1Y3IA

Crystal structure of mycobacterium tuberculosis nad kinase-nad complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
296
structure length
231
Chain Sequence
VLLVVHLVLVLGGDGTFLRAAELARNASIPVLGVNLGRIGFLAEAEAEAIDAVLEHVVAQDYRVEDRLTLDVVVRQGGRIVNRGWALNEVSLEKGPRLGVLGVVVEIDGRPVSAFGCDGVLVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPEATIAIEIEADGHDALVFCDGRREMLIPAGSRLEVTRCVTSVKWARLDSAPFTDRLVRKFRLPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inorganic polyphosphate/ATP-NAD kinase
publication title NAD-binding mode and the significance of intersubunit contact revealed by the crystal structure of Mycobacterium tuberculosis NAD kinase-NAD complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 42
structure length 231
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 1y3iA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 1y3iA01
4WERA 4DY6A 4WRRA 5DHQA 3PFNA 2I29A 5DHRA 3V8QA 5EJIA 3V8RA 1Y3HA 2I2CA 3V7UA 4V24A 2I2AA 2Q5FA 4HAOA 5DHPA 3V80A 2I2DA 3V8PA 5EJGA 1U0TA 3V7YA 1SUWA 2P1RA 2QVLA 3S40A 4L02A 1Z0SA 1Z0ZA 1Z0UA 3V8NA 2I1WA 2QV7A 3T5PA 2I2BA 3VZDA 2JGRA 3VZCA 5EJHA 3V7WA 5EJFA 2BONA 2I2FA 5DHTA 3VZBA 3V8MA 3AFOA 5DHSA 1YT5A 2AN1A 5DHUA 1Y3IA 1U0RA
chains in the Genus database with same CATH superfamily
2P9FA 4LBZA 3TJRA 4LXQA 1CQWA 3BQ9A 3FWNA 3CW8X 5BR1A 3JQPA 1PT6A 2PSJA 3VOAA 3DLBA 2Q3JA 5TGTA 3BREA 4W9NA 3OP1A 3CVUA 3JQDA 5KSYA 1AURA 4IS3A 3D6VA 2ZRCA 3OO0A 5C8VA 4KFCA 3CEJA 3B8HA 3U5TA 4LV5B 4DDVA 1UJNA 4FGSA 4NOKA 4YRPA 3QVWA 3R23A 4K2AA 2G1JA 2CBXA 1HWYA 1AQYA 4PLTA 4M9SA 5DMHA 2GVZC 1EZ4A 1N7GA 1MR1A 1TF5A 2GM4A 4ZIRA 4HAIA 4Q1VA 5T4HA 3ZGLA 3COZA 4HAVA 2JAWA 4GO1A 3G0DA 4KXUA 3HB9A 4RDCA 1II8A 3BFJA 3MWYW 2R65A 4Q00A 4J0JA 2J32A 3QMVA 5JQWA 5DI3B 2O3QA 4AJNA 5JSUA 4QPNA 4YWJA 1DKRA 1D2AA 2H6EA 2GILA 2WW8A 2X8JA 3X1XA 3T0FA 1VHJA 1SXJD 3L6OO 3WWEA 5BN4A 3IIMA 2J87A 4Z3OA 5GM1A 2EGGA 2X5JO 1O89A 5AM2A 5K3DA 1H0RA 1NONA 2COEA 3HN2A 4FFBB 2D2VA 1RIIA 1ONOA 2V9PA 1IB0A 1OT3A 3WWCA 3PXBA 3UHAA 4DY4A 3HCRA 3W79A 2GN1A 1IPFA 1G21A 1RXIA 1W4RA 1C7FA 1THZA 3ITDA 4HDRA 4KK3A 2A2ZA 4GPIB 3WA6A 4W8HA 4ZYYA 3N75A 4FWTA 3OJ0A 4DLKA 1E2PA 4AAYA 3GNSA 4CYMA 1NVMB 1N2SA 3G8DA 2JGIA 3EGWA 3NHWA 4FCVA 1JEDA 4H1VA 3O38A 1PK8A 2OESA 4U6QA 1TU3A 4ZARA 1U2GC 4QQRA 3SIXA 3SOPA 2X6RA 4IUBS 4UZFA 3UB2A 4BRZA 1A97A 3VBCA 3S4YA 1YQXA 3GRRA 3SU8A 3RF6A 1M74A 4ESVA 4IGAA 5DRTA 5BSGA 2WUFA 3EVAA 3A9UA 1KMQA 3TMAA 1IXZA 4ZRNA 1VIAA 4ZIRB 1TMGE 1PD0A 1X2EA 4INJA 4LECA 4WEOA 3WWYA 1GCOA 1X1CA 4L57A 5JD4A 3OJOA 3WJ7A 3KQOA 4K9PA 5IT4A 2HNAA 2Z08A 4QUAA 4DB4A 3BFPA 2VHXA 4F5EA 1XE3A 2D59A 4QSHA 5FL7A 3Q7IA 3GEPA 2DY1A 2X8JB 4LF6B 1GL6A 3F9CA 1XU9A 5BUZA 1C0LA 2YFYA 1JG2A 1F4VA 2WK1A 3GLRA 3Q7RA 1G4UR 2GB4A 2GXQA 1WSDA 3N2KA 4GE3A 4DMFA 3W5JA 4YIKA 3HXOA 2NYVA 2GN8A 4DN6A 1DDIA 2CHEA 1D0IA 1DCKA 1HE1C 4WESA 1FQJA 4YXWA 2PVPA 1ZUHA 3EF3A 4KLRA 1E2FA 3WMXA 2AI3A 3I5XA 3DTNA 1EESA 1CJTC 1G21B 2PUTA 1ZVVA 3VZDA 2V96A 4LDNA 1OUMA 1XZAA 1P2SA 2F9FA 3HWRA 3SJUA 3KB8A 1MV8A 3B9PA 3R5FA 2Q50A 3WNVA 4KFUA 5HPYB 4Q9NA 5I8PA 2JJMA 4ROTA 4R9UC 4XD7A 2DWUA 1GJRA 2RDMA 3DUFB 4TT3D 4CL0A 5KSWB 5GJWC 2DECA 3OPQA 3V7WA 2BONA 4BJHB 3RFCA 2FG6C 5EIEA 4ZT7A 4IRXA 1M1YA 2OXEA 1I6KA 5EUMA 2C3MA 4JNCA 2VXOA 2Y1XA 3ELWA 1WXWA 2OG2A 4BVAA 2O8CA 4UBKA 1P2TA 2C98A 2ZYTX 3AETB 4MVYA 1R6UA 3N6VA 3BD6A 1YKSA 2GZ3A 3FB1A 2OMEA 3PITA 1SB8A 5FP0A 3V1LA 1P7YA 1Q19A 4KW7A 2O2YA 4O29A 4QAQA 5HA5A 5LM3A 1WUIS 3GFRA 4N7MA 2FX3A 1ZQ1A 3GIDA 4GGPA 2AXEA 2VQFB 4DILA 1JLRA 5DCWA 3QVXA 4IG9A 3ZV6A 3E9QA 1Y1SA 1Y4DE 2VG8A 1ISJA 1OX5A 1M72A 2X1VA 2GD1O 1TU0A 2HNBA 4GR4A 1G8FA 3N2KB 2P9TA 5DASA 2X8LA 2XT9A 1L2TA 3T0GA 3PK0A 1KAHA 3PFNA 4YK7A 3PCTA 4ZT5A 3TQCA 1SZCA 2OQ2A 3AEXA 3A4TA 4XSGA 5TSDA 1DAKA 3QOWA 2FPUA 2AHRA 3NP7A 1KDZA 1WMAA 1T9BA 1CD5A 3NVKI 1U94A 1WOMA 3O1LA 4Z2YA 3GJRA 3VH2A 3VTKA 1Y37A 4QFMA 1W94A 3D0QA 3TTXA 4B47A 2QTVA 3W5SA 1VMDA 2NMVA 2C8LA 4B5KA 1WXQA 3OIFA 1W4BA 1X87A 2GYVA 1Q77A 1TRKA 4JP5A 1CUAA 4IO1A 2Q7DA 3GNTA 3EMVA 3OU6A 4GNKA 4HO1X 4HAYA 5J2UB 1LJUA 1T24A 1M1YB 2KQUA 2Y1GA 3L82B 5CNJA 1UWKA 4E14A 1D6NA 2QRGA 4GMKA 2O8CB 4PBTA 1X39A 4OP1A 5EMLA 2R6ZA 3OQJA 4G0YA 2NPIA 2X3UA 2XNJA 3NC4A 2CKMA 3PEVA 4FMCB 2QD1A 2NG1A 4ZAGA 1P8AA 3O75A 3RUAA 3TTSA 4MVJM 4CTOA 4XWOA 2I2DA 4KE8A 3V4LA 2FCRA 2ZB2A 2N75A 3QPUA 2QLJA 2PYDA 1SBIA 5FA8A 2QT1A 4FDTA 2UUOA 2ZIVB 1E9EA 4BATA 5JR3A 4RLHA 4NECA 4G0MA 3TQOA 2VP5A 3LCCA 1KA9H 1VQ1A 4EL5A 2Z8XA 3RRZA 3PQCA 3EVEA 5A04A 2YHSA 2NZXA 3FSGD 1MJGM 1YB1A 2XT9B 1LPAB 1IFXA 3O0DA 4IEIA 4ZHQB 2NU9A 5FNVF 3I8XA 2N47A 4LDZA 5IJ0B 4KU0D 1E2HA 1NZDA 1YR8A 1KBZA 1AQIA 4MYUA 2DH5A 2EYQA 2HK7A 4I4TA 4IMJB 4UFOA 3RLFA 4CIVA 1NG9A 4K40A 1G6Q1 3JWGA 3AEQB 3LUDA 5DW3A 2AFIE 1LRKA 2AEJA 3ONFA 4XEHA 5G0WA 1BZYA 3OPVA 4GC5A 2QTVB 3M83A 4M0CA 2XB2A 2IPOA 2VPPA 4IGKA 4TUYB 4BNIA 2IWHA 4EKYA 4BMZA 3U4GA 4IDDA 1P75A 4HJRA 4JBHA 1N6PA 4BLPA 3CF6R 4TSFA 1OZGA 1CCWA 1U7PA 2BV3A 4LCJA 3RFTA 3FA2A 3WO1A 3GUCA 5GTDA 2YDXA 3K0HA 4JBIA 4KDRA 4NOJA 4QJ4A 4ZU3A 3SS7X 2HLDD 5IZ4A 4ARAA 1ODFA 