 3ZIUA 1NMZA 1Y33E 1DDGA 4Z54A 3PJEA 1XVTA 4MYHA 3C3YA 4BQRA 1VCOA 1XP8A 5JZMA 2ATEA 3AI3A 1AGNA 4S1VA 2ACKA 4OQZA 1KAMA 2WFAA 5DHAA 1IBMB 1J24A 1G3MA 2ZUCA 2FEKA 1BJTA 1G8JA 1AXGA 4KGXA 4BWGA 3ROMA 3VNVA 1WHSA 3JALA 1CLUA 1HK7A 1TFUA 2WU1A 4BP8A 4D9CA 5KINB 3W5JA 5IAJA 2VSQA 4R2KA 1FFXA 4DY6A 3SM3A 5IVKA 4L95C 1SVOA 2JLUA 3ZU6A 2QW0X 1BVYF 4EY6A 2VA8A 2K2WA 5JE8A 1P1JA 3LM8A 5HK9A 1ZUNB 2VDLB 2HFJA 1Z7WA 4RV5A 3T6KA 3ZX5A 2YQ5A 4B7AA 4DV4B 2JJYA 3SBXA 1EFAA 3I9MA 4NSNA 1B6SA 1MX9A 1YDFA 4LIPD 3WLSA 1GKIA 3FMPB 4G8DA 5K01A 4JB0A 4PZYA 5JNSA 3I6QA 3IAAA 2ODQA 3MW8A 3O4IA 4FQ7A 1EXMA 1VDZA 2PKCA 4IPTA 4GF5A 2X2OA 1CPYA 4YPFA 1OFGA 2I2BA 5JY6A 1RPNA 4KO4S 1Z4OA 5CVUA 1PL0A 5C8ZA 2WK1A 3O2SB 3UO8B 9MHTA 3NVAA 2O3SA 1AMOA 1F0YA 3OIWA 1Y80A 4RMHA 2QLTA 3L6CA 3QYPA 1QRDA 2C7VA 1SHLA 3A1DA 5I4CA 2ZTVA 3E4DA 2KBEA 2GK3A 1L4YA 2ZYRA 3B12A 3TCKA 1IM2A 2QS9A 4D97A 3FH0A 3LDFA 3FHJA 3V2IA 5BUCA 4O2RA 3B6KA 4N1AA 2XIJA 4KGVA 2DJ5A 4KN8A 4XIJA 3JXEA 1HDXA 3N2KB 5B1HA 1I24A 3U5ZB 1UPXA 3HWRA 3OAAD 2CLEB 1EUDA 2QIOA 4A0RA 3PHBE 4QTUB 1W87A 1HYBA 5FPSA 2I76A 4UU8A 1DKUA 3AL3A 5F1YA 4X97A 4D26A 4FC6A 2B3DA 1ULHA 3H4MA 1CRQA 3HJBA 3LCUA 3AW9A 3PYLA 1KY4A 2OFWA 4KXQA 4L9RA 2C77A 2BZGA 4BEWA 1YA6A 5D3QA 2H06A 4L15A 4YWJA 4BFZA 4EGSA 3DEHA 2GNAA 4RACA 1V5IA 5EG5A 4C6HA 2DVMA 2X3FA 4X1YB 1XI2A 1L4MA 3IYLW 5AM5A 1FNSA 1Z4JA 3Q6IA 4MV1A 4Z4QA 3W5CA 1MX3A 2J31A 4J1SA 4DYHA 3L9XA 4LC9A 3BJRA 3S55A 3T3MB 1RR6A 2EDAA 2WIGA 2H11A 3W9BA 2ZB4A 4HWOA 1I5OA 2WFLB 1PCXA 2GD6A 1N9ZA 4AUKA 1U0BB 3ZVKA 2IE8A 4QDZA 4MWZA 4RD4A 4GUAA 4M9QA 4BAZA 2UUCB 