4FSXA 5HP4A 2BJHA 1KMNA 3GARA 4EEXA 1SVWA 4KREA 2D13A 1CUUA 1RWMA 3GUHA 4F21A 1H1TA 2O9JA 5C0OE 5GZ1A 2HLNA 3S29A 2LC1A 1N57A 1NLZA 2ONCA 3EIEA 2PGOA 3MSXA 2Y0DA 4MB0A 2GKSA 4LXHA 2B36A 2V7QD 5JSZB 5ANRB 3F9RA 1VHWA 2PS0A 4LF5B 1KI6A 2VHJA 3QW2A 1KRWA 5KYVA 2AKYA 1P0FA 4FXPA 4BECA 1VE5A 2MT9A 2QTLA 4S24A 3ZKAA 3NZEA 4DBVO 4QAJA 1QU3A 3IUQA 2GPSA 2PANA 4PO9A 2NU9B 4D9KA 4P7KA 1Q5PA 4US0R 3A9WA 5HKKA 2QP4A 2VDMB 3ELSA 2B69A 2GEJA 2Q21A 4A4YA 1R0SA 2X8WA 4I4TB 3VYVA 1WD7A 1JSCA 4B73A 4TN5A 3T0IA 5CLLA 1O58A 5H70A 3LGAA 4J0EA 3HB7A 3AV0B 3SJ7A 3BE6A 2Z2XA 4D9HA 4IOJA 4BPBA 1Z17A 3HNPA 5G0SA 1C3JA 1R5JA 3PDUA 2W90A 3OP4A 3AJEA 5DNEA 2PAAA 4UDOA 1KRHA 3AP3A 4CIWA 3PTLA 4BX3A 5IC6A 1G5TA 1FYEA 4EYGA 3LLMA 4RH1A 3X44A 1SR8A 2JFXA 4PQRA 2WTEA 1SKMA 2QB5A 1L4NA 3O4JA 4OHZA 5EJHA 3P0RA 3U37A 1HDRA 3V4SA 3NM5A 4L4ZA 5ADWA 1P0QA 3GFFA 4GWKA 5JEJA 4MPPA 1GEEA 3WIUA 2B4YA 3IQDB 3O7WA 4ROSA 1WCWA 2QRPA 3SBXA 3VR5D 2B20A 1F0NA 1W9MA 4MLZA 3PPVA 2O8EA 4DLBA 1CEYA 1G98A 2WYUA 2YJ4A 4M38A 3D2BA 4Q9HA 3U7EB 1KI1A 3KO8A 1SUCA 2FK8A 1QRAA 1UOPA 2EKBA 2PWZA 2MR5A 3GGSA 5FULA 2H4HA 1YA4A 4L5CA 3TQRA 2CFIA 2QM8A 2PQ6A 1AUOA 1LF0A 1YB5A 2VH2A 1MMFB 3PC7A 3IVCA 2VTEA 1CY8A 3M9LA 2BGJA 2GA9A 3FI9A 4HNUA 3AUKA 3OKCA 2GRJA 5ALKA 2BFWA 1C2YA 1M0EA 1KE2A 3IR5A 3L0SA 3QU2A 1YK0A 1UQTA 4H2DA 5J47A 3GV0A 3WSWA 1AGYA 5ALGA 2HIHA 1M34A 4QODA 1RPNA 1Q1BA 1UOEA 1S8OA 3RVJA 1GQOA 4D46A 4GLOA 4K6CA 4R0MA 1FXUA 2G82A 4D80A 5AQ1A 5HBRA 4EJQA 3ZD9A 2R1ZA 1LWOA 3JATB 3E9DA 3H5NA 4LYGA 2W2XA 3BSSA 3PI6A 5K0TA 3OLQA 4OHUA 2V6BA 1ZOSA 2EV9A 2EATA 1KS2A 1ZYUA 2O6LA 3Q7SA 1Y63A 1LBEA 1X1AA 3BH7A 3OLCX 3RFVA 1F0KA 3FTFA 1Y34E 2R6DA 1NVTA 1Y8RB 2BGGA 2UZ1B 3CE9A 4IQGA 4L1KA 5LWQA 3VOTA 1NFRA 5DK6A 1L5VA 3I30X 3R0QA 3VPAA 4LRSB 3D54D 3PICA 3TXAA 3GA7A 5AJXA 1BHSA 3Q8KA 1J8YF 2O52A 1SCJA 4YBZA 5EJ2A 3MMZA 1P2VA 2PVSA 3DYBA 1T25A 4AS2A 4PFSA 4S1NA 3D8HA 4ZOQI 2IOYA 1N75A 3PNMA 5HEKA 4MH0R 3CRW1 3WLNA 4JEIA 2C3YA 5D3MA 1QV9A 2GJ8A 4L4XA 3H6GA 1QGUA 4DYHA 1YCGA 4GYKA 1H9BA 1WMBA 1IU9A 4HYTA 4X8OA 2JW5A 1N34B 2CFTA 4F8EA 1IXYA 4Q3AA 2X58A 1CPYA 1RXYA 1SBCA 2M6KA 2QTHA 1J8MF 3ZNQA 3LT1A 4I8IA 2FDCA 1QE3A 2X41A 1K6XA 3PSHA 4GPBA 4F4FA 1P2UA 4GZLA 4MJXA 4YV2A 3ZK7A 1M34B 2ZVPX 4H0NA 4HFJA 4IDCA 4PYKA 4YAJA 3EG5A 3T3MB 4CHTA 1QRDA 3I8SA 1AJEA 5JPIA 5CLJA 3LXRA 4AMBA 2KM1A 4ENPA 1GUBA 1O77A 5B30A 1BMQA 2XNSA 3W5DA 4RE6A 3FWHA 2V45A 4PQEA 3KK0A 1OX4A 3GGDA 3OUUA 5KU1A 5FOWA 1YV9A 2Q2QA 3I73A 3N59A 1T0PA 4PSUA 5EQFA 4YONB 3BSYA 3CXRA 3ZNOA 4RA6A 2BI8A 4QPJC 4K9KA 1I80A 2PS9A 1JQ3A 3VGJA 3N3BC 1AKQA 3ETGA 2DHCA 5K0LA 5BY2A 4QIHA 1A5ZA 1GAJA 1UJ5A 1ZN8A 3WQBA 3FSJX 4WOBA 1L4FA 5ICMA 4OHFA 4F3RA 5KYGA 2O19A 4BASA 2ZRPA 3A06A 1PQYA 2XE7A 1EGVB 3EWIA 3LBIA 1WHSA 3OJXA 1FBTA 4ZC1A 1LSJA 4G0WA 3TPCA 4POOA 2MMCA 1NUQA 1YUBA 3EVGA 4DCPA 5L9AA 1ZCFA 5C7LO 1C4XA 1UPFA 2W6OA 3LBHA 4A8JC 2G1PA 1JBEA 5EXTA 2F64A 4DA0A 4P80A 3LYAA 4CM5A 3DEHA 3PKIA 1K8XB 2HR1A 1C5KA 3ZIDA 4NCBA 2WFMA 2R6FA 3L84A 4RETA 2J30A 3N74A 1M0WA 1ZNZA 3WYNA 2FRDC 1SC3A 1B8NA 4QGAA 1DXQA 1NQ5A 3BG5A 4F71A 1R0BA 5KQRA 1EJ0A 2WVGA 3WQQA 5LQRA 5AOCA 3U3DA 5LA6F 2DWOA 1U5AA 3L7AA 2VUUA 2C3PA 3PC2A 5TPZD 3S0JA 1NP6A 3STHA 4YXFA 1ISHA 3ZE0B 3KEQA 3GR6A 1JU9A 3ZE9A 4WNCA 3TQFA 2PUCA 4RGQA 2GBFA 2Y8EA 3U3OA 1AB5A 1KSHA 5L8VA 5FNVA 2AB0A 4FLEA 1BGXT 2F62A 4RA6B 1F9AA 1RBQA 1G7TA 3DMTA 4PPYA 2XCLA 3UG6A 4LAFA 1LTKA 3O8OA 3MWEA 5H0IA 5EZ6B 5F4ZA 1BX3A 4Z9BA 2IDZA 1P9NA 4OJNA 3H9GA 4PEVA 4F6LA 2QVLA 1MOZA 4YJGA 2OFFA 4ACAA 4RF5A 2XF2A 1FXSA 4NEGA 3BDVA 1TT5A 1WHSB 1IK4A 4MS3A 3P19A 5JDCC 3DYIA 1UBJS 2Z0MA 1ZHFA 4HNAA 2B6NA 3CZCA 2YUTA 4PC1A 1YS4A 3NRCA 1KZ6A 3MGBA 4OL0A 3T1HB 2EFGA 4FN4A 4MW6A 5CB4F 4TXLA 1FOEB 4H27A 1UXJA 2O2HA 2JHFA 3NHKA 3FR7A 2NNWB 1DRKA 1G9SA 4N41A 4DR7B 3OZVA 3EGXA 4FSDA 4D9JA 5AJYA 3LPNA 4KX5A 4HX2A 1ZGAA 1UWVA 2WJHA 5CRIA 3N39C 3GF4A 4TQ9A 1NQTA 1IVSA 2XTNA 2PSHA 4QZVA 2FY8A 4H87A 2W5UA 3BIJA 3OY2A 3PQ7A 1IOZA 2RH5A 3UA4A 4B75A 3DZKA 1L4HA 2B25A 4OLFA 5EKXA 1ENYA 1UEXC 2FF4A 3WE7A 2H11A 1C4WA 3EODA 2WJPA 3HKBB 3VU1A 5FLEX 3WGIA 1J9GA 3OWHA 2A5FA 1OCEA 1Y82A 3NT4A 5EQDA 1U4NA 1O4WA 3NHYA 4MXDA 3MOGA 5JNRA 1VDMA 3O8OB 3GBSA 4K9OA 2R4UA 2B2XA 2GPJA 1FNNA 2WFAA 3FNHA 2IDJA 5IH3A 4A23A 4G0VA 3RBZA 1VCOA 1WNFA 4DADA 1WW2A 4LZLA 2F8SA 5IAGA 3MILA 4YJGB 2G0TA 2RAPA 2WAXA 3IPXA 1LBQA 4YQFA 1IOWA 1CVIA 3PS9A 4KVFA 2C9ZA 1TT5B 2GBGA 1NC1A 1KDTA 1THMA 1YMVA 3QHQA 1I3OA 1XKLA 1J2UA 2XADA 3LKBA 4PLPA 2VC2B 4UATA 2NO6A 4Y0NA 1YVDA 2JFWA 3OZFA 1WAMA 2IK8A 2XDWA 3CLUD 5DTMA 3UFBA 2YZMA 3ELVA 3GXOA 3HTXA 1YGYA 3RAGA 1KI4A 1G0OA 3EZ2A 3UAZA 2H0QA 2YIVX 5D3KA 2YVQA 3L7CA 1XTPA 2YH2A 4G6ZA 3QBDA 2DR0A 3B78A 4LJKA 4V2UA 3TIVA 5LOVB 4X90A 1C3OA 4AQDA 4QLOA 1KP3A 3AFHA 3UUFA 2O8FA 4AKGA 4YLGA 3TECE 1VCIA 1G8JA 2FA9A 2FSVC 2C88A 1E94E 2ZM6B 3ROMA 1N0HA 1B1AA 2R9VA 3R24A 4J03A 4O4LF 3G3EA 4RZQA 2XZTA 3OZWA 4IAOA 2QUHA 4JC8A 3HB0A 5EWLA 2HBYA 4EVRA 3TIGA 3RRNA 1PT8A 1GV1A 3ZN2A 4L74A 5C2JB 3JAKB 3DFFA 4FX5A 1I9CA 2H57A 1OZ0A 3HB1A 3N0TA 4GVPA 4M9RA 4N65A 3RWBA 3TBFA 4EUHA 1BOFA 3STWA 5KCMA 1E9AA 1LDGA 2GN4A 3Q0EA 1AKUA 1PG5A 1KEUA 5FR1A 3BWDD 1T8YA 4HH0A 1PFGA 4ALIA 5BWMA 5DN9A 1U0GA 1XG5A 1J90A 5H3HA 1QFMA 3K09C 2NAPA 2FHSA 1YU9A 4XPIA 2MYPA 2KYRA 2ID8A 3VPXA 3BPSA 2M2IA 1A72A 2HQSA 4HP8A 4A1OA 2W6PA 3A1WA 3KLNA 1QXSA 2QZJA 4UULA 2YUIA 2FP3A 2UZIR 2C2OA 1SHTX 3IBGA 1MO3A 4BVFA 2JGDB 3FX2A 1ZOIA 5F7JA 1NN1A 2P5YA 2ZJ4A 3PF9A 4FFPA 1EFCA 1L7OA 1J4PA 2G5CA 2ZVJA 3DULA 1O95A 1YZ3A 2IEIA 4WAUA 2EG9A 4EYOA 1C3OB 3GUUA 1E6UA 4ZAWA 2O8FB 1RLOA 3KE8A 4OGLA 1KZ7B 3EFBA 2XQKA 3FLMA 3I34X 4R31A 1LPMA 6CHYA 1OHHD 2P4UA 3JQQA 4HZUA 4F2GA 2YHIB 1NQWA 4RDIA 4DJDC 3BXEA 3B89A 4JQSA 3SK0A 5EWLB 4LBVA 1K7CA 4NZNA 3P45A 2QQGA 3QYFA 3V8QA 1FRQA 2YS7A 3VR2D 3SP1A 3BOSA 5AVWA 4UDNA 3CBQA 2NTVA 1KZYC 2ZAMA 3KB6A 4JHLA 4Q93A 5FYDA 1YE8A 3MLEA 4R1UA 4FR2A 2RBEA 5ABPA 3T5PA 3OTIA 2YWXA 5I9MA 3PNPA 2IYYA 4FE4A 1N1DA 4GMHA 4E33A 3ZCSA 5TF4A 4CMEC 4XPIB 3M81A 4QREA 3EB9A 1PI3A 2NSDA 2QTMA 4TYPA 3WRVA 1QTQA 2J9ZB 4JJ7A 3U3ZA 4AJOA 1Q7TA 4D9GA 2JLBA 1CUBA 4AF7A 2ET6A 3OC6A 1SHUX 2V5AA 5BNWA 1EU1A 1PX2A 3TLYA 4EHHA 4ERNA 3RS7A 2C2YA 1LNZA 3HU3A 5GONF 2PUEA 4UE2A 4TKLA 2AZ4A 2XQVA 2HU2A 5CBPA 1OBHA 3I4FA 1NNEA 3OE7A 2FV8A 1NF3A 2Z5LA 2YCLA 1P7VA 4Q24A 4N76A 3NM4A 4WTOA 2CHUA 4L51A 1Z83A 2X7HA 4L8FA 2XQGA 4A8HA 2CYAA 2VJCA 3HY4A 3Q9SA 3WMWA 4FBGA 2ZI3A 4CKCA 3RAEC 4YP0A 1CDDA 4PZCA 1OA0A 3OETA 4JI8B 1SQGA 3GPCA 2YNMD 1GPYA 3A6JA 3WMGA 1LU9A 3LA6A 2PXCA 1EK5A 1TC1A 1JLHA 3ZWOA 1VE6A 3LS2A 1MENA 4RZ3A 2VP2A 4LF9B 2VKQA 1ND5A 1CZKA 4N5LA 4II2A 1FTWA 2UZAA 1RYBA 1GCAA 2FJPA 3EAQA 3UAGA 4B6OA 3IEMA 2W0SA 3KHTA 5JH7A 1NVGA 1P5ZB 4ETMA 5F98A 4RMNA 3Q7QA 4Y2GA 3GT4A 5TXGA 5LA6A 3REQB 3RYIB 1G20B 2FTKE 3A4NA 1R1DA 2R8PA 3R4VA 1G1MA 3OIWA 3KXLA 5DGTA 5I45A 1CUYA 1FU7A 2XYRA 5EC8A 3W9UA 5KNBH 1Z6AA 1XB2A 2R62A 4QM7A 2AFHB 4C7XA 4MVXA 4YQEA 4Q7KA 5ERGB 1LNSA 2AC7A 2CJWA 1GZ4A 1QGYA 2XKJE 3OZAA 1YQTA 4JUBA 5KAPA 1J7JA 2HGZA 3NC1C 3PCXA 1PT9A 4OSEA 1GZHB 5K0FA 2C96A 1CJKC 1R00A 3N2EA 3NHBA 1E96A 3B1YA 4FFSA 1QZXA 2L0XA 4MQEB 2O7NA 4R2WA 4TL8A 5B4UA 3FMFA 3L1HA 4AZTA 1RLIA 1U9IA 1XMXA 3TTTA 5DNAA 3KXDA 2X13A 3RGGA 1GOTA 4EUNA 3DOFA 3JRXA 2HCFA 5C1OA 3FE2A 1ZBDA 5BPHA 5C53B 2GGSA 1UAAA 2XSZD 1EGMB 4LG1A 2OHIA 3R6GA 1MJHA 3PE6A 4B3IA 4BN5A 1CS4C 2XHZA 2ODEA 3BK1A 2G70A 5CB4A 2E85A 3BMCA 5HILA 5H4GA 1YFLA 4EHAA 1ZH6A 5BSVA 3F6BX 4ZV7A 3G85A 1LWNA 2VLIA 3IV9A 1PK9A 3HP7A 4P58A 4PLFA 2HIMA 2Z8YA 1LPPA 1XSEA 5JH7B 5E9WA 4YYEA 1IE3A 3K9GA 1ORDA 2FEOA 4DV0B 5AW7A 4IEEA 4NH0A 5PGMA 1DBRA 4L4SA 2V4UA 3E4DA 4PPQA 5AO9A 3KL2A 2WWTA 3H3XA 4G85A 3H16A 1H05A 3RARA 1P4JA 4PZ9A 1S3FA 1J1UA 3GJ8A 1SZJG 1XCLA 4MW7A 3F71A 4URZR 4HV4A 1MJFA 1PD1A 5KOJA 5HNKA 1U6IA 1N2ZA 2BF4A 2ZAIA 4B1FA 2FEXA 2PD3A 1RAHA 1A8UA 1OFTA 2QL5A 4JP1A 5EI5A 3VR4D 1I30A 3GK3A 5BN3B 4UTOA 1RQNA 1GTRA 2Z3WA 2X5NA 2JAPA 4WRRA 1GRQA 1KZ9A 3E1SA 3QLUA 1H0KA 3R40A 4IIVA 4D57A 1B41A 1JJIA 5M29A 2WZBA 5IKMA 1PG0A 1JJ7A 1ZSVA 2C4MA 2PYIA 1E7SA 1H8ED 3HGTA 3ZYCA 1ESDA 3CLUC 2XB4A 2II6A 4WXHA 1KNQA 4ME6A 1M6HA 1DAMA 1QG2A 4TN1A 4XIYA 1R5NA 1B6RA 3GDHA 1MU0A 3DDNA 4J0GA 5CM8B 3RC7A 1U8TA 4ZFNA 5EHZA 3OQBA 4DXAA 3UPUA 3KS9A 1R6AA 3E3NA 4IQ0A 2Q6LA 4H6XA 1CULC 5CCBA 2YVLA 4QGBA 3ICVA 5AKYA 3KSBC 3BMCB 3DC2A 1PR6A 5FQOA 1RFGE 4ID3A 5HQ3A 1M6VA 1M2WA 1Z12A 2WZDA 2ZJ7A 2IOQA 4OSPA 1VM6A 3C43A 3FOFC 5DKFA 1T8WA 4CMIA 3K1AA 1EFTA 1V16B 3K4HA 4KDEA 4ZRDA 3E81A 2QG6A 4PLGA 1PE0A 1KBQA 1HYQA 4EG7A 3G8AA 1QJCA 2A88A 2C2XA 1BWPA 1T5OA 4LDQA 1R88A 4G1UC 3VZRA 4O4LA 2DVMA 1JYEA 1IZZA 3H17A 4NQZA 4U5QA 2YJGA 3T8YA 3ERCA 3RHTA 2D62A 1AN9A 4J94A 3CXUA 2A92A 5I7OA 5IX8A 2LIPA 3P52A 2RI1A 3MPOA 1XEXA 4EUFA 2I1QA 4GI2A 1NTRA 1S9HA 2OBNA 2DTXA 4BFXA 4LSMA 3QMMA 2FQQA 4HRYA 4XUEA 2P4EA 1V2GA 2V7WA 2Y1FA 4MJ3A 4CI0B 1CUEA 4PBRA 4KN5A 4UD6A 1FLAA 1DBWA 1V25A 2A0TA 4LHZA 3WLAA 3S2EA 1A9PA 3OLXA 2JJ8A 2Z5VA 3P2IA 1OBVA 4IHKA 4JB3A 4K86A 4Q15A 3T52A 3PNQA 4WCVA 4UARA 1FYWA 3M82A 3LFTA 1IY8A 2GBCA 3OCXA 3R6DA 3U6BA 2EDAA 4MSUA 3EZ6A 4CI9A 4UVDA 4CUZA 1C1YA 4PQGA 3GHHA 2FQYA 2JCYA 4F91B 4C4AA 4BXOA 5L7WA 1N6KA 2V6GA 4D3DA 4LNUA 4UHDA 2AMYA 3KETA 3NRBA 2NU6A 1BXZA 1DX4A 1I7PA 1TT7A 3CWZA 4X1YB 1WDKA 4DMGA 1XTBA 3LJKA 4FJ2A 5E7QA 3TXYA 3WYAA 5LD2C 5GIOE 3I2GA 5HQ3B 4NXNB 5I9NA 1M6VB 2IDKA 1Z34A 2PGXA 4KN9S 2HUPA 2JJ1D 4IUYA 4B87A 3S5JA 1IAVA 3O90A 1O7JA 1OGYA 1TDJA 2OXFA 3A3KA 3POAA 4CMIB 1B8PA 3AFIA 3EMBA 3LECA 3R0IA 1D2MA 4EY6A 2Z2YA 3TFOA 1I33A 2QVGA 3PNLA 5AVSA 5ETJA 4HFRA 2WKRA 3CJTA 4D9MA 3L7JA 3T4EA 5TV2A 5DXJA 1GHTA 5D84A 3UGQA 5I48A 2WT8A 1PU2A 5B1IA 3MCAA 4D8WA 4KSYA 4PS0A 2X3FA 2YQ4A 3OG9A 4IF4A 1AZWA 3RIGA 3KV3O 3IR7A 1CE8B 3L7MA 1OWNA 1ZY2A 2RC6A 4WQMA 4PXSA 2LGJA 4GOKA 1QRTA 2CZCA 4OM8A 2V0GA 3BCHA 1Z7YA 2B34A 3RR2A 5HE8A 5ES4B 1EWRA 1HLPA 4IRUB 4LBYA 3FPEA 5AVJA 3GFOA 1UXGA 4H15A 3Q5EA 4CIDA 1Z2DA 1TCAA 1BD3A 3L6RA 5GJVC 5KSPA 1UHTA 4D3YA 2Y77A 1ID8A 2NO9A 4Q02A 5JFOA 1DJOA 5BNFA 1FLDA 1OWPA 2NU6B 1CUGA 2R5WA 1U7WA 1EX7A 2I9KA 4IW3B 5AVZA 4IICA 3VNRA 3HVKA 2QY9A 2P6UA 3H5AA 2J7KA 3VZQA 2A0UA 3CSUA 2X0FA 1FPQA 2FSHA 2AMJA 9LDTA 3TS1A 2PE5A 3OFNA 1MD9A 3H0EA 