1U0OC 3DL4A 3FG9A 1N0VC 4OI0A 5EESA 1AE1A 1V41E 2WZQA 3BH7A 3L02A 3RVQA 2JI9A 3GT3A 3D5TA 1U2TA 1RS0A 1WEKA 1I6MA 4RTJA 3U3JA 3GLGA 1G63A 2ZULA 3U4CA 1DPFA 2YHBA 3GN2A 1V5EA 3QG1A 4ALLA 5KWIA 2Z1NA 4ZDWA 3EA5A 3WC4A 1OXKB 3UUGA 4ZI3A 1TLTA 4D6YA 1QP0A 3OKAA 2PS3A 4G2NA 4FEYA 1CZLA 3FWKA 5BOSB 1P6QA 2DT8A 2NUAB 5KYWB 4V24A 1JT9A 5D6NA 4KRFA 3ECAA 1M1UA 1NI4B 5EIEA 3AF6A 1UXIA 4MIYA 2Z5VA 1MUUA 1C7RA 1GSOA 3FHTA 2X19A 1KEUA 3I4CA 5DTEA 1X8XA 1OXUA 1QNFA 2EG5A 1VCHA 4Y6SA 4EFKA 4DTIA 3IMEA 2YR0A 3PENA 4RVCA 2I6TA 4HYEA 4MVYA 2JJ2D 2ZJ1A 4ND7A 4NDZA 5E8JA 1JHOA 4MP8A 4QRHA 1SXJA 2OR3A 1VE5A 2VK8A 5K0FA 1JEAA 4UAJA 1L7XA 3QBVA 4MRSA 1GG9A 2CCKA 4IIEA 1CW2B 2V5UA 4G5YA 4JBIA 4MV4A 3I4FA 2JJ2A 2ZTLA 3NHKA 4LDPA 4UD2A 1ODFA 4GU5A 5EKSA 5H7XA 1FP1D 4AMZA 4GKJB 4MEBA 1H5NA 1K8XB 3B9PA 3DD5A 2XTJA 3DZCA 3GGOA 2VAMA 4BPBA 4DB4A 2E18A 4Q7QA 3KO8A 3PGKA 2C2WA 1ZYUA 4JLSA 5B3JC 4GR9A 3MLEA 5BWNA 2RAPA 3DUWA 4KR9A 1PT8A 1AU9A 3BBLA 3O47A 1ZITA 4EGFA 3VZQA 1E7MA 4Z49A 1WA5A 2PIEA 1NP6A 1Q7BA 1PJLA 2HSGA 2JAHA 1TYDE 2LKDA 5JU6A 3LKDA 2OD7A 3PCRB 3L4BC 1ZOSA 5I9LA 1AQYA 1HRDA 1TC2A 1TX4B 5LL6P 1IPFA 3U39A 4ZOBA 3CH4B 4OHOA 3N2YA 3VX3A 1OBHA 2IA5A 2R48A 2VT2A 1D4FA 4HDQB 2F55A 4H17A 4OLJA 4DV1B 3NRCA 2N46A 4FJ2A 2VTEA 2PN1A 3PIIA 4UXJA 4A3SA 2BMJA 2D2EA 3H04A 1F8XA 2QMOA 1NUHA 2X15A 4FBMA 2YL2A 3U7RA 4GH5A 1QANA 4H4DA 4EELA 5BNWA 3A7DA 3ZDBA 1T8PA 2I6QA 3RIYA 4UPVA 1WUJS 2JHPA 2XWBF 3WAKA 1QYRA 2OFFA 3R6TA 5FFMA 3FFBA 3TH5A 2IUYA 3AV3A 4TWZA 5IJ9B 1X92A 4Y30A 1BOOA 4QYWA 3EWNA 4AX8A 5EJGA 1FW6A 1DV2A 5KQSA 3LKZA 2WJPA 1WJGA 3JQFA 4BFCA 