2FN9A 3IP8A 4GLFA 2P3QA 4OBXA 4XPZA 5KVQA 5LR6A 4GKKB 4MMYB 3FHLA 4GD3Q 3O26A 3BGWA 2G83A 2QPOA 3RBVA 4F7WA 4HQ0A 1P3JA 2A33A 2FE1A 3OF3A 3KQYA 2YNMC 3TMYA 1EK6A 5A5FA 1RZUA 3GI1A 4DEXA 1RYMA 1Y1QA 3U44A 1O6CA 3DW1X 4P3KA 4EJMA 2ZIXA 5AKJA 2MSEB 1A96A 1NP7A 2ZQ5A 5A4MS 4QVKA 3LPMA 4GXNA 3NUGA 3BH0A 1A5BB 4UHEA 1PKEA 1WLNA 3GLHE 4P84A 2IZ6A 2ZTUA 1X7YA 3RHSA 1Z5ZA 2PKRA 1ZH8A 2EZUA 1JQBA 4HDKA 2VHEA 1QTRA 2ARKA 3NHSA 3F7TA 5LDDC 3ZJVA 5JYEA 1T5BA 2PX6A 3TXXA 4BJ3A 1A3CA 2CXTA 2A0XA 3QUQA 1YL5A 4HZGA 3QPAA 4QHYA 5AHOA 4UTNA 1T5DX 1L8XA 3HS3A 2HF7A 4QPZA 4Z1MD 3GFVA 1XPUA 4Q5IA 1G2QA 1UBRS 1RAEA 4KPEC 5GGYA 1MOSA 3MUOA 4XQ0A 4NZOA 3NPAA 2CD9A 3M49A 2IXAA 2X2FA 1NE2A 1P5FA 4DTIA 1WDLA 2X40A 2OZVA 3RO7A 4BBAA 4ZC8A 1QVZA 4E2ZA 5KC9A 4QO8A 4D45A 2F17A 4HH3C 1J24A 4XASA 4C76A 4DWOA 4G09A 3SY8A 3GAAA 4EO7A 3PHLA 1ZIOA 3BICA 1QH1A 5CA1B 1J4AA 3E5NA 2GWHA 3WDMA 1WVGA 4GVLA 4WFIA 4B17A 4CETA 3FAKA 3B51X 4G0PA 2QV7A 2XLBA 2XHEA 4WY8A 3RSGA 2FN4A 1QCZA 5F2KA 4C6TA 4NOLA 1U5BB 2O4UX 4DMMA 1AIPA 4N1AA 2QT0A 3D8BA 3NYRA 4J1TA 1JG1A 2QMHA 1E5TA 1V9SA 2V7PA 1E6CA 5IMBA 4IXWA 3M6MD 4S1VA 3A0RB 3FZGA 1FF9A 1WTAA 1FVXA 4O1HA 5HS4A 2RH8A 2UVDA 3W8NA 2QJTA 3FFWA 3AHEA 1XZDA 1OLSB 4Q3NA 5JSKA 4ARCA 4PC7A 1ZJ4A 1LFDB 4C3ZA 2XYHA 3UTDA 3I4LA 2JLZA 4HFMA 2YIDA 3B7GA 4N8DA 1VYVA 3H65A 2I55A 2NTEA 3K0EA 4DWWA 4EHNA 1E1QA 3IOBA 1CU1A 1R6TA 3CRNA 4RQAA 2VT6A 2MDTA 3ZKWB 4UOZA 2ZS7A 3AV3A 2PIDA 3FFBA 1RLMA 3KJQA 3GVPA 1JDZA 4IQ8A 5HGJA 3RI3A 4NICA 2AI1A 5FX2A 2Q4TA 3IL2A 3RVBA 2RHLA 3GB9A 3QV1A 5DP2A 3WGLA 4X24A 4UPEA 1I24A 2B92A 1QH1B 4L7QA 4JVOA 1BXGA 1MABA 4M1EA 4PIMA 2P0AA 1VIMA 2EL7A 2GWRA 2PIAA 3QFSA 4H16A 4P86A 4UJ3A 3VXKA 3ZXIA 4AY4A 2B5WA 4NS4A 5K2OA 3GQBB 4A0FA 4E88A 1RJ9B 3H6HA 1Q83A 4KQ9A 5HM8A 4YLEA 4HQLA 2OLJA 4FQ5A 4CGZA 3A4IA 3A1SA 3KTFA 4H1WA 4GOMD 4RANA 2Q1WA 5LQSA 1WBJB 4W7IA 3E15A 4IY1A 4X00A 2WWHA 3PGMA 2GD0A 4G9BA 4IWXA 2ZWVA 1ORRA 1NMSA 5JZMA 1X8XA 221PA 3TK1A 1EXMA 5BSWA 2Q0QA 2NACA 4KAAA 1LLDA 1N7HA 3FCAA 1QC5A 1RYDA 1V47A 4RQUA 3EN0A 4XYMA 4JYCA 1SURA 5H82A 4YREA 3EPLA 1VOTA 1R6XA 3DV0A 3IMEA 3WLOA 4DLTA 4A8PA 3PHCA 4E5DA 3K5PA 2R00A 3RKSA 3ZH2A 2CD7A 4X1KA 5ELLA 2IS4A 4RSRA 2YRWA 3GN1A 2ZBGA 3RYTC 4KE6A 2VLBA 4TL6A 4ZCIA 4BV2A 1T2NA 3T5AA 5JROA 4GICA 4QU9A 3HKEA 1GPBA 2Y4OA 4CEHB 2POQX 1GL9B 3SZLA 5MHTA 4NE9A 2ASEA 2C7VA 4M1ZA 5IZCC 1AU9A 3BRQA 3RT7A 1JAZA 1EFLA 3BT7A 1PNRA 1MABB 3I5AA 2CLMB 3AU9A 4PFKA 1ZIPA 4WUTA 4D44A 5AW0A 1Q1AA 2XT6A 1AY0A 2H0AA 1AK9A 1MB3A 4WOKA 5F9FA 4PHHA 1M67A 1J5PA 3DDOA 2C2BA 4KLNA 4RW0A 2ZWMA 2RK6A 3HVUA 2IHVA 5AKHA 4FDMA 4ZO6A 2YCBA 2DFTA 3DHYA 4KH0A 1PJTA 4RDXA 5F23A 1QVRA 5BMVB 2VZ8A 4R68A 4BMSA 4YBRA 2R1TB 1DARA 2A9QA 2WYHA 1YS1X 1R0CA 4B3FX 1V5EA 2C03A 4M86A 2XTAA 3SC3A 3FUTA 4D81A 2FN7A 4TS9A 4OMCA 1MQSA 3EPRA 4WLOA 3EOZA 4A0RA 4R9RA 1DE0A 1QC5B 2FLVA 1KOFA 3B85A 3CF2A 3OM8A 3R3HA 4JLMA 4Q3CA 3HFSA 4TKUB 3H9EO 3IDZA 2YVKA 3PNYA 4H7HA 1OLOA 3I01M 4CPDA 1NW4A 1PVDA 3ZV3A 1G9XA 2CUNA 4XA8A 1K88A 4ZOLB 2V7VA 4FNAA 3RK0A 4UBIA 3THYB 2B8TA 1TM5E 3ER6A 4XGNA 4XWTA 2FPOA 2HD4A 3DV0B 1VZ2A 3FGNA 3MIIA 5D2CA 3P5BA 4R8MA 3WKCA 3MAJA 4K0RA 5JQGA 4BPRA 3GJ0A 2WSSD 4TRRA 1ZIDA 4MI1A 1O9BA 2OV1A 2J3HA 4X7BA 2D1RA 1NPTO 3WHLA 3ZIAD 2OM6A 4CCWA 2AZXA 2H29A 4RPIA 3V7YA 3C6XA 3UC5A 2C0CA 5DPMA 2CNWA 2VP0A 4P38A 1LLCA 3W6UA 5C80A 4OXNA 4PLYA 2PUHA 5A3JA 1J21A 1PQWA 2H51A 3DPSA 4S2EA 2K7FA 4MUJA 4R1PA 1Z3IX 4UXHA 4FOSA 1E5VA 4K6MA 2YXPX 3E9RA 5C4IA 5F1YA 4D43A 5ALTA 3QMPA 1IHUA 5DXFA 2EJBA 3SDBA 1XTZA 4JGGA 5IBQA 4AI6A 4FS8A 1ECBA 2QLTA 3KDSE 3FHTA 1O5TA 1ST2A 2CNKA 3PPXA 4RMHA 3IEUA 4G5QA 2A7QA 3O93A 5FI3A 5BV2P 1QB7A 1W36B 4NBUA 1NWCA 3INGA 3GLIA 5ESXA 2ZYSA 4Q9DA 3S68A 5JMOA 1MRZA 5HZGA 4I4CA 3BORA 5K0CA 3W77A 4B6RA 7REQA 2JKZA 1G42A 4M8IA 4R1MA 2WD8A 3JPYA 4CL8A 2VVTA 1Q0LA 2Y1LA 4Q3KA 1NNLA 2Q5EA 4NK4A 3GLGA 1R4MB 4UU0A 2XXAB 2YV2A 3BEDA 1G3QA 4AL4A 2ZXUA 1P1BA 2D5BA 1FSPA 3H42B 2FPWA 1UJCA 1RHKA 1OFHA 4QNNA 1XCOA 2QJWA 3O8BA 3W8RA 3JQ6A 3LW8A 3M7IA 4ILKA 5JQGB 3QHAA 4TTIA 5ALPA 2I5PO 1XKTA 1B8VA 4HC4A 4U3JA 1VPEA 3V4ZA 1II0A 3BFVA 3FOCA 4RH3A 3EULA 3ZHRA 1KMHB 1PFYA 1YNOA 3DB1A 1FDRA 1K6MA 5EP2A 2J5QA 4IIGA 3VDQA 1K2NA 1JQDA 3HNOA 3CISA 2ZYVX 5KDOA 3AI7A 4KFTA 4ZYXA 3H5IA 1E6KA 4N49A 3B52X 3O8QB 1GPDG 5DO9A 3WYGA 2EL9A 2MIIA 1XRPA 1CJBA 2RKOA 1X8KA 1QHHB 3GPLA 1U0HC 2F9MA 1N92A 2W2VA 4YJDA 1HQDA 2DLCX 3ROKA 4OPMA 2XRYA 2PLWA 5CYOA 4MS4B 5CK4A 1Y7PA 1TADA 3GX1A 1C0EA 3VA7A 3ICCA 1KSFX 1ODJA 3DE0X 1YD7A 1MGOA 1UJBA 2BEVB 4YB8A 2O8VA 5IMSA 4M8NE 5LP1A 2X9GA 2GM5A 3IMCA 3RRBA 5EIBC 2CCJA 4AY2A 4F46A 2HMVA 4AIIA 2BLNA 3PL5A 1N0IA 2VPYA 4NMHA 4MPTA 1DCFA 4MRMB 4TYMA 3VV3A 1J99A 1NI3A 4Q21A 4DSOA 3FBTA 3WGKA 1PUXA 4XW2A 4GPZA 5BSTA 2BHLA 2JI9A 4P4GA 3F2IA 3GRPA 4RGVA 2GEFA 1N6OA 3IEKA 4R1NA 1NJ2A 3NBMA 4ZAFA 3FXAA 3PPYA 1RQPA 3FBGA 3NBYC 3BF7A 4L5JA 3S3TA 4NPCA 1O57A 3ZQJA 3Q9LA 3O4RA 4M7OA 4KYTA 5DI9A 3AK4A 1H65A 4QKQA 3QXSA 1YR9A 3OCUA 4PIPA 1SVLA 1P91A 2CVQA 4I7EA 4FGUA 3EXAA 1EJ2A 4Y2JA 3ZK8A 2UZ4A 1L5RA 4OYYA 4XVQA 3SJAA 1HETA 1Q12A 1H4SA 3VYRB 2PR2A 3EARA 3P0IA 4NEQA 1XDGA 1HH4A 2XWSA 2OG1A 2COKA 4L0CA 5HK9A 3M4JA 2E4AA 4IV0A 4NFHA 2ODQA 2ZR0A 2J46A 4TZ6A 1SOMA 2XMBA 3IT2A 3T54A 4ALNA 3ETNA 1F4PA 4BQNA 2PVCA 4RTNA 4MO2A 3I76A 3ZHZA 2P79A 4U1RA 3RT9A 2YZ2A 5I4BA 2XVYA 2MWMA 3CNLA 4L0DA 1KIMA 5CH5A 3V4FA 3VO1A 1J70A 2BRFA 2RGYA 2VF4X 4C14A 2SHKA 3H9JA 2XGGA 1GTJ1 4IOMA 4ZO7A 2D5IA 1EI9A 3HCCA 3DAGA 3LT2A 4I81A 5IEBA 5JUWA 1G6KA 3UXEA 1RM3A 5LUBA 3TL6A 2B5VA 2PGAA 3QWAA 4AUMA 2WWYA 5FYQA 5J4HA 4JJ6A 3NASA 4ARZB 1HUQA 1DLJA 2QTWB 2GEBA 1YR3A 1FX0A 5EUCA 2H2HA 4EFMA 1T4CA 2I7TA 1MQAA 2AX4A 3W8FA 5F77A 3BX1A 3H4TA 1V4VA 2OFXA 1R8SA 3WLPA 7MDHA 2VUTA 1PGQA 5TLSA 1KKMA 5GZ6A 2W2NA 2WPDA 1UPCA 4FW9A 4D0SA 3UPTA 1UXOA 1XTVA 3MRVA 2QSJA 3HNRA 4U39A 1F8FA 4WJLA 2OZPA 3MOSA 5FNZA 5C7OO 2M6SA 4ED9A 1ZK3A 4IXDA 2BELA 3BXZA 3EGOA 1XYVA 1M2VA 4PXAA 3U7FB 5EJIA 2RGUA 3NBFA 2FOIA 3WI7A 4ZICA 4EMSA 5JAHA 2H52A 4WXRA 4R81A 3FN4A 2PLFA 1I2MA 4IGEA 1P29A 2ZSDA 1DPGA 2ZUWA 3FVRA 4KEAA 3AEUA 2IS6A 1XC7A 2PKYX 1ZVQA 3CINA 2LWIA 4B6EA 4JEUA 1N5DA 2DR3A 2GCGA 3HSKA 1W1IA 1TK9A 2X1HA 3PWSA 4MCJA 4AUKA 4BAUA 1CUFA 1NLFA 2YOFA 4BGVA 1JH8A 3NUQA 1QOPB 2DQZA 3OI7A 4C6SA 1VL0A 2IEAA 4PC3A 3IBTA 3NBXX 4RS4A 1QYIA 4Z0PA 1DAPA 3K5IA 5CA0A 3FVQA 4TVSA 4GZ6A 1YASA 3U9LA 1V8PA 4MDEA 1WV1A 4YR9A 1MB9A 1NQVA 2ISQA 4HVLA 2O8DA 5K0SA 4OA8A 2R68A 5K05A 4I4IA 5JMWA 2VNJA 3BL8A 2B83A 1PK7A 2P91A 2WMDA 2YY6A 3QUTA 5BR8B 1W2HA 4EK9A 3RUHA 3L0BA 4AN4A 5IF9A 2Q4OA 1XRMA 4L07A 2Z95A 1D5CA 4GZ5A 1L5OA 1NE7A 2ORYA 1WE2A 2QW8A 2X0RA 3AR6A 1SHZA 4S1WA 1M2VB 3NIBA 1PJBA 4JKIA 3KUKA 3ZNNA 3RFXA 3QXHA 1A9XA 1PS0A 4LVOA 5K0EA 2W6JD 4RY8A 3WKBA 2FPXA 3GAFA 4GX1A 2AHOA 4A92A 4P3PA 1SKQA 3G2NA 3AEUB 5K0BA 3MJCA 7GPBA 2GDZA 3AHIA 2FWAA 3URMA 5ECDA 4KQFA 5DX8A 4YRFA 1GNQA 5FAKA 4FMDB 2F1IA 1YR7A 1NSTA 1A88A 1WP4A 2VDNB 3LL7A 4G4GA 4Z4IA 2BTEA 4ZEXA 4CQLA 4EHDA 3EDCA 3TMKA 4DUGA 2NUAA 4G9EA 3B6ZA 2PU5A 3FOAA 2RARA 1Q7EA 3IT3A 4B8WA 3VUEA 3FMPB 3EAGA 3GIWA 1U28C 3IJEB 5D51S 4E6EA 4IFBA 2O8DB 2YRFA 3QXJA 1EFDN 1SC9A 1Y1TA 2ODWA 3P2YA 5HG0A 2BFAA 4ASUA 1RT9A 3L79A 2YV1A 3JD3A 4IIJA 5HUHA 5JS8A 3KZMA 4QVGA 1IBCA 5AI0A 4AURA 2ZDGA 1BQ4A 1YZUA 3IODA 4LOKA 2XOXA 3OEHA 1QORA 5C5IA 3DBIA 1ZVKA 2QYTA 4K26A 1DXHA 2GUGA 1QQBA 5D01A 3E0QA 4CLOA 4MROA 5EAIA 2HF9A 2W6NA 5DE3A 3IB6A 3JYOA 2HA0A 3FPGA 4C5AA 1QHSA 1A9XB 1T2UA 1J9ZA 3PQ4A 4OGKA 1UT6A 3IIKA 3VJLA 4ENWA 3H4MA 4F04A 2DLDA 3WTBA 2F9LA 3ZDZB 1RMQA 4LDAA 2H2WA 3N9IA 3K0AA 1M6EX 4JROA 1DV1A 2IYZA 1L7VC 2V5UA 3O9VA 3PRJA 3I2HA 1KI3A 1NZJA 1SCBA 2RHBA 2VK4A 1RAAA 2JEZA 4WN3A 5HKOA 3AL3A 4BX9A 5EXSA 3BA1A 4DABA 1RC0A 1RI2A 2EW2A 1SB9A 4JL8A 4ZDKA 1BWRA 5BW8A 3I62A 4X64B 4YCAA 2OYCA 2ACVA 3L01A 4M1SA 2C7OA 2NUAB 3G1TA 1DO0A 1KARA 1L5KA 2BWJA 3FNEA 4LTNA 4QUJA 1TNDA 5E7MA 1JR3E 3L8HA 2DMRA 3LHIA 1HT0A 3T7DA 2P9ZA 4X3CA 4A82A 3F3YA 2XGOA 2F4NA 1CTQA 2IRWA 4JJEA 5ARBA 3GZNA 2JAUA 1OFVA 4PSVA 4IIJB 1CY7A 3UMBA 4BNUA 3H2JA 1K8YB 3B53X 3RSCA 3FCXA 2ENUA 2PZFA 4BO5A 1V96A 3TRHA 1CP3A 2WU3A 3DEYX 4DIUA 1ODCA 5BSRA 1PDOA 1HF3A 4UUOA 3H2BA 3GJTA 2LW7A 2OHGA 4UMVA 2B61A 1RRKA 1P4RA 2SECE 1ARZA 1ZBQA 2ZRGA 4L5IA 3P9IA 4IKPA 2RI6A 1WHTA 6GPBA 1I8TA 3AIOA 1HDXA 2QP9X 3DP9A 2ZJYA 1L7RA 1WCIA 4DRYA 3TW0A 4Y30A 2FPPA 4IVPA 2B8NA 3O73A 1OV6A 3OFVA 4YJHB 3K0AB 4M99A 5T6MA 4ZKDA 2GD2A 2J3MA 1FFCA 1LNQA 4B2YA 1AZSC 4FK8A 5JXIA 4FGKA 4WERA 1OBOA 4N0MA 4UNPA 3WGJA 3V46A 2V7XA 4MINA 4H17A 1SOAA 3BRWA 3PDIA 1HE4A 4JFRA 1MNQA 1RHJA 3GYBA 4MS1A 1PL6A 3OUTA 3TM4A 4DEVA 2BF7A 5BW5A 1RZRA 3AR9A 4IH4A 4BVJA 1IEWA 5E6UA 4TWAA 1XU7A 1USUA 2R87A 2J9FA 1PUJA 2Q0SA 3EXEA 1K4KA 1QK5A 1D6SA 1KU6A 5TR9A 2O59A 4WA7A 4O3MA 2Y1KA 2AXNA 4PANA 4DIKA 1WDWB 4R8VA 4ZU6X 4E51A 3GFQA 2IHZA 3KWJA 4RK1A 1CFZA 2P9CA 1JN0A 1W4LA 3HGQA 3IV6A 2D54A 3Q9UA 2AVDA 4O2BF 4QA9A 4OFXA 1JW9B 4JT2A 2HSGA 3WFJA 1R16A 3B6MA 3SEZA 5BW4A 821PA 1D2CA 1WXHA 4OU5A 1Y5IA 5JCPA 2RONA 3OCJA 1FU4A 1WHTB 3KQVA 1YE3A 4NPAA 3JV7A 4D92A 3ZU3A 2VPTA 3LSTA 1AOXA 1LDNA 4WOJA 1D9XA 2F6RA 4J8PA 1VJCA 1FCJA 1KYQA 2X4LA 2CXXA 2V6JA 1H8HA 3HU5A 4WLEA 4R2KA 1PTJC 4CUJA 1Z4MA 4NJOA 2WKQA 5JZVA 3EZYA 5AI4A 4MGEA 1L5HB 1SHLA 2BKAA 4CTMA 5CK5A 4WFKA 1VL8A 1TQ8A 2VHWA 3AMVA 2AG1A 1GM5A 2H7CA 2WY2D 3PDIB 1U1EA 2GO7A 4MS1B 3J81k 5DULA 4K05A 2ZQYA 2BRUA 1Y4UA 5ALFA 2PZLA 5AKZA 3HMKA 3TI7A 5DBIA 1Z4PX 1DQZA 4F4HA 1QCYA 5D7NA 2CWWA 2IYUA 3EXEB 3LUFA 3TE6A 4C0BA 1KHTA 1I6LA 5IWCA 3BKXA 1AG9A 2G9ZA 3A1FA 5CCDA 2WEKA 1XZFA 1PL8A 2DFPA 3FUWA 1OSNA 3TPZA 4BKUA 1LGYA 5JWOA 1GZSA 3RNOA 3TN7A 3DDHA 2W2KA 4DLYA 3O2SB 4JD5A 5HKAA 5C31A 1PFKA 1OU4A 4XLLA 5A71A 3W2HA 1U7TA 4D0LB 1PWEA 1BVRA 4HDOB 1S7GA 2RGNC 3DKPA 5H5JA 3VJMA 4Q47A 1I10A 2RJ3A 4HLDA 3GGCA 3CVVA 3VYTB 4Y6OA 5HF8A 1JH9A 5HXAA 2DAPA 2JFOA 4HWTA 1O9GA 2GAJA 4PX2A 2BM8A 1XTRA 4D8VA 4I1PA 3OE5A 5LIRA 1KJJA 5EQTA 1SZDA 3DLAA 3GGJA 4FMBB 4LN1A 2IYWA 4C9BA 1TYBE 4DA9A 4Z3KA 5SY6A 4LFCB 1OXBB 4HN2A 1GLGA 2ZI9A 3GJXC 3GEBA 2FWIA 2HDHA 1G2PA 1QTIA 3IBCA 1ANKA 3BIOA 3GFBA 3STVA 3I72A 3VKHA 1E2MA 4OP3A 1NULA 3A27A 1G0NA 2EWMA 3RC3A 2FDRA 3T3IA 1G64A 4TM7A 3RT1A 4U4AA 2JIRA 4LHVA 4OI2A 2GO1A 