3TWOA 3DZDA 4L8LA 2JLYA 3NXKA 1B0ZA 2GNPA 3B89A 2CMHA 3IDFA 4K5QA 5DH9A 3I42A 5F2NA 1BQEA 2E82A 1MVOA 2C7RA 5D85A 2Q0XA 3RKRA 5JNVA 1MHPA 3SP1A 5TGTA 4E21A 4LYDA 3PHLA 2WZCA 3VPFA 3GH3A 4A0GA 3MF4A 5K8IA 4QECA 2GPBA 4QPJC 1BCSA 3NT2A 4D02A 2G08A 5D51S 2YN0A 1HDCA 2I4IA 4M3NA 4DR2B 1T4DA 3PA8A 4JB3A 2NOAA 3KD3A 3N0VA 1WXDA 4OREX 5DF1A 5DYWA 4BDSA 1TUBA 3WLHA 2D2XA 2WYIA 4P8RA 4MZXA 3MQ4A 3RU3A 2HHJA 3C39A 4CTOA 2GDJA 5GZ1A 1UZNA 1L8LA 1WE2A 4DIOA 1CJVC 1C7JA 1X7YA 3G9UA 2EW2A 5FFNA 4MKFA 3BC1A 4EY4A 2BLLA 2HEIA 4PYLA 1FX0A 1WSBA 3W3AH 5EJ9A 1Q0LA 4BV8A 5CU7A 1TO2E 1M2EA 3D81A 4X6LA 4Y2SA 1YXMA 1NKVA 2EV9A 3VYWA 4DCMA 4R84A 1DO0A 3VHLB 2O4UX 3MINB 1TRKA 1D04A 3HKEA 4HVLA 3B7GA 4LXHA 3SIXA 1XKQA 1PHPA 3JY6A 5EIWA 3GIWA 1PLLA 3NHWA 4PLVA 5LYJA 1HQKA 4N7BA 3DLTA 1ZIYA 4BNLA 5BNZA 4OHZA 4F3KA 1I9CA 3TTWA 4XKJA 4BVGA 5HQJA 4QGSA 1M7HA 4DLNA 2ZKIA 2CL0X 3BFJA 4TS3A 1M6NA 2JLZA 3LGAA 4LKOA 2ZJ2A 4JAVC 4UUNA 1CUZA 4RORA 3W3ZB 3IP9A 4S0ZA 1RRVA 4BCDA 1WMEA 3PUZA 5AVKA 4J2HA 2PZLA 1EXWA 2FZ5A 3L7LA 4QUHA 4C0KA 4ZGWA 2YV2A 5CH5A 3WL7A 4C4XA 4PIVA 4Y8VA 2W5UA 1YJ5A 3AVYA 3H5AA 1U28C 4GNRA 1Y3IA 4UQOA 1ESEA 5A6SB 4G26A 1RQ7A 2P9HA 3C3AA 4D9NA 2PK3A 3NAZA 5EIHA 1YONA 1Z9BA 2B99A 2VFAA 3IBSA 3OE1A 5DJOA 1U98A 3EHEA 3B5EA 5KEIA 1GPH1 4DDHA 4HSEA 5FI0B 4CBVA 1H8ED 4OP1A 3EHDA 5EJAA 1COWA 5JPIA 3NR2A 3TKAA 5K5EA 5KQRA 3U44A 1FLDA 2REQA 4CQMB 4YUZA 3TN7A 1VHTA 1T36B 3VSCA 5BY2A 1EXVA 4AZTA 2FEPA 1TMGE 4R1TA 1ZESA 3DFIA 3STTA 4WXHA 1D1PA 1Y1TA 3NWPA 2JLQA 4P7BA 3QKIA 3RDPA 4FWIB 3ZBQA 3GGCA 4HQ6A 1HTWA 1Z74A 2IY8A 3AGQA 4WV3A 4P0QB</