3REFA 5CDHA 4DDUA 4JFAA 4R8LA 5JU6A 1QFJA 1MIOB 4UXJA 1YE5A 2HHLA 4ZVOA 1XP5A 1IXRC 1M1NA 3OURA 2ANCA 4GL4A 1VZ3A 4DJJA 5GVRA 1RLTA 3IERA 5AXDA 2J1LA 1E1CB 2O8NA 4MUIA 3N0XA 2ZR9A 2W2KB 2E4XA 3RIHA 2NTNA 2WP0A 3AJ9A 2PD6A 5F64A 3X43A 1LXCA 1NXXA 1U2EA 1PJ3A 2CXNA 2FSPA 2H65A 2MYNA 4A5SA 3PFBA 1J6UA 5EHQA 4XGRA 1IJFA 4P7BA 4A6EA 2KKLA 1ACJA 4O4IA 4EG4A 1I4WA 1U2GA 4KO1S 3V1YA 3JQ7A 4R2HA 2NZWA 4XDYA 4M53A 3LPCA 5IHXA 1FDUA 3WO0A 1B43A 1WXGA 3QFRA 5I8ZA 3U7HB 4LYFA 4IGIA 1WU8A 5IXSA 1M33A 3FPCA 2WTUA 2HHHB 1K98A 1RS0A 2I3AA 1E9DA 1YZKA 1UEIA 2XCQA 4PNPA 3UMZA 1T2VA 5CGZA 5GVSA 1YAHA 3ZDAA 5HJ7A 8ADHA 3WL3A 2VNIA 5KJFA 4EB8A 5KVCA 1ZQ9A 3L4EA 5SV2A 1PL7A 3ICPA 4JIVD 1O8BA 4CEIA 1E18A 4UZSA 3IJ5A 2FMFA 3N2NA 4JX9A 1VJ1A 4JB2A 1OR8A 3L4KA 3SLKA 1OKKD 3SMQA 1ZUNB 3PHGA 1V9CA 1M1NB 1BXRA 3KOUA 3H1EA 1A82A 4RZSA 2VRBA 4WXMA 2WAYA 2P65A 1JHZA 4G8DA 3L7DA 3C3YA 1ELOA 2EU8A 2OA0A 1MVNA 3ZE1B 4CMBA 1X7WB 1XLVA 4E7OA 1ZJZA 5JI3E 1LBSA 1SK9A 1T6ZA 5FI5A 4X65B 3Q8WA 3IQEA 2XD9A 4Q1BA 3WIBA 4ZTZB 3GN2A 1RYNA 1XDBA 2PRSA 1E1RA 2W6IA 1O94D 2AN5A 4RJTA 4EI8A 5JZSA 1H22A 1D6MA 1UMBA 3SM3A 1ULZA 2FSFA 2OXCA 4YRZA 4ZEVA 4O4IB 3VPYA 2C31A 2GESA 1C1HA 1U4OA 3FUUA 3M33A 2XTZA 4M46A 3C3CA 5EZYB 5AJTA 4D6PA 4ZZIA 5CTJA 3WNQA 2B3TA 5AVOA 2P2ZA 2QKYA 2VQDA 5IAOA 2H00A 3FKJA 1LEHA 2JK0A 3D7LA 3HP1A 5E38A 3N6XA 3J81A 2W83A 5FH9A 4OVKA 3TCKA 2V8OA 4BV3A 1CJSA 4NAUA 4PYLA 3OIVA 4BQPA 3TZKA 1TAUA 1RHUA 1U0NA 2XUHA 1I7NA 1MDBA 3GLSA 3QY0A 1VLZA 1SG0A 1KAGA 3CM0A 5EEGA 1CRPA 4RD4A 1Z7EA 1HDCA 3AL2A 4LQ4A 4II3A 1O8CA 2DHEA 4B3CA 2VDOB 3N7UA 3R3SA 4DIBA 4PR0A 1QHEA 2E0IA 2EHDA 5I47A 3CZPA 3DDCA 1C1DB 1LW6E 1NUAA 3DMGA 4D8TA 2FUKA 1NT4A 1PZHA 2JGMA 1X1TA 3ESXA 3HN7A 1NBME 3CC8A 1QIIA 1XVUA 4EDHA 4G0UA 2X0NA 2DXIA 4QLAA 4Z4FA 3B1XA 1QPBA 2O07A 3GA5A 5MFZA 3F47A 4P35A 2VZLA 1NQOA 3FWPA 3ODGA 1A2BA 3S27A 4CMHA 1WY7A 2B4RO 1W34A 5ER6A 2XRZA 2HAEA 1UMBB 1P1IA 1ZZEA 4P3XA 3ZLJA 4C05A 1IHDA 3CG4A 3RQSA 1E4EB 5DCUA 1RPJA 2V59A 2PT6A 4FWBA 3RSZA 2IHNA 1T9GR 1DDOA 2R44A 2SCUA 4RKRA 4WEQA 4GGOA 2NV6A 1JSRA 4YRSA 5DNVA 3WKAA 2WLTA 1M76A 3GMJA 1GPMA 2W4MA 3AR8A 4FHGA 4KYIB 4LCEA 4RK7A 2OYRA 2P9EA 1XX6A 3V33A 4CLEA 2IL1A 2HHJA 1UKBA 3SGLA 5C8ZA 2P2CA 3O0TA 1FJ2A 1VSVA 1ZSNA 3DONA 1JUDA 2PQMA 1WEKA 3Q3GE 1KFJB 2UV8A 3WHPA 3WYDA 2IY8A 3LLVA 4O2BA 3EXG1 3FMIA 4BJ1A 2QMYA 4DLAA 1T1SA 4J75A 2BFDA 4CG3A 5C4VA 1G8GA 1ZD3A 1ZC4A 3IVAA 5IJ9B 1G3UA 2FZ5A 1TYZA 2WOJA 5FUBA 1V0JA 5B4TA 1IYZA 1YZLA 5IDVA 4FOOA 3BHJA 4H0CA 1IN8A 1VPVA 4D4JA 5AJZA 4IINA 4ZMBA 2WUDA 5KJ6A 9MHTA 1Q7BA 3AESA 1RQLA 2OHHA 2HH9A 3IAAA 5EA2A 1DMSA 2I3GA 2IE0A 4XTCS 2ONJA 1UM9A 2NSJA 2ZJ5A 3EIWA 4J9UE 3V8BA 3ZU5A 1MVOA 4Q9AA 3HCOA 2VDWA 4B45A 3H97A 5CNMA 4CCAA 2AEMA 2BGNA 1T1JA 3L7BA 4HB0A 2QRNA 1SOWA 5E1DA 1ADYA 3BWEA 4BB0A 6REQA 3E7PA 1IPEA 4K1LA 4KWEA 4MZDA 4BLQA 1BJTA 3W5VA 3T4UA 3B7PA 2NYUA 4JZKA 4P7JA 1Z4KA 4YFVA 4QOGA 3WXMA 3IEIA 4NJEA 1AS3A 2J5XA 3CPSA 2YV3A 4RMJA 1N6IA 2C2KA 1XQ9A 3L93A 1P5RA 1R37A 5INTA 1U2RA 5EKDA 4TVOA 3LF2A 3ROQA 2KHZA 5DEIA 1CZLA 4C07A 3BZBA 1BSVA 3P0JA 3QFTA 3KOMA 4A2PA 3SDZA 3VX4A 4RULA 2YDYA 3HZRA 1DELA 3WV4A 2QE6A 1S4MA 2QLBA 4TS3A 2WC1A 3HGMA 2FZWA 5JRZA 3CR7A 3OZUA 3LI2A 1N2EA 2PSSA 4O2AF 3SHVA 1N0UA 4WZBE 2BFDB 3ZE6A 3ZWNA 2HQBA 4DDKA 4QYSA 3GLQA 2O1WA 2CVZA 2X77A 4TXHA 1BCRA 2XAAA 4DA6A 5FTLA 4NV0A 3K9FC 4ZPJA 2XYPA 5KWJA 4GLJA 2CLEB 3MWGA 3QWIA 4YAOA 5DM70 4Q4HA 3ZWBA 4J0KA 1GUAA 1UEJA 2I80A 1VG1A 2Q0HA 3S8YA 1Z0SA 3BDAA 2NO1A 4C3UA 1JR2A 4URYR 1ZH4A 1X94A 3TKAA 1CP2A 2PUGA 1UM9B 4QASA 4JIWD 1RYHA 2XA2A 5HE9A 3RRYA 4RVFA 1RTTA 3LXUX 1ICEA 2VDWB 5B12A 3ZI0A 1D4AA 1SXJA 4J76A 1TKCA 6REQB 1LJ8A 3KXKA 5G0VA 2G67A 3CURA 3ACDA 3WY9A 5A0VA 1XZMA 1CRQA 1CNMA 3NBUA 2BFNA 4J0IA 2ZETA 2B78A 1SU4A 2GZAA 1W48A 2P2GA 1Z73A 3I32A 3MGAA 3OLWA 4PRKA 4Y9RA 2REQA 1N3LA 2PTGA 5ITZA 3KQHA 3IOEA 4W6ZA 3CUWA 3MWLA 3F3KA 4ZV9A 4E1VA 2AFFA 3VM6A 2CEKA 1PYDA 3G2LA 4KQ2A 1QK3A 4HG2A 5KX5F 4OQMA 5DN6D 4RVOA 3ZQ6A 3CUVA 4GGMX 2WQ7A 2F3QA 2CMKA 1UOOA 2OMKA 3L8CA 3GPBA 4ISBA 5G0TA 5M04A 1K7SN 3T7RA 1BRTA 4ZCTA 1KJIA 4GPD1 1U80A 4GE0A 3USZA 3C1AA 3AQIA 5CG1A 3DZIA 1Z16A 1LSOA 1Z5PA 1DL5A 2BGWA 3I6WA 1DUVG 4XR9A 2F00A 2NTJA 4Q4HB 3DEZA 3N8IA 4FLMA 1ENOA 2WRZA 3WRXA 2QM3A 3J7TA 3NLLA 1L7BA 2QRLA 3PYXA 3ND8A 4BKRA 3E8MA 4Q4JA 3G2KA 2HMSA 5BOVA 2HQOA 2IYFA 1RHRA 3QVTA 5K6AC 2XVZA 1RPZA 3C4VA 1QBKC 2ZGVA 1S1MA 3R7DA 1SXJB 2C9YA 4DGQA 3CLRD 4CV1A 3SNKA 1M6WA 4MWSA 3C8ZA 1EP9A 1GG8A 3Q8XB 4KWIA 4LV8B 3IYLW 5F7OA 1I32A 4ZQIA 1EFAA 1UQRA 3P9KA 3FCSB 5C18A 5A3VA 3A2NA 3W78A 3NWPA 4PZYA 5IAAA 4QFDA 2FWBA 3DL0A 2O06A 3AYZB 2D5LA 3TI9A 4NCHA 3BWYA 1P74A 1NR5A 2WM2A 1O94C 1HG1A 3GLKA 4L75A 1OH8A 2EJVA 2JIQA 3GRUA 5CXUA 1Y4SA 2WNSA 3FZNA 4PSAA 4PRLA 4TT3A 2IVFA 3PUJA 2K4MA 2IUFA 3D1JA 3GDOA 1B15A 4P5PA 2MSCB 4LXUA 5FBHA 5HOQA 1YBHA 1MO5A 2I6SA 2GEDA 3AG5A 3VC7A 2GM3A 4MJ7A 1JEAA 4P7GA 4X93A 1FRNA 3KQLA 4LF8B 1RP1A 1NA5A 2H06A 1NVUQ 1TEHA 4RORA 4X1IA 4R01A 3UMGA 4KB5A 5FBWB 2FR0A 2ZAYA 1BNCA 3DR5A 3ZHYA 3GDWA 1I7QB 3BFXA 4R9NA 5AHRA 3TNJA 1EPUA 2RGGA 3CR3C 1GTSA 2GNPA 2FLKA 1WKVA 3LCMA 4IIXA 4IGFA 1COWD 1K06A 2QJFA 3DF9A 1G8SA 4MW2A 4Q4JB 3UMRA 4BBPA 1P45A 2HCTA 4JL5A 4NZ9A 1WLSA 2FWJA 3RIMA 3CNOA 1WZ2A 2PY6A 1YHYA 1D0SA 1KZ1A 3KYDB 4GECA 4YAUA 4F11A 3W05A 2CJFA 5F9HA 5KNBD 3K96A 1Z62A 5AOVA 3JZAA 1BC5A 4YP6A 1QP7A 4UMFA 3KOXA 2DZDA 1UZMA 1C9KA 1G5QA 2E21A 2HF8A 4UTZA 1UC8A 1KAQA 3PLRA 4G25A 5BV1A 3W5AA 1PR3A 1Z6TA 4DLWA 3EY4A 4NYIQ 1P33A 4Z86A 4KVAA 3EZ9A 3GMSA 4JLAA 3VAZA 4ARUA 2HREA 3ENNA 3DDUA 4MK4A 1XEWX 3D5TA 2JHPA 2ZS9A 4EBBA 1K66A 3DW3X 1NATA 1U9YA 2DJIA 4MV6A 1SC6A 3Q0IA 3W2FA 2X8AA 3F90A 3ZDEA 4TTJA 5KO2A 3OKPA 4P4UA 2NYRA 3N76A 5ADVA 5EXEA 3B5IA 1GPKA 1Q3HA 3KZNA 4E07A 4KR3A 4AP6A 4EG0A 3O31A 1JHAA 2A59A 4R7TA 5LB2A 4QHSA 1Y7LA 5LQUA 3AY7A 1LD3A 2VH1A 2UYHA 1V1JA 2KBEA 2X9LA 3B3AA 3OEYA 2QBYA 5KNDH 1OYYA 2CFCA 1WMEA 2QSZA 3PNKA 4BMDA 3I45A 4W1RA 3ILXA 2K2WA 4LE1A 4X1IB 1QIMA 3DAHA 4YRRA 1YQUA 2GZHA 3I2IA 3PQEA 1E9BA 1T36A 1M5RA 2RGXA 1F1BA 1T10A 3DEIA 3X1ZA 5KKCA 4A8JA 1KMMA 2V3WA 4AS1A 4COKA 4U8HA 1P77A 2I2XB 3EVNA 5CFLA 3QBVA 5LJLA 2VDJA 3GFSA 2X23A 4NONA 3RVOA 3V7NA 3WDKA 4BMCA 3ONVA 3RPEA 3S7TA 3IDQA 1IXKA 2ZK7A 4XR4A 2B7LA 2IYQA 1UBUS 2ZR7A 1R8XA 2K2QB 2RFLA 3LBNA 3QITA 4I8XA 2FRDA 3QBEA 3SYMA 5FUQA 5J43A 2BKXA 3VH1A 2MSKA 4E11A 3AH8A 3FSGA 3IUBA 3TG2A 3UAYA 1IWOA 2QSYA 5FDFA 4LWZA 2CFRA 2KS6A 4MDHA 4G67A 4ER0A 1GWNA 4O8CA 3B12A 2BC9A 3T9DA 2JGKA 4KBFA 5D6NA 1L7QA 1NXOA 1YZGA 4OFBA 3UCEA 1N1MA 1YRAA 1TOAA 4UUQA 5TARA 3W6OA 2XZOA 2IELA 2V7EA 3MFQA 3FDXA 2WVAA 4TWBA 4YAFA 3KYCA 3VBEA 2NU7A 4J2OA 1ZJYA 2C8KA 1W47A 4DHEA 1DXYA 1A9RA 3TIIA 2V4ZA 3DH0A 3MNFA 5EOVA 3AERB 2ONYA 3RYFA 1NDUA 4J16C 4BO1A 2FG5A 1RQRA 2HJGA 1GPUA 1AMNA 2QW1A 3RRMA 1YZFA 1PQ4A 1UK7A 1CUZA 3NHRA 4DARA 4R8KA 1JJAA 1NSYA 4KODA 2XH8A 1AM4D 2CXQA 4G1CA 1UJ4A 2HLDA 2QK4A 2V58A 5JDCA 3CLKA 4K28A 1IM8A 1FTYA 3H1AA 1RWXA 2Q99A 1W1WA 5AQEA 5KJCA 1A1VA 3VHXA 1O54A 3ZTYA 3FD8A 3NKLA 4IDFA 4A8JB 4U7HA 3SMVA 4XDGA 1VJ0A 1KI2A 1W75A 2ISSD 4LRTB 1NJ5A 4QT4A 4M37A 5KSZA 2PUDA 5CM2Z 4D42A 2QAGA 1CC1S 3T15A 2QL7A 2X0EA 5CP8A 5EP1A 1M6YA 2V7QA 4F4CA 4XFKA 4DZTA 3A70A 3PZBA 4DYDA 2ZB7A 5AVXA 5BQ3A 3QEKA 3W04A 3VKFA 2CVHA 4O2AA 2YRXA 4Y1GA 4ZQGA 1R9GA 3VQTA 4FZJA 4UOEA 2JAQA 5LU8A 3HM9A 1VE7A 1Y5LA 2E4ZA 2GPTA 2LV8A 1Z08A 5IK2D 1MAWA 2HPZA 4PW0A 3ZBUA 3TW4A 3QTTA 4AMVA 2Q3CA 1HT1E 3HJGA 2GAAA 2JC3A 5FOSA 4LJSA 5B6JA 3CVYA 3SYRA 3ZVLA 1Q91A 1GPWB 4C01A 3CLTD 1I4OA 1Z75A 2PAFA 1CEXA 3CRZA 3TAUA 2ODPA 5B4VA 1BYIA 4MV9A 4MVJP 4GDMA 3D6UA 3DE3X 4EHFA 3PUVA 2NZJA 4CM8A 1JDJA 4LGVA 1KTIA 1Y3AA 4RY2A 4I50F 4JKOA 3ABOB 2ZIGA 5GGXA 4G23A 4E94A 2XCSB 3OOEA 5F76A 1XIVA 2ZUFA 2Q6VA 4RC9A 3LUBA 4RGYA 2R5NA 4GNRA 2OTCA 4RVSA 2UDPA 2K87A 3T7EA 2B21A 2GX6A 1JR3D 1BCSB 1XDSA 3B1FA 3VHXB 1N8SA 3THRA 1Y1RA 3X3HA 5A03A 5BWCA 2Q29A 1C14A 1NL3A 1Z5UA 3S2YA 1VG9B 1YSCA 5KVAA 3K9WA 3AHCA 2QAGB 1GXSB 1A7AA 2IYEA 1M7GA 4B8YA 5KX5A 4LI3X 4J2TA 1YZHA 3KOWA 1GYQA 5T3UA 3VR5A 5LXTF 1NLUA 4YRDA 5ICEA 1EH5A 4NBSA 5SYMA 5HZKA 1R4NA 2FW9A 4KRFA 4O2AB 1H66A 2CNLA 1HPLA 1XAGA 2FSVA 2IP2A 3Q3JB 4B0PA 4W5OA 4LXTA 2ZT5A 2BN4A 1GTG1 1AF4A 1DTSA 3CW2A 3UV7A 4OBBA 2A84A 4EPTA 3X1KA 4L6AA 4Q82A 3ICOA 5HOEA 4A0QA 3GLFE 5A0FA 3W06A 4DA7A 2MOKA 2I54A 3V1NA 4G5HA 1L5FA 1H2XA 3ROTA 1YKGA 2VHTA 3KR1A 1GU0A 9GPBA 4ZYTA 4M0EA 4G1MB 3RFFA 1PSDA 3LQ4A 1UFRA 3NBKA 1R6DA 3QTLA 3HXMA 2VDUE 3BK2A 3QHPA 4TMTA 1A50B 2I33A 3LY9A 1M7HA 1ULHA 4MCHA 1TQDA 1KJNA 1ZU4A 2Q62A 5E9AA 4TKVA 4JYAB 3KRTA 1YQQA 2DC1A 5IVDA 1VKOA 4A0SA 4E13A 1Z2PX 1AKVA 1NU6A 1V48A 4IDNA 3KSMA 5A4JA 1CHNA 2QIPA 3NHMA 3N2GB 2GH1A 3QE0A 4I5EA 3FVTA 2ZUEA 1I3CA 4WZAA 1MEJA 1NHGA 3LBAA 3LWNA 1E2LA 2FPIA 4LTDA 1N6LA 4NI5A 5EJ4A 3NNDA 1C81A 2ODTX 1NJ6A 6ABPA 4I2VA 4N8EA 4URFA 2FDXA 4EG3A 3FW1A 5EJ9A 4QEZA 3NV9A 1K4YA 3C39A 1BW9B 2KJQA 1AXEA 2QVYX 4L50A 5NLLA 3ZE2B 4AFNA 1TGVA 2VQEB 4N9WA 3L4JA 1PNVA 4ZQEA 3SC6A 5BP7A 2Z9BA 2EZ9A 1GZ7A 2QZ4A 4BNTA 2CF6A 2IYAA 2W2OA 1GTVA 4EHKA 5LSAA 3QIVA 4W5QA 4DNXA 5DLPA 2MCFA 4QFCA 3ZTWA 1AMUA 3LOQA 2VPQA 1Z82A 3HZZA 1ZW1A 1P5JA 3EH1A 4QFBA 4XX1A 1YGPA 3WZLA 3QVJA 2X22A 1T2DA 1T4GA 3UWSA 3I3OA 4BNFA 2BIFA 1AHIA 2HX1A 3W9BA 3EIUA 2RGDA 3EPKA 3L6DA 5BVGA 1WUTA 2I29A 1G63A 2UYOA 3DAFA 3GRKA 3NU1A 4EB0A 3WA7A 1AKTA 2E6UX 2XODA 2PKXA 1W5FA 3IRUA 4U7TB 2R25B 1YVRA 4AICA 4TKVB 1EAYA 3GVIA 2EQAA 1GKLA 2Z1DA 4H6WA 4KDFA 1V7QA 5AK3A 3UPDA 1NJ1A 3MYRA 4J43A 4QUGA 1RBYA 4O1IA 4CMEA 4D2IA 3MLBA 4BXOB 4IDOA 1I7DA 3ZW8A 2AL7A 3IPRA 3MPUA 5M2QA 4JI6B 1TVKA 2J4CA 2VHQA 1OXVA 3H4VA 3QQ5A 1HOTA 4AO7A 4BB6A 4Z7NB 4JI7B 1Y5RA 1Q1QA 3EEBA 2Q4RA 2FPIB 1ESCA 5EPUA 1GPAA 3GLVA 2IBTA 3I6IA 3ESZA 1SY7A 2PSEA 1MA0A 2QRQA 1B0UA 1JWAB 2WHPA 2ZU6A 3A9SA 1R10A 3NEAA 4QYIA 3IOMA 4UMDA 2C83A 1JFVA 1CRLA 2XUQA 1F38A 4UEOA 5HZHA 1OJ7A 1IHPA 2YWDA 3ME5A 4XDHA 3PC3A 4X44A 4BLTA 1FP1D 1TKBA 2NX2A 3B8EA 3P9YA 4JMPA 2XWJI 3S99A 2WU1A 3MM4A 1G7RA 4P32A 1IM2A 5F1KA 2BE7A 4QWWA 2WJ6A 4KN8A 3VAYA 3ZHXA 2WTMA 4V1CI 3N2LA 1WXDA 2F3RA 1QIDA 3WFZA 1NW7A 4EGJA 3DZHA 2Z9CA 4RWEA 1WXEA 3DOHA 4TXJA 1JHMA 3NHJA 2YASA 1A9TA 5JAOA 4N54A 3R7SA 1JDTA 3PD1A 3UF0A 1K86A 1VHDA 4NLLA 1XXLA 2IITA 1EWVA 3TLJA 5BVGB 1YFZA 1DHTA 1X77A 1R12A 5JSHA 1Z6QA 3CO5A 1POXA 4GM0A 3ZXXA 1ZR2A 1ECJA 3A26A 2L2QA 3SG0A 2G7MC 4MRSA 3URKA 4A16A 4EX7A 5KTMA 5JJCA 1N33B 5TPZA 1R0RE 4WK6A 5A5EA 1LK5A 4FI3C 3QU7A 1AT1A 3FNIA 4G8BA 1RWPA 3DZFA 1BH6A 2QDXA 2ABWA 3JQ9C 3DFKA 4KOAA 4HX5A 3BGVA 5FADA 2IV3A 2ZCUA 4XYBA 1U02A 5IM5A 2WNHA 4XH9B 4CN8A 4GH5A 4ARIA 1M2KA 3MS4A 4X94A 3UJHA 2JBAA 3OQ6A 4OA5A 2XQJA 3BE5A 3ND9A 5BN4B 1O96B 2WHPB 4XB1A 1XHLA 4QYIB 2HTEA 3DVRX 4XYGA 1TO1E 3WLQA 4CKXA 4HB3A 4NXMB 4GQBA 1E2BA 1J0BA 1YDGA 5CA0B 4KCGA 2G1LA 1NW6A 1DC7A 2NIPA 4LQDA 5FFNA 4CODB 4IIUA 4HTFA 4G2TA 5KJEA 4TQUS 6YASA 5AVTA 4FEEA 2OCXA 1IQUA 1Q6ZA 1I1OA 3DO6A 1J1ZA 3RVRA 3IA7A 2FR8C 5AICA 3LVFO 1VC2A 5H3CA 5BR4A 2JIZD 2QYOA 3RLIA 4JK3A 2QUZA 4NBVA 4ND3A 1FJXA 3ZLVA 5ALNA 1PHRA 3A4LA 3EYAA 1XWWA 4TMFA 2J8ZA 2RIRA 2NO5A 3ESAA 5FKJA 4FUTA 4A8TA 4ZQBA 3DCNA 3HM2A 1FMLA 4KXMA 4L0MA 10MHA 4INZA 5C8XA 3GAZA 4GW3A 1SCDA 2IU6A 2IY9A 4U2CA 1U7UA 4Q4CA 1FNSA 1NM5C 2GN2A 4O25A 2FMUA 3CLTC 3F7NA 2G09A 5HJ5A 4E32A 4JC5A 4EGFA 1AKWA 1WPXA 2C0PA 3I2KA 4NFYA 5IN5A 2JBAB 4RHUA 1AK2A 3DBVO 1V5WA 5LKAA 2H2DA 4QDXA 3GO4A 2QVXX 4B79A 4CEJA 4NU8X 1LA2A 3FFTA 1TX4B 4FGLA 4G3XA 3C6KA 2IDMA 2O0LA 3B9BA 3D0KA 4MKZA 5E4TA 3T3GA 1GT6A 1M10A 2EKPA 3NTLA 4I50A 4KFRA 5KWVA 4NTZA 5FBLB 1O95C 4GP6A 2E37A 2ZB4A 3QUAA 2BMDA 3R3JA 4L8GA 4L28A 1U8XX 2XUOA 3HCPA 1SGWA 4HLNA 4CM3A 1JALA 1B3BA 2EZTA 2IJGX 2XT0A 4IP0A 1UPUA 1NR7A 4P1ZA 1YB4A 1QIFA 1X86B 4WECA 5ECWA 1DU4A 1ZS9A 4QDKA 3NAGA 1U1FA 3A7EA 1ZOQA 2C92A 4LJ9A 5IVKA 3UV3A 2JCGA 3GDFA 3VSCA 3FNGA 4X7PA 4CDMA 5ELXA 4DQ0A 3OBBA 1YB6A 3I1FA 4YRQA 2R85A 3TLEA 2C4HA 2BZGA 4QSMA 1D09A 1OC4A 1HOXA 2HWKA 5IUKC 5LXTA 3DZDA 3UFXA 3G2PA 5EKTA 4G0QA 3T1TA 2J9RA 3TG8A 2CL0X 2R60A 2I4IA 3D6AA 3QKSA 4XAQA 4B6SA 1J8FA 1ORTA 2CNOA 4EA8A 2GOYA 1U2DC 2UU9B 3N8KA 2FPLA 3GT7A 3WK9A 2LKDA 4LDPA 1T35A 2AE2A 2XAUA 3JD2A 3O6VA 1GDHA 5G4LA 3MELA 2EFJA 5BT9A 5KI6A 1NBMD 1HE3A 1N2CB 3AM4A 2C5AA 4CEJB 4BEBA 3SZ3A 4JP2A 2WTXA 3VYWA 1XU4A 2VCEA 4B0OA 4IPTA 1YCDA 4S35A 4AXXA 3I6QA 2D1FA 4BU0A 1EP1B 1QSGA 3IURA 5EMMA 2EBFX 1G17A 2EP8A 4RLQA 5G53C 4U7WA 1JAYA 4R98A 2HT6A 4QJIA 3JWPA 4HNVA 5JS1A 2P11A 1E9RA 4A7PA 4FJ1A 4RMGA 2HRBA 5CHEA 2MR6A 3WBJA 5IG2A 1A0OA 3NNNA 3QKTA 4MEJA 4ZYVA 2VWPA 3R5TA 1FTNA 2QRKA 2JKDA 1HNWB 3FMOB 2CWDA 1ZOLA 2VF2A 4FPXA 4B5LA 3FZEA 1VB3A 3SZOA 3TW8A 3OPMA 1HT3A 3DUWA 4HWGA 2P5UA 3ONWA 1G5RA 5DEOA 3UUGA 3PFFA 2WHXA 4HXYA 1KDRA 3PDCA 1E3WA 4DR4B 1OHHA 4Z9XA 5TY0A 1AUVA 3UFXB 4O0LA 1MJNA 3HDJA 3BHMA 3QKSB 1W88A 1QMPA 1XZNA 4Q12A 3FYTA 3VR2A 3P2KA 2WQ6A 2O1EA 3CEPB 3NFYA 3E9NA 3R8XA 1U8EA 4FFLA 4JQZA 2R8EA 3GEIA 2IUYA 1OWLA 5IDYA 2OL4A 4HQKA 3C8MA 4X6YA 4U2DA 3HVRA 3FPKA 1MC5A 1ZK1A 2OV2A 1LDMA 3ZZ0A 1WUHS 1Z37A 3OPYI 3DEAA 3BIWA 3SSAA 2I8AA 3OZTA 1W93A 2GSDA 2I9PA 4IWNA 4KPUA 5THXA 4G5OA 4KNYA 5KWSA 2LUOA 4QELA 4X6LA 1AZTA 4IRMA 5LLTA 3U26A 5JEKA 1FRZA 4OREX 5B1DA 5AKKA 3IR6A 5CMLA 3JALA 4JLVA 1T2CA 2IFTA 2DX7A 4RZIA 4OY3A 4WW0A 1TUIA 2VP4A 1EG2A 4GMDA 4UEJA 2BZ1A 1U0OC 1Q57A 2RHDA 3ED1A 1U9IC 2EEPA 1KKLA 1JHRA 3C15C 4DPKA 5F9MA 4TWJA 1U5CA 1WL8A 5AKXA 3SHOA 2X0JA 3T3OA 1Q0TA 3TSAA 1QKIA 3TW8B 4C0QC 3JD0A 3B3JA 3FF1A 1ODIA 2YWBA 5ULLA 2H1CA 1U04A 2PWAA 3PF8A 1ZMOA 1UM8A 3LIIA 4GWLA 4JIGA 4AG6A 3AVTA 4XWGA 1DIBA 5LZ9A 1FTSA 1T9AA 3K8QA 5G41A 2P3SA 3CNNA 1DG3A 3KVRA 2P68A 3M6VA 3U60B 1E2JA 4EPVA 5EGSA 4YCBA 4KQCA 4NCIA 5ALVA 1EXDA 2XBLA 5C8YF 3AG6A 1K92A 2GPYA 1S8NA 5ALYA 3SFZA 2YNMA 2ERYA 1T2EA 1HEYA 1R8YA 3LCRA 3MUEA 4KIWA 1J1IA 4LZOA 1BMTA 4NCNA 4TV8F 3OT1A 4DV2B 1NV8A 1ATZA 3I37X 1A8SA 4EWLA 3H8VA 4N5MA 3DMNA 3PD0A 1ZKDA 2CJXA 3MWDA 3I53A 1U8UA 4RYLA 4DJAA 3KQUA 4PWYA 4DLZA 5IYZA 3DQPA 3OQIB 1HZZC 2QX7A 2GK7A 3BGDA 4FZ5A 4KLAA 3SX0A 3LP6A 4MPJA 3UHOA 3V1TC 4CIBA 3K20A 2ENWA 2HI0A 4AWXA 2EJCA 1IBSA 3BIXA 4KMOA 5ISMA 5I7VA 3RV4A 1YS9A 1UUFA 3JALB 4O8ZA 4LUCA 2GFQA 1RJGA 2XMSA 3E53A 1BDMA 5K2MA 1OPXA 3JYLA 1KY4A 3UH0A 4C06A 2O2DA 5I7UA 3H2KA 4IH9A 1FDTA 1Z35A 1NY5A 1DZIA 4N39A 4S1OA 4TMWA 1I4LD 1VJRA 3H9QA 5D87A 5F33A 3RFUA 1VLVA 2C5EA 1SULA 3W1EA 1JR4A 4V0OA 1XNRB 2F4VB 2JLWA 1YGSA 4TVKA 5IC4A 3HACA 1P31A 1GPH1 2WE7A 2PX8A 4PNHA 2Z04A 1LK7A 4XB6B 4WINA 4D4KA 1RE1A 1UJ2A 2R2GA 5DHUA 1Q0SA 4IFTA 2B9VA 4DDHA 5AUQA 3RC8A 2XSZA 2OCYC 3HDVA 3LZCA 3KQNA 1TQHA 5AUNB 2X0KA 4O2RA 1E3MA 4ZOCA 2HA7A 4O4JA 4U6SA 1OX6A 5EJMA 3TOVA 1QHXA 3CU5A 3DSRA 2W43A 3QX7A 2RK3A 3A1NA 4NWIA 3OT1B 4B6PA 2WP8J 3ENQA 3GT0A 1Q95A 4WADA 5F2EA 5K3CA 5MFPA 1W5BA 3W8EA 1WXXA 1YR2A 3ACCA 4KNWA 3V48A 1RE0A 3PFGA 4YVFA 5AHWA 5IYZB 2FEPA 1S2DA 2DT5A 4BE4A 1KWKA 4N0EA 5K20A 4I5IA 4N7BA 3F8SA 3ADOA 3PENA 2FH5B 3QNWA 5TVKA 4DIFA 3KPYA 4FKBA 4B43A 3HDYA 5JVDB 4D3FA 1F1JA 4K6OA 4KP7A 5T6BA 1TLLA 4IUCS 2P7HA 4YA6A 2PGJA 2O14A 3F6RA 2ZUVA 4E4TA 3QPDA 4M60A 1GUYA 3FVVA 5JAQA 2B4AA 2GCEA 5T3YA 3TEFA 4CCYA 3A3PA 3VR4A 4CT4B 1T13A 1N3YA 1HY3A 2CXRA 2WSBA 3DEFA 1WP9A 1AMOA 1URPA 1CR2A 2JZNA 2V7UA 3N8GA 4P2GA 1QOQB 4PYNA 3M4ZA 2XLCA 4FSHA 5JECA 2W6ZA 4PYQA 1H8EA 5L3SB 4QUBA 3DLHA 1BU8A 1E2UA 3KYBA 1AQ6A 2J5BA 2W00A